Fixed-time artificial insemination with estradiol and progesterone for Bos indicus cows II: strategies and factors affecting fertility.

Science.gov (United States)

Sá Filho, O G; Meneghetti, M; Peres, R F G; Lamb, G C; Vasconcelos, J L M

2009-07-15

In Experiments 1, 2, and 3, we evaluated the effects of temporary weaning (TW), equine chorionic gonadotropin (eCG), and follicle-stimulating hormone (FSH) treatments on results of a fixed-time artificial insemination (TAI) protocol in postpartum Bos indicus cows. In Experiment 1, treatment with 400 IU eCG or with TW for 48 h consistently improved pregnancy rates (PRs) at TAI, but, in Experiment 2, FSH treatment was less effective than eCG or TW. In Experiment 3, the inclusion of eCG treatment in cows subjected to TW did not improve PRs. We concluded that TW or 400 IU eCG should be included in the TAI protocol in postpartum Bos indicus cows to enhance fertility. In Experiment 4, we used records from heifers and cows treated with the proposed protocol during the 2006-2007 (n=27,195) and 2007-2008 (n=36,838) breeding seasons from multiple locations in Brazil to evaluate factors potentially affecting PRs. Overall PR at TAI was 49.6% (31,786 of 64,033). Pregnancy rate differed (Pcow group within farm, by breed (Bos indicus, 48.3% [26,123 of 54,145]; Bos taurus, 61.7% [3652 of 5922]; and crossbred Bos indicus x Bos taurus, 50.7% [2011 of 3966]), category (nulliparous, 39.6% [2095 of 5290]; suckled primiparous, 45.2% [3924 of 8677]; suckled multiparous, 51.8% [24,245 of 46,767]; and nonsuckled multiparous, 46.1% [1522 of 3299]), body condition score at TAI ( or =3.5, 52.7% [9419 of 17,881]). Days postpartum at beginning of protocol did not affect PR (30 to 60 d, 47.6% [4228 of 8881]; 61 to 90 d, 51.7% [16,325 to 31,572]; and 91 to 150 d, 50.8% [7616 to 14,991]; P>0.1). Pregnancy rate was also consistently affected (P<0.01) by sire (results ranging from 7.2% to 77.3%) and artificial insemination technician (results ranging from 15.1% to 81.8%).

Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

Science.gov (United States)

Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

Obtenção de oócitos e produção in vitro de embriões em doadoras lactantes da raça Gir (Bos taurus indicus)

OpenAIRE

Ferreira, Marcos Brandão Dias [UNESP

2011-01-01

Raças zebuínas (Bos taurus indicus) e seus cruzamentos têm papel fundamental na pecuária brasileira, e a raça Gir, em especial, acrescenta rusticidade e produtividade nas suas descendentes leiteiras. A produção in vitro de embriões bovinos é uma biotécnica de alto valor econômico, que, aliada à utilização de sêmen sexado para cromossoma X, possibilita a multiplicação com fêmeas de valor genético superior. Foram realizados dois experimentos com o objetivo de avaliar a produção in vitro (PIV) d...

Polymorphism and Mobilization of Rransposons in Bos taurus

DEFF Research Database (Denmark)

Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10...

Cattle phenotypes can disguise their maternal ancestry.

Science.gov (United States)

Srirattana, Kanokwan; McCosker, Kieren; Schatz, Tim; St John, Justin C

2017-06-26

Cattle are bred for, amongst other factors, specific traits, including parasite resistance and adaptation to climate. However, the influence and inheritance of mitochondrial DNA (mtDNA) are not usually considered in breeding programmes. In this study, we analysed the mtDNA profiles of cattle from Victoria (VIC), southern Australia, which is a temperate climate, and the Northern Territory (NT), the northern part of Australia, which has a tropical climate, to determine if the mtDNA profiles of these cattle are indicative of breed and phenotype, and whether these profiles are appropriate for their environments. A phylogenetic tree of the full mtDNA sequences of different breeds of cattle, which were obtained from the NCBI database, showed that the mtDNA profiles of cattle do not always reflect their phenotype as some cattle with Bos taurus phenotypes had Bos indicus mtDNA, whilst some cattle with Bos indicus phenotypes had Bos taurus mtDNA. Using D-loop sequencing, we were able to contrast the phenotypes and mtDNA profiles from different species of cattle from the 2 distinct cattle breeding regions of Australia. We found that 67 of the 121 cattle with Bos indicus phenotypes from NT (55.4%) had Bos taurus mtDNA. In VIC, 92 of the 225 cattle with Bos taurus phenotypes (40.9%) possessed Bos indicus mtDNA. When focusing on oocytes from cattle with the Bos taurus phenotype in VIC, their respective oocytes with Bos indicus mtDNA had significantly lower levels of mtDNA copy number compared with oocytes possessing Bos taurus mtDNA (P cattle with a Bos taurus phenotype. The phenotype of cattle is not always related to their mtDNA profiles. MtDNA profiles should be considered for breeding programmes as they also influence phenotypic traits and reproductive capacity in terms of oocyte quality.

Recombinant lactoferrin (Lf) of Vechur cow, the critical breed of Bos indicus and the Lf gene variants.

Science.gov (United States)

Anisha, Shashidharan; Bhasker, Salini; Mohankumar, Chinnamma

2012-03-01

Vechur cow, categorized as a critically maintained breed by the FAO, is a unique breed of Bos indicus due to its extremely small size, less fodder intake, adaptability, easy domestication and traditional medicinal property of the milk. Lactoferrin (Lf) is an iron-binding glycoprotein that is found predominantly in the milk of mammals. The full coding region of Lf gene of Vechur cow was cloned, sequenced and expressed in a prokaryotic system. Antibacterial activity of the recombinant Lf showed suppression of bacterial growth. To the best of our knowledge this is the first time that the full coding region of Lf gene of B. indicus Vechur breed is sequenced, successfully expressed in a prokaryotic system and characterized. Comparative analysis of Lf gene sequence of five Vechur cows with B. taurus revealed 15 SNPs in the exon region associated with 11 amino acid substitutions. The amino acid arginine was noticed as a pronounced substitution and the tertiary structure analysis of the BLfV protein confirmed the positions of arginine in the β sheet region, random coil and helix region 1. Based on the recent reports on the nutritional therapies of arginine supplementation for wound healing and for cardiovascular diseases, the higher level of arginine in the lactoferrin protein of Vechur cow milk provides enormous scope for further therapeutic studies. Copyright © 2011 Elsevier B.V. All rights reserved.

Differential abundances of four forms of Binder of SPerm 1 in the seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability.

Science.gov (United States)

Magalhães, Marcos Jorge; Martins, Leonardo Franco; Senra, Renato Lima; Santos, Thaís Ferreira Dos; Okano, Denise Silva; Pereira, Paulo Roberto Gomes; Faria-Campos, Alessandra; Campos, Sérgio Vale Aguiar; Guimarães, José Domingos; Baracat-Pereira, Maria Cristina

2016-08-01

The Binder of SPerm 1 (BSP1) protein is involved in the fertilization and semen cryopreservation processes and is described to be both beneficial and detrimental to sperm. Previously, the relationship of BSP1 with freezability events has not been completely understood. The objective of this work was to determine the differential abundance of the forms of the BSP1 protein in cryopreserved seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability using proteomics. A wide cohort of adult bulls with high genetic value from an artificial insemination center was used as donors of high quality, fresh semen. Nine bulls presenting different patterns of semen freezability were selected. Two-dimensional gel electrophoresis showed differential abundance in a group of seven protein spots in the frozen/thawed seminal plasma from the bulls, ranging from 15 to 17 kDa, with pI values from 4.6 to 5.8. Four of these spots were confirmed to be BSP1 using mass spectrometry, proteomics, biochemical, and computational analysis (Tukey's test at P semen freezability and its absence in bulls presenting high semen freezability. This is the first report showing that more than two forms of BSP1 are found in the seminal plasma of Nelore adult bulls and not all animals have a similar abundance of each BSP1 form. Different BSP1 forms may be involved in different events of fertilization and the cryopreservation process. Copyright © 2016 Elsevier Inc. All rights reserved.

Evidence of Bos javanicus x Bos indicus hybridization and major QTLs for birth weight in Indonesian Peranakan Ongole cattle.

Science.gov (United States)

Hartati, Hartati; Utsunomiya, Yuri Tani; Sonstegard, Tad Stewart; Garcia, José Fernando; Jakaria, Jakaria; Muladno, Muladno

2015-07-04

Peranakan Ongole (PO) is a major Indonesian Bos indicus breed that derives from animals imported from India in the late 19(th) century. Early imports were followed by hybridization with the Bos javanicus subspecies of cattle. Here, we used genomic data to partition the ancestry components of PO cattle and map loci implicated in birth weight. We found that B. javanicus contributes about 6-7% to the average breed composition of PO cattle. Only two nearly fixed B. javanicus haplotypes were identified, suggesting that most of the B. javanicus variants are segregating under drift or by the action of balancing selection. The zebu component of the PO genome was estimated to derive from at least two distinct ancestral pools. Additionally, well-known loci underlying body size in other beef cattle breeds, such as the PLAG1 region on chromosome 14, were found to also affect birth weight in PO cattle. This study is the first attempt to characterize PO at the genome level, and contributes evidence of successful, stabilized B. indicus x B. javanicus hybridization. Additionally, previously described loci implicated in body size in worldwide beef cattle breeds also affect birth weight in PO cattle.

Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

Directory of Open Access Journals (Sweden)

Aparecida Carla de Moura

1999-01-01

Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

Clotting of cow (Bos taurus) and goat milk ( Capra hircus ) using ...

African Journals Online (AJOL)

The ease to locally produce kid rennet contrary to that of calve has led us to compare the proteolytic and clotting activities of these two rennets depending on their action on goat (Capra hircus) milk and cow (Bos taurus) milk. The proteolysis was measured by determining the increase of non-protein nitrogen according to the ...

Phylogenetic relationships of Malayan gaur with other species of the genus Bos based on cytochrome b gene DNA sequences.

Science.gov (United States)

Rosli, M K A; Zakaria, S S; Syed-Shabthar, S M F; Zainal, Z Z; Shukor, M N; Mahani, M C; Abas-Mazni, O; Md-Zain, B M

2011-03-22

The Malayan gaur (Bos gaurus hubbacki) is one of the three subspecies of gaurs that can be found in Malaysia. We examined the phylogenetic relationships of this subspecies with other species of the genus Bos (B. javanicus, B. indicus, B. taurus, and B. grunniens). The sequence of a key gene, cytochrome b, was compared among 20 Bos species and the bongo antelope, used as an outgroup. Phylogenetic reconstruction was employed using neighbor joining and maximum parsimony in PAUP and Bayesian inference in MrBayes 3.1. All tree topologies indicated that the Malayan gaur is in its own monophyletic clade, distinct from other species of the genus Bos. We also found significant branching differences in the tree topologies between wild and domestic cattle.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Science.gov (United States)

Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

2016-01-01

The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

crossbreeding wit}i africander dam as basis . 3. post-weaning ...

African Journals Online (AJOL)

'n stelsel van rntensiewe vetmesting, het laasgenoemde drie 8os taurus vaarras nageslaggroepe opvallend beter presteer as eersgenoemde twee Bos indicus vaarras nageslaggroepe. Onder ekstensiewe veldtoestande het alle krusgeteelde groepe egter die Afrikanerkontroles geklop. Die nageslag van beide Bos indicus ...

Detection and quantification of Duffy antigen on bovine red blood cell membranes using a polyclonal antibody

Directory of Open Access Journals (Sweden)

Ana Teresa B.F. Antonangelo

2012-09-01

Full Text Available Babesiosis is one of the most important diseases affecting livestock agriculture worldwide. Animals from the subspecies Bos taurus indicus are more resistant to babesiosis than those from Bos taurus taurus. The genera Babesia and Plasmodium are Apicomplexa hemoparasites and share features such as invasion of red blood cells (RBC. The glycoprotein Duffy is the only human erythrocyte receptor for Pasmodium vivax and a mutation which abolishes expression of this glycoprotein on erythrocyte surfaces is responsible for making the majority of people originating from the indigenous populations of West Africa resistant to P. vivax. The current work detected and quantified the Duffy antigen on Bos taurus indicus and Bos taurus taurus erythrocyte surfaces using a polyclonal antibody in order to investigate if differences in susceptibility to Babesia are due to different levels of Duffy antigen expression on the RBCs of these animals, as is known to be the case in human beings for interactions of Plasmodium vivax-Duffy antigen. ELISA tests showed that the antibody that was raised against Duffy antigens detected the presence of Duffy antigen in both subspecies and that the amount of this antigen on those erythrocyte membranes was similar. These results indicate that the greater resistance of B. taurus indicus to babesiosis cannot be explained by the absence or lower expression of Duffy antigen on RBC surfaces.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Directory of Open Access Journals (Sweden)

Cristina Ballarin

Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore ( Bos indicus) beef cattle

NARCIS (Netherlands)

Rosa, A.J.M.; Bijma, P.; Oliveira, H.N.; Lobo, R.B.; Arendonk, van J.A.M.

2007-01-01

We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET) closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS) of Nellore (Bos indicus) beef cattle embryos prior to transplantation to reduce the age at first calving

Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

Science.gov (United States)

Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

Directory of Open Access Journals (Sweden)

Chase A. Runyan

2017-12-01

Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

DIVERSIDAD GENÉTICA ENTRE SUBPOBLACIONES RACIALES BOVINAS DE COSTA RICA

Directory of Open Access Journals (Sweden)

Marco Martínez

2015-01-01

Full Text Available El objetivo del estudio fue cuantificar la diversidad genética entre 16 subpoblaciones raciales bovinas de Costa Rica, con base en 1412 muestras de ADN bovino de todo el país, evaluadas mediante 18 marcadores microsatélites. El número promedio de alelos (Na por locus dentro de raza fue de 10,3, que varían entre 8 (Holstein×Jersey y 13 (Criolla para doble propósito. El número promedio de alelos efectivo (Ne fue de 5,04, con cambios entre 4,18 (Jersey y 5,64 (Bos taurus×Bos indicus. La heterocigosidad observada promedio fue de 0,77, variando entre 0,73 (Jersey y 0,81 (Bos taurus×Bos indicus. La heterocigosidad esperada (He promedio fue de 0,78, que oscilan entre 0,74 (Jersey y Holstein×Jersey y 0,81 (Bos taurus×Bos indicus, Criolla para doble propósito y Cruces para doble propósito. El contenido de información polimórfica (PIC fue de 0,76, con variaciones entre 0,71 (Jersey y Holstein×Jersey y 0,79 (Criollas para doble propósito y Cruces para doble propósito. El FIS promedio fue de 0,02, con oscilaciones entre -0,03 (Holstein×Jersey a 0,04 (Brahman, Criolla para carne y Cruces para leche. La desviación del equilibrio Hardy Weinberg no fue significativa (p>0,05 en la mayoría de los loci para las subpoblaciones raciales. El subgrupo con mayor número de loci en desequilibrio fue Jersey (8 loci, mientras que los subgrupos Bos taurus×Bos indicus, Criolla para leche y Holstein×Jersey presentaron solo 1 locus en desequilibrio. Los índices de fijación FIS (0,02, FIT (0,05 y FST (0,03 indicaron cierta tendencia hacia la homocigosidad. Los dendrogramas mostraron 3 agrupaciones raciales claramente diferenciadas que coinciden con las razas de origen Bos taurus, Bos indicus y sus respectivos cruces. Los resultados del análisis indicaron que el número de microsatélites empleados sí permitió establecer una discriminación clara a nivel de las frecuencias alélicas y en la distribución del tamaño de los alelos entre las

Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2012-02-01

Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

Tractus génital des vaches zébus (Bos indicus) au Niger.

OpenAIRE

Moussa Garba, Mahamadou; Marichatou, H; Issa, M; Abdoul Aziz, ML; Hanzen, Christian

2013-01-01

Les caractéristiques anatomiques et les structures ovariennes et pathologiques du tractus génital de 500 femelles zébus (Bos indicus), appartenant à quatre races bovines (Azawak, Bororo, Djelli, Goudali), ont été étudiées à l’abattoir de Niamey au Niger du 15 août au 15 décembre 2011. Chaque animal a été examiné avant abattage. Ces vaches et génisses, âgées en moyenne de 8 ± 2,5 ans, ont eu une note d’état corporel moyenne de 1,6 ± 0,6 et un poids moyen de carcasse de 113 ± ...

Absence of heat intolerance (panting) syndrome in foot-and-mouth disease-affected Indian cattle (Bos indicus) is associated with intact thyroid gland function.

Science.gov (United States)

Maddur, M S; Rao, S; Chockalingam, A K; Kishore, S; Gopalakrishna, S; Singh, N; Suryanarayana, V V S; Gajendragad, M R

2011-06-01

Foot-and-mouth disease (FMD) is a highly contagious and economically important viral disease with high morbidity and reduced productivity of affected animals. We studied the heat intolerance (HI) (panting) syndrome and the effect of FMD virus (FMDV) infection on thyroid gland function in Indian cattle (Bos indicus). Experimental infection with FMDV Asia 1 resulted in a mild form of disease with superficial lesions. Heat intolerance syndrome and its signs were not observed among the recovered animals. Subtle changes in the serum level of thyroid hormones, triiodothyronine (T₃) and thyroxine (T₄) were observed. However, there were no distinct histological changes in the thyroid gland, and FMDV antigens were not detected in the thyroid tissues. Our results thus suggest that the absence of panting syndrome in FMD-affected Bos indicus cattle may be associated with intact thyroid gland function.

Independent mitochondrial origin and historical genetic differentiation in North Eastern Asian cattle.

Science.gov (United States)

Mannen, H; Kohno, M; Nagata, Y; Tsuji, S; Bradley, D G; Yeo, J S; Nyamsamba, D; Zagdsuren, Y; Yokohama, M; Nomura, K; Amano, T

2004-08-01

In order to clarify the origin and genetic diversity of cattle in North Eastern Asia, this study examined mitochondrial displacement loop sequence variation and frequencies of Bos taurus and Bos indicus Y chromosome haplotypes in Japanese, Mongolian, and Korean native cattle. In mitochondrial analyses, 20% of Mongolian cattle carried B. indicus mitochondrial haplotypes, but Japanese and Korean cattle carried only B. taurus haplotypes. In contrast, all samples revealed B. taurus Y chromosome haplotypes. This may be due to the import of zebu and other cattle during the Mongol Empire era with subsequent crossing with native taurine cattle. B. taurus mtDNA sequences fall into several geographically distributed haplogroups and one of these, termed here T4, is described in each of the test samples, but has not been observed in Near Eastern, European or African cattle. This may have been locally domesticated from an East Eurasian strain of Bos primigenius.

Resposta superovulatória na primeira onda de crescimento folicular em doadoras Nelore (Bos indicus)

OpenAIRE

Luiz Fernando Tonissi Nasser

2006-01-01

Três experimentos foram realizados para testar a hipótese de que a resposta superestimulatória de doadoras Nelore (Bos indicus) com tratamentos iniciados próximo à ovulação durante a primeira onda de crescimento folicular seria maior ou comparável àquela decorrente de tratamentos convencionais. Os animais foram aleatoriamente alocados em três grupos. As doadoras dos Grupos 1 - Onda 1 s/P4 e 2 - Onda 1 c/P4 foram superestimuladas na primeira onda de crescimento folicular, e as do Grupo 3 - Sin...

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

NARCIS (Netherlands)

Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

2014-01-01

Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

Biochemical polymorphism in Egyptian Baladi cattle and their relationship with other breeds.

Science.gov (United States)

Graml, R; Ohmayer, G; Pirchner, F; Erhard, L; Buchberger, J; Mostageer, A

1986-01-01

Gene frequencies were estimated in a sample of Baladi cattle for milk proteins, blood proteins and blood groups. Gene frequency estimates of Bos taurus, Bos indicus and Sanga breeds were assembled from the literature. The gene frequencies were utilized for estimating the genetic distance between the breeds and breed groups. The Egyptian Baladi cattle appeared to be closer to Bos taurus breeds than to the Sanga. They are far removed from Zebus.

Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

Directory of Open Access Journals (Sweden)

Gustavo Gasparin

2005-12-01

Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

Breeding programs for the main economically important traits of zebu dairy cattle

OpenAIRE

Ariosto Ardila Silva

2010-01-01

In tropical regions, Gyr and Guzerat breeds (Bos indicus) are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically...

Marginal costs of abating greenhouse gases in the global ruminant livestock sector

NARCIS (Netherlands)

Henderson, B.; Falcucci, A.; Early, L.; Gerber, P.J.

2017-01-01

Livestock [inclusive of ruminant species, namely cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), goats (Capra hircus), and buffaloes (Bubalus bubalis), and non-ruminant species, namely pigs (Sus scrofa domesticus) and chickens (Gallus domesticus)] are both affected by climate change and

Objective Measures for the Assessment of Post-Operative Pain in Bos indicus Bull Calves Following Castration

Science.gov (United States)

Musk, Gabrielle C.; Hyndman, Timothy H.; Lehmann, Heidi S.; Tuke, S. Jonathon; Collins, Teresa; Johnson, Craig B.

2017-01-01

Simple Summary Surgical castration of cattle is a common husbandry procedure, and although this procedure is known to cause pain in cattle and other species, in some countries it is often performed without anaesthesia or analgesia. Society is increasingly aware of this animal welfare issue and it is creating pressure to drive research into animal welfare science with the aim of identifying practical and economical approaches to pain management in livestock. To effectively manage pain, a pain assessment must be performed. Pain assessment methods are often subjective and therefore influenced by the observer. Ideally, objective assessments that generate consistent and repeatable results between observers should be identified. Bos indicus bull calves were divided into four groups: no castration (NC, n = 6); castration with pre-operative local anaesthetic (CL n = 12); castration with pre-operative anti-inflammatory medication (CM, n = 12); and, castration without pain relief (C, n = 12). A range of objective assessments was performed: bodyweight measurements, activity, and rest levels, and four different compounds in the blood. The results of this study suggest that animals rest for longer periods after the pre-operative administration of anti-inflammatory medication. The other objective assessments measured in this study were not able to consistently differentiate between treatment groups. These findings emphasise the need for alternative quantifiable and objective indicators of pain in Bos indicus bull calves. Abstract The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6); castration with pre-operative lidocaine (CL, n = 12); castration with pre-operative meloxicam (CM, n = 12); and, castration alone (C, n = 12). Bodyweight was measured regularly and pedometers provided data on activity and rest from day −7 (7 days prior to surgery) to 13. Blood

Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

DEFF Research Database (Denmark)

Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

2013-01-01

Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...

Effect of Concentrate Supplementation on Reproductive ...

African Journals Online (AJOL)

A study was conducted in Rungwe district in Tanzania, to assess the effect of concentrate supplementation on reproductive performance of smallholder dairy cattle. Cattle used were crossbreds, mainly between Friesian (Bos taurus) and indigenous Tanzania Short Horn Zebu (Bos indicus). All animals were managed under ...

The power and pain of market-based carbon policies

NARCIS (Netherlands)

Henderson, B.; Golub, A.; Pambudi, D.; Hertel, T.; Godde, C.; Herrero, M.; Cacho, O.; Gerber, P.

2018-01-01

The objectives of this research are to assess the greenhouse gas mitigation potential of carbon policies applied to the ruminant livestock sector [inclusive of the major ruminant species—cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), and goats (Capra hircus)]—with particular emphasis on

Genomic divergence of indicine and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically adapted Bos primigenius indicus. Human selection exponentially...

Estudo genômico do nível de infecção por Babesia bovis em bovinos da raça angus

OpenAIRE

Santana, Clarissa Helena [UNESP

2016-01-01

A bovinocultura é um setor com importante destaque no agronegócio brasileiro. O carrapato Ripicephalus (Boophilus) microplus é responsável por perdas econômicas significativas aos pecuaristas e é vetor de hemoparasitoses como Anaplasma spp e Babesia spp. Sabe-se que os bovinos Bos taurus taurus são mais susceptíveis à infestação por carrapatos do que Bos taurus indicus. Acredita-se que o mesmo ocorra para a infecção por Babesia bovis. Neste trabalho, foram avaliados, em duas colheitas, 355 bo...

Morphological dimorphism in the Y chromosome of "pé-duro" cattle in the Brazilian State of Piauí

Directory of Open Access Journals (Sweden)

Carmen M.C. Britto

1999-09-01

Full Text Available "Pé-duro" (hard foot is a rare breed of beef cattle of European (Bos taurus taurus origin, originated in northern and northeastern Brazil. Y chromosome morphology, outer genital elements and other phenotypic characteristics were examined in 75 "pé-duro" bulls from the Empresa Brasileira de Pesquisa Agropecuária (Embrapa herd in the Brazilian State of Piauí. The purpose was to investigate possible racial contamination with Zebu animals (Bos taurus indicus in a cattle that has been considered closest to its European origin (B. t. taurus. The presence of both submetacentric and acrocentric Y chromosomes, typical of B. t. taurus and B. t. indicus, respectively, and the larger preputial sheath in bulls with an acrocentric Y chromosome indicated racial contamination of the "pé-duro" herd with Zebu cattle. Phenotypic parameters involving horn, dewlap, ear, chamfer, and coat color characteristics, indicative of apparent racial contamination, were not associated with acrocentric Y chromosome.Um plantel de touros "pé-duro", consistindo de 75 animais do núcleo da Embrapa envolvido com a preservação desse gado no Estado do Piauí, foi examinado quanto à morfologia do seu cromossomo Y, bem como em relação a elementos da genitália externa e outras características fenotípicas dos machos. O objetivo era investigar a contaminação racial por animais zebuínos (Bos taurus indicus num gado bovino que tem sido considerado mais próximo de sua origem européia (Bos taurus taurus. Tanto a forma submetacêntrica quanto a forma acrocêntrica do cromossomo Y, típicas das sub-espécies B. t. taurus e B. t. indicus, respectivamente, bem como maior bainha prepucial nos espécimes portadores do cromossomo Y acrocêntrico, indicativa de contaminação racial por gado zebuíno, foram detectadas no rebanho "pé-duro" mantido no núcleo da Embrapa. Outras características fenotípicas analisadas que podem informar sobre a contaminação racial aparente n

9 CFR 94.0 - Definitions.

Science.gov (United States)

2010-01-01

... than poultry or game birds). Bovine. Bos taurus, Bos indicus, and Bison bison. Bovine spongiform... loaded with meat product, or the areas at various points along the belt in an oven chamber, slowest to.... Game birds. Migratory birds, including certain ducks, geese, pigeons, and doves (“migratory” refers to...

Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

Science.gov (United States)

There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

Risk factors related to resistance to Rhipicephalus (Boophilus microplus and weight gain of heifers

Directory of Open Access Journals (Sweden)

Jenevaldo Barbosa da Silva

2015-08-01

Full Text Available The aim of the present study was to evaluate the influence of age and genetics in dairy heifers on resistance to the cattle tick Rhipicephalus (Boophilus microplus and correlate these parameters with weight gain. Twenty-two heifers were evaluated from birth up to two years of age. Resistance to the cattle tick was evaluated by counting the number of engorged female ticks and subjective qualification of the larvae and nymph infestation. The animals were weighted in the first 24 hours after birth and at six, 12, 18 and 24 months of age. The average tick count and weight gain were compared by Tukey’s test at 5% significance. Subsequently, linear regression was performed to verify the strength of the association between the risk factors age and genetics and infestation by R. (B. microplus. Age and genetics were both significant risk factors for R. (B. microplus infestation in heifers. Between the third and sixth months of age, the animals showed a window of susceptibility to R. (B. microplus. Regardless of age, Bos taurus heifers had higher infestations than Bos indicus, crossbred F1 (½ B. taurus x ½ B. indicus and crossbred Gir-Holstein (Girolando (? B. taurus x ? B. indicus heifers. B. taurus heifers were heavier than B. indicus heifers at birth and had significantly greater weight gain (p < 0.01.

Uso de extratos vegetais, vitaminas e sua associação sobre o desempenho, temperamento e qualidade de carne de bovinos nelore confinados com dieta de alto grão

OpenAIRE

Silva, Maurícia Brandão da [UNESP

2015-01-01

Fifty-six Nellore (Bos taurus indicus) young bulls of 360 (±19,8) kg initial weight and 20 month of age were used to evaluate the effect of plant extract, vitamins A, D3 supplementation and their associations on the temperament, feedlot performance (finishing phase) and meat quality of Bos indicus cattle. Animals were located in individual pens during 105 days (21 and 84 days, for adaptation and trial period, respectively). Animals were individually weighed, and blocked by initial body weight...

Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

Directory of Open Access Journals (Sweden)

Rodrigo Costa Mattos

2002-05-01

Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

Urinary catecholamine concentrations in three beef breeds at ...

African Journals Online (AJOL)

Handling and transport of live animals is a stressful experience for animals. The temperaments of cattle affect their behaviour and differ between breeds, i.e. studies have shown that Bos indicus types are more temperamental than Sanga and Bos taurus types. Catecholamines (CAT's) are considered as indicators of stress, ...

AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus), INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893) DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

OpenAIRE

Maria Aparecida Schenki; Cláudio Roberto Madruga; Aguemi Kohayagawa; Carla Lopes Mendonça; Dirson Vieira; Raul Kessler

2006-01-01

Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus) inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, ...

Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford

OpenAIRE

Mendonça,Gilson de; Pimentel,Marcelo Alves; Cardellino,Ricardo Alberto; Osório,José Carlos da Silveira

2003-01-01

O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca), peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus), com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus) e 32 com Nelore (Bos indicus). Os fatores estudados fora...

Hormonal protocols for in vitro production of Zebu and taurine embryos

Directory of Open Access Journals (Sweden)

Carlos Antônio de Carvalho Fernandes

2014-10-01

Full Text Available The objective of this work was to evaluate the effects of hormonal synchronization protocols, associated or not with follicular development stimulation, on the recovery of oocytes and on in vitro production of Bos indicus and B. taurus embryos, in different seasons. Ultrasound-guided follicular aspirations (n=237 were performed without pre-treatment (G1, control group and after follicular wave synchronization (G2, or after follicular wave synchronization and follicle growth induction (G3. Bos indicus produced more oocytes and embryos than B. taurus (18.7±0.9 vs. 11.9±0.6 oocytes and 4.8±0.3 vs. 2.1±0.2 embryos. On average, oocyte and embryo yields were higher in G3 than in G2, and both were greater than in G1, which lead to a higher conversion of oocytes to embryos in these treatments. The hot or the cold season did not affect the B. indicus outcomes, whereas, in B. taurus, both oocyte recovery and embryo production were higher in the cold season. Follicular wave synchronization improves ovum pick-up and in vitro production of embryos in both cattle subspecies evaluated.

The effect of dietary rations on the gut morphology of Zebu Cattle ...

African Journals Online (AJOL)

Studies in the Bos taurus cattle have shown the gut morphology to be affected by diet, but there is a paucity of such information in the Bos indicus cattle. A study was conducted to evaluate the morphology of digestive tract of the Tanzanian Short Horn Zebu (TSHZ) cattle under different dietary treatments. A total of 54 TSHZ ...

Factors influencing recalving rate in lactating beef cows in the sweet ...

African Journals Online (AJOL)

goups the majority was also late calving. Recalving rate was high in all other breeding groups and was not influenced by date of calving. In general, Bos taurus type cows calve significantly earlier in the calving season than Bos indicus types (Bonsma &. Skinner, 1969; Holroyd et al., 1979; Gotti el a/., 1985). This is to some ...

Genital tract of zebu (Bos indicus cows in Niger

Directory of Open Access Journals (Sweden)

M. Moussa Garba

2014-01-01

Full Text Available The anatomical characteristics, and the ovarian and pathological structures of the genital tract of 500 zebu (Bos indicus females belonging to four breeds (Azawak, Bororo, Djelli, Goudali were studied at Niamey’s slaughterhouse in Niger from August 15 to December 15, 2011. Each animal was examined before slaughter. The cows and heifers were on average 8 ± 2.5 years old. Their mean body condition score was 1.6 ± 0.6 and mean carcass weight 113 ± 21 kg. The anatomical characteristics of the genital tract did not show differences between breeds (p > 0.05. The following characteristics were observed: cervix diameter 3.4 ± 1.1 cm, cervix length 8.1 ± 2.5 cm, horn length 21.6 ± 5.2 cm, horn diameter 1.6 ± 0.5 cm, length and width of the right ovary 19.8 ± 4.4 and 11.2 ± 3.8 mm, of the left ovary 18.8 ± 4.5 and 10.2 ± 3.3 mm, and weight of the right and left ovaries 2.9 ± 1.8 and 2.5 ± 1.6 g, respectively. A corpus luteum was identified in only 14% cases and no visible follicles were found on the surface of the ovaries in 32% cases. These characteristics were significantly (p < 0.05 influenced by the age of the animal. Among the examined females, 7.4% were confirmed pregnant. Various genital tract diseases (cysts, uterine infection, free martinism, pyometra... were observed in 10.4% of the genital tracts.

AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus, INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893 DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

Directory of Open Access Journals (Sweden)

Maria Aparecida Schenki

2006-10-01

Full Text Available Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, Babesia bigemina, parasitemia, bioquímica sérica.

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

OpenAIRE

Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

2016-01-01

En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

Directory of Open Access Journals (Sweden)

Anirene G T Pereira

Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

Science.gov (United States)

Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

2016-09-22

Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods

Directory of Open Access Journals (Sweden)

Luciano José Bezerra Delfino

2014-09-01

Full Text Available ABSTRACT. Delfino L.J.B., de Souza B.B., Silva W.W., Ferreira A.F. & Soares C.E.A. Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods. [Influência da idade nos parâmetros hematológicos do gado Sindi (Bos indicus no sertão paraibano.] Revista Brasileira de Medicina Veterinária, 36(3:266-270, 2014. Departamento de Medicina Veterinária, Universidade Federal de Campina Grande, Campus de Patos, Av. Universitária, s/n, Santa Cecília, Patos, PB 58708-110, Brasil. Email: zulu_vet@hotmail.com The aim this work was to establish reference values of the hemogram of Sindi cattle raised in Paraiba backwood and evaluate the influence of same age, on blood samples we collected from 60 clinically healthy animals, being 30 females and 30 males, with the following age groups: Group I: 6 - 24 months, Group II: 24 - 48 months and Group III: up to 48 months. The experiment was conducted at the Center for Research and Development for the Semiarid Tropics (NUPEÁRIDO and the Veterinary Clinical Pathology Laboratory of the Health Center and Rural Technology (CSTR, Universidade Federal de Campina Grande (UFCG, Campus de Patos-PB. Blood samples were placed in tubes containing EDTA (tetracético-ethylenediamine-di-sodium as an anticoagulant were performed the following tests: counting the number of red blood cells, packed cell volume (PCV, Hemoglobin (Hb content, calculations of absolute Erythrocyte count (RBC, Mean corpuscular volume (MCV and Mean corpuscular hemoglobin concentration (CHGH. Held global count and differential leukocyte such as segmented neutrophils, eosinophils, lymphocytes and monocytes. Reference values for erythrocyte count (RBC, hematocrit (PCV, hemoglobin (Hb, MCV and CHGH were, respectively, (6375 to 13,400 X106 / MM3 , (32 – 50 %, (9 - 15 G/DL (37 – 60 µ3, (23 to 33 µµG. And for the WBC were obtained the following results: WBC (5270 to 17,170 UL, segmented neutrophils (from 1360 to 5780

Breeds of cattle

NARCIS (Netherlands)

Buchanan, David S.; Lenstra, Johannes A.

2015-01-01

This chapter gives an overview on the different breeds of cattle (Bos taurus and B. indicus). Cattle breeds are presented and categorized according to utility and mode of origin. Classification and phylogeny of breeds are also discussed. Furthermore, a description of cattle breeds is provided.

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds

OpenAIRE

Xu, Yao; Jiang, Yu; Shi, Tao; Cai, Hanfang; Lan, Xianyong; Zhao, Xin; Plath, Martin; Chen, Hong

2017-01-01

Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus) and Qinchuan (Bos taurus) are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 ...

Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

Directory of Open Access Journals (Sweden)

Daniela Bebbere

Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

Llllan, w. WAIBOCPH, Keith, T. BALLINGALI, Niall, n. MACHUGA ...

African Journals Online (AJOL)

African cattle are a hi ghly divergent population possibly due tointrogression by Asian Bos indicus Oiumped) cattle and more recently European B. taurus ... highly divergent Asian, African and European allelic families. This describes signiñcant allelic ..... J. Tïssue Culture Methods Il: 101. 13. Bembridge, G.P. Parsons, K,R., ...

The role of genotype on classification grades of beef carcasses produced under mexican tropical conditions

Directory of Open Access Journals (Sweden)

José Manuel Zorrilla-Ríos

2015-01-01

Full Text Available El presente estudio identificó la distribución de 22,850 canales de bovino de diferentes genotipos. Éstos, en función del juzgamiento visual del tamaño de la giba (grande, representativa de un genotipo Bos indicus; mediana, genotipo producto de la cruza entre B. taurus y B. indicus y pequeña, considerada como genotipo B. taurus en los grados de clasificación obtenidos bajo la norma mexicana NMX-FF-078-SCFI-2002, en el rastro Tipo Inspección Federal No. 51 de La Unión, Tabasco (México. Se determinó el grado de asociación y la proporción de canales, juzgados por el tamaño de su giba; y el criterio de clasificación de la canal, por el procedimiento analítico de Chi-Cuadrada. Cincuenta y cuatro por ciento de las canales correspondieron al tipo de giba grande (genotipo B. indicus, 35% al de pequeña (genotipo B. taurus y el 10.70% al de mediana (genotipo producto de la cruza entre B. taurus y B. indicus. En los genotipos B. taurus y cruza se concentró un mayor número de canales con clasificación de selecta (P<0.0001; 17.90 y 18.50%, respectivamente y estándar (55.20 y 60.10%, respectivamente que el genotipo B. indicus (10.10% para canales selectas y 39.30% de estándar. El genotipo B. indicus concentró un mayor número de canales de grado comercial (36.20% y fuera de clasificación (14.40% (P<0.0001. Los tres genotipos de bovinos considerados (B. indicus, B. taurus y Cruzas dieron lugar a canales clasificadas como selectas, sugiriendo que el genotipo no sea un factor de sesgo en la norma de clasificación de canales de bovino mexicano NMX-FF-078-SCFI-2002.

DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

Directory of Open Access Journals (Sweden)

Mishra Bina

2006-11-01

Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

In vivo Efficacy of Vernonia amygdalina (Compositae Against Natural Helminth Infection in Bunaji (Bos indicus Calves

Directory of Open Access Journals (Sweden)

C. B. I. Alawa ab*, A. M. Adamu, J. O. Gefub, O. J. Ajanusic, P. A. Abdud and N. P. Chiezeyb

2010-10-01

Full Text Available Fifteen Bunaji calves (Bos indicus averaging 105±12.5 Kg liveweight and approximately nine months of age with natural helminth infection were distributed into three treatment groups of five animals each. Animals were either treated orally with aqueous extract of Vernonia amygdalina at a dose concentration of 1.1g/Kg body weight, a conventional anthelmintic or left untreated. V. amygdalina treatment produced 59.5% reduction in eggs per gram (EPG of faeces which was significantly different (P<0.001 from the untreated control (-17.24%, whereas levamisol hydrochloride treatment produced 100% reduction in EPG. A total of six genera of helminths were recovered from the gastrointestinal tracts and liver of experimental animals. These were Haemonchus contortus, Trichostrongylus spp, Bunostomum spp, Oesophagostomum spp, Fasciola spp and Dicrocoelium spp. There was significant difference (P<0.001 in worm load between the different treatment groups. Except for Haemonchus spp, animals in the untreated group had significantly (P<0.001 higher worm load for all the genera of helminth recovered than those of the V. amygdalina treated group, indicating that V. amygdalina had no effect on Haemonchus contortus.

Genome sequencing of the extinct Eurasian wild aurochs, Bos primigenius, illuminates the phylogeography and evolution of cattle.

Science.gov (United States)

Park, Stephen D E; Magee, David A; McGettigan, Paul A; Teasdale, Matthew D; Edwards, Ceiridwen J; Lohan, Amanda J; Murphy, Alison; Braud, Martin; Donoghue, Mark T; Liu, Yuan; Chamberlain, Andrew T; Rue-Albrecht, Kévin; Schroeder, Steven; Spillane, Charles; Tai, Shuaishuai; Bradley, Daniel G; Sonstegard, Tad S; Loftus, Brendan J; MacHugh, David E

2015-10-26

Domestication of the now-extinct wild aurochs, Bos primigenius, gave rise to the two major domestic extant cattle taxa, B. taurus and B. indicus. While previous genetic studies have shed some light on the evolutionary relationships between European aurochs and modern cattle, important questions remain unanswered, including the phylogenetic status of aurochs, whether gene flow from aurochs into early domestic populations occurred, and which genomic regions were subject to selection processes during and after domestication. Here, we address these questions using whole-genome sequencing data generated from an approximately 6,750-year-old British aurochs bone and genome sequence data from 81 additional cattle plus genome-wide single nucleotide polymorphism data from a diverse panel of 1,225 modern animals. Phylogenomic analyses place the aurochs as a distinct outgroup to the domestic B. taurus lineage, supporting the predominant Near Eastern origin of European cattle. Conversely, traditional British and Irish breeds share more genetic variants with this aurochs specimen than other European populations, supporting localized gene flow from aurochs into the ancestors of modern British and Irish cattle, perhaps through purposeful restocking by early herders in Britain. Finally, the functions of genes showing evidence for positive selection in B. taurus are enriched for neurobiology, growth, metabolism and immunobiology, suggesting that these biological processes have been important in the domestication of cattle. This work provides important new information regarding the origins and functional evolution of modern cattle, revealing that the interface between early European domestic populations and wild aurochs was significantly more complex than previously thought.

Breeding programs for the main economically important traits of zebu dairy cattle

Directory of Open Access Journals (Sweden)

Ariosto Ardila Silva

2010-06-01

Full Text Available In tropical regions, Gyr and Guzerat breeds (Bos indicus are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically superior sires in the herds. A major objective of QTL (Quantitative Trait Loci and candidate genes is to find genes and markers that can be implemented in breeding programs across marker assisted selection (MAS. In Zebu dairy cattle MAS could be used to pre-select young candidate bulls to progeny testing, thus increasing selection differentials, shortening generation interval and increasing genetic gain

Effect of follicular diameter, time of first cleavage and H3K4 methylation on embryo production rates of Bos indicus cattle

Directory of Open Access Journals (Sweden)

Paula Alvares Lunardelli

2016-10-01

Full Text Available This study aimed investigate the relationship between epigenetics, follicular diameter and cleavage speed, by evaluating the developmental potential and occurence of H3K4 monomethylation of early-, intermediate- and late-cleaving Bos indicus embryos from in vitro fertilized oocytes originating from follicles up to 2 mm in diameter or between 4 and 8 mm in diameter. Oocytes (n = 699 from small follicles (? 2 mm and 639 oocytes from large follicles (4-8 mm were punched from 1,982 Bos indicus’ slaughterhouse ovaries. After maturation and in vitro fertilization (IVF, the cultured embryos were separated into early (? 28 h post-IVF, intermediate (> 28 h and ? 34 h post-IVF and late (> 34 h and ? 54 h post-IVF cleavage groups. Blastocysts were subjected to an immunofluorescence assessment for H3K4me investigation. The blastocyst rate for large follicles (36.3% was higher than that for small follicles (22.9%, P < 0.05. In addition, blastocyst rates for early and intermediate cleavage groups (45.3% and 33.8%, respectively were higher than that for late cleavage group (13.5%, P < 0.05. The blastocysts from all groups displayed H3K4me staining by immunofluorescence, particularly intense in what seemed to be trophectoderm cells and weak or absent in cells seemingly from the inner cell mass. For the first time for indicus embryos, data from this study demonstrate that higher blastocyst embryo rates are obtained from embryos that cleave within 34 h after fertilization and from those produced from follicles of 4-8 mm in diameter, indicating a greater ability of these embryos to develop to the stage of embryonic preimplantation. This is the first article demonstrating the occurrence of H3K4me in cattle embryos; its presence in all the evaluated blastocysts suggests that this histone modification plays a key role in maintaining embryo viability at preimplantation stage.

Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

Directory of Open Access Journals (Sweden)

Leslie Scarpelli

2009-01-01

Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

THE INFLUENCE OF AUTOLYSIS ON THE PROTEIN-PEPTIDE PROFILE OF Bos taurus AND Sus scrofa HEART AND AORTA TISSUES

Directory of Open Access Journals (Sweden)

I. M. Chernukha

2016-01-01

Full Text Available The article presents the results of autolytic processes impact on the protein-peptide profile of Bos taurus and Sus scrofa cardiac muscle and aorta. The results of tissue-specific protein identification are also presented as well as the effect of autolysis. Apolipoprotein A-1 involved in the formation of high-density lipoproteins, peroxiredoxin-1 involved in the suppression of oxidative stress, galectin-1 induced apoptosis of T-lymphocytes, as well as number of heat shock proteins with molecular weight less than 30 kDa were identified in Sus scrofa aorta tissue. It was discovered that functional proteins with molecular weight less than 30 kDa are retained during the freezing process, but destroyed under the action of autolytic enzymes. This work was supported by the Russian Science Foundation (project No. 16–16–10073.

Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

African Journals Online (AJOL)

ethnoveterinary uses of B. taurus by-products by traditional practitioners in Nigeria and South Africa. Conclusion: There ... Moreover, there are over 60 species of bacteria, about 100 species ..... bioremediation of pharmaceutical, pesticides and.

Novel polymorphisms in UTR and coding region of inducible heat shock protein 70.1 gene in tropically adapted Indian zebu cattle (Bos indicus) and riverine buffalo (Bubalus bubalis).

Science.gov (United States)

Sodhi, M; Mukesh, M; Kishore, A; Mishra, B P; Kataria, R S; Joshi, B K

2013-09-25

Due to evolutionary divergence, cattle (taurine, and indicine) and buffalo are speculated to have different responses to heat stress condition. Variation in candidate genes associated with a heat-shock response may provide an insight into the dissimilarity and suggest targets for intervention. The present work was undertaken to characterize one of the inducible heat shock protein genes promoter and coding regions in diverse breeds of Indian zebu cattle and buffaloes. The genomic DNA from a panel of 117 unrelated animals representing 14 diversified native cattle breeds and 6 buffalo breeds were utilized to determine the complete sequence and gene diversity of HSP70.1 gene. The coding region of HSP70.1 gene in Indian zebu cattle, Bos taurus and buffalo was similar in length (1,926 bp) encoding a HSP70 protein of 641 amino acids with a calculated molecular weight (Mw) of 70.26 kDa. However buffalo had a longer 5' and 3' untranslated region (UTR) of 204 and 293 nucleotides respectively, in comparison to Indian zebu cattle and Bos taurus wherein length of 5' and 3'-UTR was 172 and 286 nucleotides, respectively. The increased length of buffalo HSP70.1 gene compared to indicine and taurine gene was due to two insertions each in 5' and 3'-UTR. Comparative sequence analysis of cattle (taurine and indicine) and buffalo HSP70.1 gene revealed a total of 54 gene variations (50 SNPs and 4 INDELs) among the three species in the HSP70.1 gene. The minor allele frequencies of these nucleotide variations varied from 0.03 to 0.5 with an average of 0.26. Among the 14 B. indicus cattle breeds studied, a total of 19 polymorphic sites were identified: 4 in the 5'-UTR and 15 in the coding region (of these 2 were non-synonymous). Analysis among buffalo breeds revealed 15 SNPs throughout the gene: 6 at the 5' flanking region and 9 in the coding region. In bubaline 5'-UTR, 2 additional putative transcription factor binding sites (Elk-1 and C-Re1) were identified, other than three common sites

Do cattle (Bos taurus) retain an association of a visual cue with a food reward for a year?

Science.gov (United States)

Hirata, Masahiko; Takeno, Nozomi

2014-06-01

Use of visual cues to locate specific food resources from a distance is a critical ability of animals foraging in a spatially heterogeneous environment. However, relatively little is known about how long animals can retain the learned cue-reward association without reinforcement. We compared feeding behavior of experienced and naive Japanese Black cows (Bos taurus) in discovering food locations in a pasture. Experienced animals had been trained to respond to a visual cue (plastic washtub) for a preferred food (grain-based concentrate) 1 year prior to the experiment, while naive animals had no exposure to the cue. Cows were tested individually in a test arena including tubs filled with the concentrate on three successive days (Days 1-3). Experienced cows located the first tub more quickly and visited more tubs than naive cows on Day 1 (usually P visual cue with a food reward within a day and retain the association for 1 year despite a slight decay. © 2014 Japanese Society of Animal Science.

Microbiota composition, gene pool and its expression in Gir cattle (Bos indicus) rumen under different forage diets using metagenomic and metatranscriptomic approaches.

Science.gov (United States)

Pandit, Ramesh J; Hinsu, Ankit T; Patel, Shriram H; Jakhesara, Subhash J; Koringa, Prakash G; Bruno, Fosso; Psifidi, Androniki; Shah, S V; Joshi, Chaitanya G

2018-03-09

Zebu (Bos indicus) is a domestic cattle species originating from the Indian subcontinent and now widely domesticated on several continents. In this study, we were particularly interested in understanding the functionally active rumen microbiota of an important Zebu breed, the Gir, under different dietary regimes. Metagenomic and metatranscriptomic data were compared at various taxonomic levels to elucidate the differential microbial population and its functional dynamics in Gir cattle rumen under different roughage dietary regimes. Different proportions of roughage rather than the type of roughage (dry or green) modulated microbiome composition and the expression of its gene pool. Fibre degrading bacteria (i.e. Clostridium, Ruminococcus, Eubacterium, Butyrivibrio, Bacillus and Roseburia) were higher in the solid fraction of rumen (Pcomparison of metagenomic shotgun and metatranscriptomic sequencing appeared to be a much richer source of information compared to conventional metagenomic analysis. Copyright © 2018 Elsevier GmbH. All rights reserved.

Effect of shadow availability at pasture on reproductive traits of Nelore bulls (Bos indicus raised in southeastern Brazil

Directory of Open Access Journals (Sweden)

Octavio Fabián Bao Tarragó

2013-12-01

Full Text Available Solar radiation is responsible for bull body temperature elevation. An alternative to minimize heat stress is to use artificial shade. Thus, this study aimed to evaluate the effect of thermal stress reduction, through shade availability, on reproductive characteristics of Nellore bulls (Bos indicus. For this, ten bulls were divided in: Available artificial shade (AS, n = 5 and Unavailable shade (US, n = 5. Each group was kept in two hectare paddocks, in which shade availability for group AS was artificially created. Animals were submitted to a clinical-reproductive evaluation and seminal analyses. No interaction was observed between treatments (AS and US and time (8 collections for all analyzed variables (P>0.05. No significant effect (P > 0.05 of treatment was observed for all parameters analyzed. So, it can be concluded that the absence of shaded areas during summer does not negatively affect reproductive characteristics such as: scrotal circumference, testicular consistency, progressive motility, percentage of rapidly moving cells (Computer Assisted Semen Analysis - CASA, morphology or sperm viability in Nellore bulls raised in southeastern Brazil, considering that results could be different in other regions of the country where average temperature is higher.

Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

Directory of Open Access Journals (Sweden)

Rodrigo Pinheiro Araldi

2015-01-01

Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

Infestation by Haematopinus quadripertusus on cattle in São Domingos do Capim, state of Pará, Brazil Infestação por Haematopinus quadripertusus em bovinos de São Domingos do Capim, Estado do Pará, Brasil

Directory of Open Access Journals (Sweden)

Alessandra Scofield

2012-09-01

Full Text Available Severe infestation with lice was observed on crossbred cattle (Bos taurus indicus ×Bos taurus taurus in the municipality of São Domingos do Capim, state of Pará, Brazil. Sixty-five animals were inspected and the lice were manually collected, preserved in 70% alcohol and taken to the Animal Parasitology Laboratory, School of Veterinary Medicine, Federal University of Pará, Brazil, for identification. The adult lice were identified as Haematopinus quadripertusus, and all the cattle examined were infested by at least one development stage of this ectoparasite. The specimens collected were located only on the tail in 80% (52/65 of the cattle, while they were around the eyes as well as on the ears and tail in 20% (13/65. Nits, nymphs and adults of the parasite were respectively collected from 98.46% (64/65, 38.46% (25/65 and 23.08% (15/65 of the animals examined. This is the first report of bovine pediculosis caused by H. quadripertusus in the state of Pará, Brazil. Further studies should be conducted to determine the occurrence pattern of this species in Brazil and its importance to livestock production.Alta infestação por piolhos foi observada em vacas mestiças Bos taurus indicus e Bos taurus taurus do município de São Domingos do Capim, Estado do Pará, Brasil. Sessenta e cinco animais foram inspecionados e os piolhos foram coletados manualmente, armazenados em álcool 70% e transportados ao Laboratório de Parasitologia Animal da Faculdade de Medicina Veterinária da Universidade Federal do Pará para a identificação. Os exemplares adultos foram identificados como Haematopinus quadripertusus e todos os animais examinados apresentaram pelo menos um estágio de desenvolvimento do ectoparasito. Em 80% (52/65 dos animais, os exemplares coletados localizavam-se somente na cauda e em 20% (13/65 na região periocular, orelha e cauda. Lêndeas, ninfas e adultos foram coletados, respectivamente, em 98,46% (64/65, em 38,46% (25/65 e em 23

Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

Science.gov (United States)

Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

2012-10-01

Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0.01) concentrations of cortisol and haptoglobin on d 40 and reduced (P = 0.02) exit velocity on d 200 compared with control heifers. Puberty was hastened in acclimated heifers compared with control (P = 0.01). Results from this study indicate that B. taurus beef cows with aggressive temperament have impaired reproductive performance compared with cohorts with adequate temperament, whereas acclimation to human handling after weaning hastens reproductive development of

Dual Origins of Dairy Cattle Farming – Evidence from a Comprehensive Survey of European Y-Chromosomal Variation

DEFF Research Database (Denmark)

Edwards, Ceiridwen J; Genja, Catarina; Kantanen, Juha

2011-01-01

, with limited breed panels, identified two Bos taurus (taurine) haplogroups (Y1 and Y2; both composed of several haplotypes) and one Bos indicus (indicine/zebu) haplogroup (Y3), as well as a strong phylogeographic structuring of paternal lineages. Methodology and Principal Findings: Haplogroup data were......, the Nordic region and Russia, with the highest Ychromosomal diversity seen in the Iberian Peninsula. Conclusions: We propose that the homogeneous Y1 and Y2 regions reflect founder effects associated with the development and expansion of two groups of dairy cattle, the pied or red breeds from the North Sea...

Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

African Journals Online (AJOL)

taurus L urine, bile and dung in Nigeria and South Africa. Mariam O ... traditional health care systems are still in use by majority of the people ..... improving memory, enhancing the function of the liver, slowing ... standard guidelines and database be made available to ... WHO, Traditional and Modern Medicine: Harmonishing.

Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Sergio do Nascimento Kronka

2008-08-01

Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

Gastrointestinal Strongyle Egg Output and its Relationship with Tick Burden in Gambian N'dama and Gobra Zebu Cattle

Directory of Open Access Journals (Sweden)

Mattioli, RC.

1995-01-01

Full Text Available Fortnightly quantitative analysis of rectal faecal samples for the presence of strongyle eggs were carried out from May 1992 to April 1993 on 11 Gambian N'dama Bos taurus and 11 Gobra zebu Bos indicus cattle. Significantly (P <0.001 lower strongyle egg outputs were found in N'dama in comparison with zebu cattle. No correlation was found between individual cumulative tick burden and strongyle egg output in either breed, although individual variations in parasite burdens were lower in N'dama than in zebu cattle. This study strenghtens the evidence for the presence of a natural resistant trait to strongyle infection in N'dama cattle.

Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

Directory of Open Access Journals (Sweden)

Joana D'Arc Rocha Alves

2001-08-01

Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

Science.gov (United States)

Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

2015-08-28

The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

SUSCEPTIBILIDADE DE BOVINOS DAS RAÇAS JERSEY E GIR À ACIDOSE LÁCTICA RUMINAL: II - ACIDOSE METABÓLICAE METABOLIZAÇÃO DO LACTATO-L SUSCEPTIBILITY OF JERSEY AND GIR STEERS TO RUMEN LACTIC ACIDOSIS: II - METABOLIC ACIDOSIS AND L-LACTATE METABOLISM

Directory of Open Access Journals (Sweden)

Celso Akio Maruta

2002-02-01

Full Text Available Quatro garrotes Jersey (J (Bos taurus e quatro Gir (G (Bos indicus foram utilizados para comparar a susceptibilidade de zebuínos e taurinos à acidose láctica ruminal (ALR. Neste trabalho, acompanhou-se o grau da acidose metabólica (AM e a metabolização do lactato-L. A ALR foi induzida com a administração de sacarose intraruminal. Amostras de sangue foram colhidas nos seguintes momentos: zero, 14, 16, 18, 20, 22 e 24 horas. Foram determinadas as concentrações de lactato total, de seus isômeros L e D e o perfil hemogasométrico. Nos momentos mais críticos observados (14ªh a 18ªh, a AM foi severa em ambas as raças, porém, ao término do experimento, esta passou a grau moderado nos garrotes G, mantendo-se severa nos J. Os animais J absorveram, do rúmen, maiores quantidades de lactato-D, o qual apresentou correlação negativa com o pH sangüíneo (r = - 0,78. Por outro lado, o lactato-L foi mais absorvido e utilizado nos bovinos G, contribuindo para a restauração parcial do equilíbrio ácido-básico e gerando alterações nas pCO2 e pO2. Os garrotes zebuínos da raça Gir apresentaram menor susceptibilidade à AM que os taurinos da raça Jersey.In order to compare the susceptibility to acute rumen lactic acidosis (RLA, four Jersey (J (Bos taurus and four Gir (G (Bos indicus steers were used to evaluate the degree of metabolic acidosis (MA and the metabolism of L-lactate during the RLA. The RLA was induced by the administration of sucrose into the rumen. Blood samples were collected at following times: zero, 14th,16th, 18th, 20th, 22nd and 24th h. Total lactic acid and its isomers, and blood gas determination were measured. At the most critical moments (14th to 18th h the MA was severe in both breeds, but the MA became moderate in the G steers and remained severe in the J steers at the end of the trial. Higher amounts of D-lactate was absorbed from the rumen to the blood of the J steers; the higher the D-lactate plasma level, the

Effect of heat stress on rumen temperature of three breeds of cattle

Science.gov (United States)

Lees, A. M.; Lees, J. C.; Lisle, A. T.; Sullivan, M. L.; Gaughan, J. B.

2018-02-01

Thirty-six steers (12 of each Angus, Charolais, and Brahman) with an initial BW of 318.5 ± 6.7 kg were used in a 130-day study. Two treatments were imposed: un-shaded and shaded (3 m2/animal; 90% solar block shade cloth). On day 1, steers were administered with rumen temperature boluses. Rumen temperatures ( T RUM) were obtained at 10 min intervals over the duration of the study to determine differences in T RUM between Bos indicus and Bos taurus cattle. Six feedlot pens (162 m2) were used with six steers (2/breed) per pen with three pens/treatment. Ambient dry bulb temperature ( T A; °C), relative humidity (RH; %), wind speed (WS; m/s) and direction, and solar radiation (SR; W/m2) were recorded at 10 min intervals. Rainfall (mm) was collected daily at 0900 h. From these data, black globe temperature (BGT; °C), temperature humidity index (THI), heat load index (HLI), and accumulated heat load (AHL) were calculated. Individual T RUM were converted to an hourly average and then mean hourly T RUM were converted to a mean within hour T RUM across the 130 days. Rumen temperatures were analyzed using an autoregressive repeated measures model. The model analyzed the effect of breed ( P < 0.0002), treatment ( P = 0.3543), time of day (hour, h; P < 0.0001), breed × treatment ( P < 0.3683), breed × h ( P < 0.0001), treatment × h ( P < 0.0001), breed × treatment × h ( P = 0.0029), pen within treatment ( P = 0.0195), and animal × breed × treatment within pen ( P = 0.1041). Furthermore, there were breed × treatment × hour differences in T RUM ( P = 0.0036), indicating that Bos indicus and Bos taurus regulate T RUM differently.

Crossbreeding to increase beef production: additive and non ...

African Journals Online (AJOL)

The indicus x sanga and indicus x taurus direct heterosis effects on all weight traits were greater than either the taurus x sanga or taurus x taurus effects, whereas the indicus x sanga maternal heterosis effect was consistently less than the estimated taurus x sanga maternal heterosis effect. Keywords: Direct effects, heterosis, ...

Withers height of pig - Sus scrofa domestica L. 1758, domestic cow - Bos taurus L. 1758 and sheep - Ovis aries L. 1758 at the “Gornja šuma” archaeological site (Novi Sad

Directory of Open Access Journals (Sweden)

Radmanović Darko P

2016-01-01

Full Text Available In spring 2012, osteological material was collected at the “Gornja Šuma” site (site no. 47, located in the territory of Novi Sad, and it was dated to the early 9th century. The withers heights of pig - Sus scrofa domestica, domestic cow - Bos taurus and sheep - Ovis aries, as the three most dominant species at this archaeological site, were analysed based on the length of bones and according to various authors [Boessneck 1956; Zalkin 1960; Matolcsi 1970; Teichert 1975]. It was determined that in these three species the withers heights mostly corresponded to the data from the Middle Ages.

Perfil de ácidos grasos en carne de toretes Europeo x Cebú finalizados en pastoreo y en corral

Directory of Open Access Journals (Sweden)

Maribel Montero-Lagunes

2011-01-01

Full Text Available El objetivo fue determinar el perfil de ácidos grasos en grasa intramuscular de toretes encastados de Europeo (Bos taurus con Cebú (Bos indicus, finalizados en pastoreo y en corral. Cincuenta y dos toretes se analizaron con un ANDEVA en un arreglo factorial 2 x 2. La mitad de los animales fueron finalizados en pastoreo , siendo el pasto estrella de África [Cynodon plectostachyus (K. Schum Pilg.] la base de la alimentación, y la otra mitad en corral alimentados con 65 % de maíz, 10 % de pasta de soya, 20 % de heno, 4 % de sebo, 1 % de urea y minerales. La mitad de cada grupo consistió de toretes con más de ¾ B. taurus, y la otra mitad mayormente ¾ B. indicus . Los toretes se sacrificaron con 500 kg de peso. Se tomaron muestras del músculo Longissimus dorsi de la región de la 12a costilla. Los lípidos se analizaron por cromatografía de gases. El ácido graso más abundante (mg/g de grasa fue el C18,1 (381±16.4 seguido por el C16,0 (250±5.3 y el C18,0 (201±8.6, El contenido de C18:2, 9-cis, 11-trans fue de 6.1±0.67. C14,0 y C16,0 fueron mayores en corral, y C18,0 fue más alto en pastoreo (P<0.01. C14,0, C16,0, C18,2, C18,3 y CLA total fueron mayores (P<0.05 en B. indicus y C18,0 fue más alto (P<0.05 en B. taurus. Se concluye que el perfil de ácidos grasos en toretes cruzados de Europeo por Cebú es diferente si es finalizado en pastoreo o en corral y por el nivel de encaste.

k-Casein, b-lactoglobulin and growth hormone allele frequencies and genetic distances in Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis cattle

Directory of Open Access Journals (Sweden)

Paola Augusta Kemenes

1999-12-01

Full Text Available The genotypes for k-casein (k-CN, b-lactoglobulin (b-LG and growth hormone (GH were determined by polymerase chain reaction (PCR and restriction enzyme digestion in seven breeds of cattle (Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis. k-Casein had two alleles with the A allele occurring at a higher frequency in Bos indicus breeds (0.93, 0.92 and 0.91% for Gyr, Guzerá and Nelore, respectively. The b-lactoglobulin locus had two alleles in all of the breeds. European breeds had a higher frequency of the b-LG A allele than Zebu breeds. The GH locus had two alleles (L and V in Bos taurus and was monomorphic (L allele only in all of the Bos indicus breeds evaluated. The highest frequency for the V allele was observed in Charolais cattle. The markers used revealed a considerable similarity among breeds, with two main groups being discernible. One group consisted of Zebu and Santa Gertrudis breeds and the other consisted of European and Canchim breeds.Os genótipos de k-caseína (k-CN, b-lactoglobulina (b-LG e hormônio de crescimento foram determinados por reação em cadeia de polimerase (PCR e digestão com enzima de restrição em sete raças de bovinos (Nelore, Gir, Guzerá, Caracu, Charolesa, Canchim and Santa Gertrudis. A k-caseína apresentou dois alelos e as freqüências mais elevadas para o alelo A foram observadas em Bos indicus (0,93, 0,92 e 0,91% para as raças Gir, Guzerá e Nelore, respectivamente. A b-lactoglobulina apresentou dois alelos em todas as raças estudadas, sendo a freqüência do alelo A mais elevada nas raças européias. O loco de hormônio de crescimento apresentou dois alelos em Bos taurus e foi monomórfico (alelo L em todas as raças zebuínas. A maior freqüência para o alelo V foi observado na raça Charolesa. Os marcadores investigados revelaram alta similaridade entre as raças, com a formação de dois grupos principais: um composto de raças zebuínas e a raça Santa Gertrudis e outro

Effects of 12 hour calf withdrawal on conception rate and calf performance of Bos indicus cattle under extensive conditions.

Science.gov (United States)

Escrivão, R J A; Webb, E C; Garcês, A P J T

2009-01-01

Fifty-two multiparous Brahman type cows with reproductive tract scoring (RTS) >/=4 at 45 days post-partum were randomly assigned to two groups of 26 cows each separated into an ad libitum suckling group (C) and treatment group (T). Calves in the T group were separated for 12 h during the night from 45 days post-partum to the onset of the breeding season. Body condition score (BCS) and body weight (BW) were recorded 45 days post-partum, at the start of the breeding season, and at pregnancy diagnosis. Calves were weighed at calving and weaning. Weaning weights were corrected to 205 days. BW and BCS at the onset of the breeding season were similar (p > 0.05) between the experimental groups. Calving to breeding intervals were 93 +/- 18 d and 99 +/- 22 d for T and C groups, respectively. Calving to conception intervals differed significantly between the groups (111 +/- 10 d for T and 133 +/- 19 d for C) and a similar result was obtained for the breeding to conception intervals (18 +/- 15 d for T and 31 +/- 19 d for C). Conception rates were 80% for the T group and 59% for the C group, which correlated better with BW than BCS at the onset of the breeding season. Weaning weights differed (p conception rates and improves the calf weaning weights of Bos indicus beef cattle under extensive production systems in sub-tropical conditions.

Sexual behaviour in cattle

International Nuclear Information System (INIS)

King, G.J.

1990-01-01

Short duration or weak expression of oestrus are frequently cited as major reasons for poor results when artificial insemination of Bos indicus breeds is attempted. The existing literature on sexual behaviour certainly indicates that oestrus sometimes lasts for only a few hours in Bos indicus, but similar patterns are also reported in Bos taurus animals. The period of sexual receptivity in suckled Hereford or Hereford-dairy cross-breds maintained in small, totally confined groups ranged from 1 to 18 h, with a mean of 4.4 h and a median of 3.5 h. In totally confined Holstein cows the onset of the LH surge always followed the beginning of homosexual activity by 1 or 2 h even when the period of receptivity was very short. Thus, the beginning rather than the end of oestrus should be used for estimating ovulation time. The expression of sexual behaviour is modified by many factors, including environmental conditions, the number of peri-oestrous females in the group and the presence of observers. In Hereford beef, Holstein dairy and probably all other cattle breeds, the variability in duration and intensity of oestrous activity is very large, so generalizations on a typical individual behavioural pattern are not possible. (author). 39 refs, 1 fig., 2 tabs

Aspectos clínicos da indução experimental de acidose láctica ruminal em zebuínos e taurinos

Directory of Open Access Journals (Sweden)

Enrico Lippi Ortolani

2010-08-01

Full Text Available To compare the clinical signs and the susceptibility to acute rumen lactic acidosis (ARLA, experimentally induced, five Jersey (J (Bos taurus and five Gir (G (Bos indicus steers were used. The ARLA caused in all animals tachycardia, decreased rumen movement, diarrhoea, and dehydration; Although G steers presented higher tachycardia and tendency to a more severe dehydration, the J steers exhibited a pronounced depression in the general state, requiring an intense treatment to recover. J steers needed more time to recover the normal appetite. Thus, regarding clinical picture, was observed that J steers are more susceptible to ARLA than G. Positive correlation was found between plasma volume deficit and tachycardia (r = 0.67; blood pH did not influence heart rate (r= - 0.25.

INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

Directory of Open Access Journals (Sweden)

Jane M. RUBENSAM

1998-10-01

Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

Science.gov (United States)

Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

2018-04-03

Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

Association of udder traits with single nucleotide polymorphisms in crossbred Bos indicus-Bos taurus cows.

Science.gov (United States)

Tolleson, M W; Gill, C A; Herring, A D; Riggs, P K; Sawyer, J E; Sanders, J O; Riley, D G

2017-06-01

The size, support, and health of udders limit the productive life of beef cows, especially those with background, because, in general, such cows have a reputation for problems with udders. Genomic association studies of bovine udder traits have been conducted in dairy cattle and recently in Continental European beef breeds but not in cows with background. The objective of this study was to determine associations of SNP and udder support scores, teat length, and teat diameter in half (Nellore), half (Angus) cows. Udders of cows ( = 295) born from 2003 to 2007 were evaluated for udder support and teat length and diameter ( = 1,746 records) from 2005 through 2014. These included a subjective score representing udder support (values of 1 indicated poorly supported, pendulous udders and values of 9 indicated very well-supported udders) and lengths and diameters of individual teats in the 4 udder quarters as well as the average. Cows were in full-sibling or half-sibling families. Residuals for each trait were produced from repeated records models with cow age category nested within birth year of cows. Those residuals were averaged to become the dependent variables for genomewide association analyses. Regression analyses of those dependent variables included genotypic values as explanatory variables for 34,980 SNP from a commercially available array and included the genomic relationship matrix. Fifteen SNP loci on BTA 5 were associated (false discovery rate controlled at 0.05) with udder support score. One of those was also detected as associated with average teat diameter. Three of those 15 SNP were located within genes, including one each in (), (), and (). These are notable for their functional role in some aspect of mammary gland formation or health. Other candidate genes for these traits in the vicinity of the SNP loci include () and (). Because these were detected in Nellore-Angus crossbred cows, which typically have very well-formed udders with excellent support across their productive lives, similar efforts in other breeds should be completed, because that may facilitate further refinement of genomic regions responsible for variation in udder traits important in multiple breeds.

A Novel Protocol to Assess Acclimation Rate in Bos taurus Heifers during Yard Weaning

Directory of Open Access Journals (Sweden)

Jessica E. Monk

2018-04-01

Full Text Available The speed with which animals acclimate to a new environment could be an important measure of ability to cope with management induced stress. This study developed a measure of acclimation rate in a group of 50 Bos taurus heifers during yard weaning over nine days. We recorded the time and order in which heifers moved through a novel funnel structure into a feeding yard daily. We hypothesised that addition of an obstacle at the entrance would increase the time it took heifers to move through the funnel, but that they would acclimate to the obstacle over a three-day period. The change in latency to move through could then be used as a measure of acclimation rate. We hypothesised that individuals which acclimated to obstacles at a faster rate might display favourable temperament as assessed by flight time. All heifers took longer to move through the funnel after a novel object was introduced, then latency decreased over the following two days while the object was present. This indicates the protocol could be useful for measuring acclimation rate at a group level. Individual acclimation rate variables, measured as change in times and orders of heifers between test days, did not appear to have any consistent relationships with flight time or weight change during or post-weaning (p > 0.05. We concluded that the protocol was inappropriate for assessing acclimation rate at an individual level, due to social effects while testing heifers as a group. Heifers which were consistently one of the first 20 to move through the funnel had a significantly greater average weight 5 and 10 months post-weaning (345 ± 9 kg and 518 ± 10 kg respectively than heifers which were consistently one of the last 20 through the funnel (311 ± 8 kg and 484 ± 8 kg respectively; p < 0.001. This may indicate order of movement through the funnel was related to feeding motivation or another aspect of temperament not reflected by flight time.

Characterization of a Dairy Gyr herd with respect to its mitochondrial DNA (mt DNA origin

Directory of Open Access Journals (Sweden)

Anibal Eugênio Vercesi Filho

2010-01-01

Full Text Available The Zebu breeds were introduced in Brazil mainly in the last century by imports from the Indian subcontinent. When the Zebu cattle arrived, the national herd suffered a significative change by backcrossing the national cows of taurine origin with Zebu sires. These processes created a polymorphism in the mitochondrial DNA (mtDNA in the Zebu animals with are in a major part derived from backcrossing and sharing mtDNA of taurine origin. To verify the maternal origin of cows belonging to the Dairy Gyr herd of APTA, Mococa 60 females were analyzed and 33 presented mtDNA from Bos taurus origin and 27 presented mtDNA from Bos indicus origin. None of these animals presented patterns of both mtDNA origins, indicating absence of heteroplasmy for these mitochondrial genotypes.

Dicty_cDB: Contig-U16181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

Some aspects of the epidemiology of Babesia bovis in Santana do Livramento, Southern Brazil

International Nuclear Information System (INIS)

Martins, J.R.; Correa, B.L.; Cereser, V.H.; Arteche, C.C.P.; Guglielmone, A.A.

1998-01-01

Some aspects of the epidemiology of Babesia bovis were studied in Santana do Livramento, Rio Grande do Sul, Brazil by analysing cattle raising practices applied to 101 herds and by diagnosing B. bovis antibodies in cattle of about 11 months old using an enzyme linked immunosorbent assay. Herds with prevalence of antibodies ranging between 15% to 80% were considered at risk of babesiosis outbreaks of economic importance (enzootic instability). 53% of herds were found in enzootic instability to B. bovis. The proportion of Bos taurus and B. indicus x B. taurus herds in instability were similar (P=0.771, qui square) and the number of acaricides treatments applied yearly had no influence in the instability to B. bovis (P=0.866, chi square). Herds maintained along with sheep in a ratio < 1.5 (P=0.012, chi square); this probability was further increased in herds maintained on properties greater than 500 ha (P=0.057, chi square). High B. bovis antibody prevalence was found in B. taurus x B. indicus herds subjected to an average of 5.8 tick treatments yearly with long residual period acaricides, indicating misuse of the chemicals or tick resistance to them. The epidemiological situation to B. bovis seems to justify vaccination to avoid economic losses in herds in enzootic instability and those in enzootic stability due to low antibody prevalence. (author)

Evidence of solitary chemosensory cells in a large mammal: the diffuse chemosensory system in Bos taurus airways

Science.gov (United States)

Tizzano, Marco; Merigo, Flavia; Sbarbati, Andrea

2006-01-01

The diffuse chemosensory system (DCS) of the respiratory apparatus is composed of solitary chemosensory cells (SCCs) that resemble taste cells but are not organized in end organs. The discovery of the DCS may open up new approaches to respiratory diseases. However, available data on mammalian SCCs have so far been collected from rodents, the airways of which display some differences from those of large mammals. Here we investigated the presence of the DCS and of SCCs in cows and bulls (Bos taurus), in which the airway cytology is similar to that in humans, focusing our attention on detection in the airways of molecules involved in the transduction cascade of taste [i.e. α-gustducin and phospholipase C of the β2 subtype (PLCβ2)]. The aim of the research was to extend our understanding of airway chemoreceptors and to compare the organization of the DCS in a large mammal with that in rodents. Using immunocytochemistry for α-gustducin, the taste buds of the tongue and arytenoid were visualized. In the trachea and bronchi, α-gustducin-immunoreactive SCCs were frequently found. Using immunocytochemistry for PLCβ2, the staining pattern was generally similar to those seen for α-gustducin. Immunoblotting confirmed the expression of α-gustducin in the tongue and in all the airway regions tested. The study demonstrated the presence of SCCs in cows and bulls, suggesting that DCSs are present in many mammalian species. The description of areas with a high density of SCCs in bovine bronchi seems to indicate that the view of the DCS as made up of isolated cells totally devoid of ancillary elements is probably an oversimplification. PMID:16928202

Evaluation of indirect TaSP enzyme-linked immunosorbent assay for diagnosis of tropical theileriosis in cattle (Bos indicus) and water buffaloes (Bubalus bubalis) in Egypt.

Science.gov (United States)

Mohamed, Amr M; Abdel-Rady, Ahmed; Ahmed, Laila S; El-Hosary, Amira

2012-05-25

The aim of the present study was to evaluate the validity of Theileria annulata surface protein (TaSP)-ELISA, in comparison with traditional microscopic test, for the diagnosis of T. annulata infection among Egyptian baladi cattle (Bos taurus) and water buffaloes (Bubalus bubalis). Molecular confirmation of infection using T. annulata merozoite surface (Tams-1) target amplification by PCR was used as a gold standard. A total of 76 clinically suspected animals including 64 baladi cattle and 12 water buffaloes were investigated in the current study by the three methods. Based on the PCR-confirmed results, the evaluation study revealed higher sensitivity of TaSP-ELISA (72.9% and 75%) as compared to microscopic examination (58.3% and 50%) among cattle and buffaloes, respectively. On the other hand, the specificity of TaSP-ELISA in diagnosis of T. annulata infection was higher (87.5%) in baladi cattle as compared to water buffaloes (37.5%). In conclusion, TaSP-ELISA was shown to be suitable for the diagnosis of T. annulata infection in cattle under field conditions. Copyright © 2011 Elsevier B.V. All rights reserved.

Genome-wide identification, classification, and functional analysis of the basic helix-loop-helix transcription factors in the cattle, Bos Taurus.

Science.gov (United States)

Li, Fengmei; Liu, Wuyi

2017-06-01

The basic helix-loop-helix (bHLH) transcription factors (TFs) form a huge superfamily and play crucial roles in many essential developmental, genetic, and physiological-biochemical processes of eukaryotes. In total, 109 putative bHLH TFs were identified and categorized successfully in the genomic databases of cattle, Bos Taurus, after removing redundant sequences and merging genetic isoforms. Through phylogenetic analyses, 105 proteins among these bHLH TFs were classified into 44 families with 46, 25, 14, 3, 13, and 4 members in the high-order groups A, B, C, D, E, and F, respectively. The remaining 4 bHLH proteins were sorted out as 'orphans.' Next, these 109 putative bHLH proteins identified were further characterized as significantly enriched in 524 significant Gene Ontology (GO) annotations (corrected P value ≤ 0.05) and 21 significantly enriched pathways (corrected P value ≤ 0.05) that had been mapped by the web server KOBAS 2.0. Furthermore, 95 bHLH proteins were further screened and analyzed together with two uncharacterized proteins in the STRING online database to reconstruct the protein-protein interaction network of cattle bHLH TFs. Ultimately, 89 bHLH proteins were fully mapped in a network with 67 biological process, 13 molecular functions, 5 KEGG pathways, 12 PFAM protein domains, and 25 INTERPRO classified protein domains and features. These results provide much useful information and a good reference for further functional investigations and updated researches on cattle bHLH TFs.

Detection of Theileria annulata carriers in Holstein–Friesian (Bos taurus taurus) and Sistani (Bos taurus indicus) cattle breeds by polymerase chain reaction in Sistan region, Iran

OpenAIRE

Majidiani, Hamidreza; Nabavi, Reza; Ganjali, Maryam; Saadati, Dariush

2015-01-01

Theileria annulata is common in tropical and subtropical regions especially in Iran and causes great economic losses in cattle industry. In Iran the epidemiological aspects of bovine theileriosis in different breeds of cattle is poorly understood. The aim of present study is comparison of the number of T. annulata carriers in the two major cattle breeds (Holstein–Friesian and Sistani) in Sistan of Iran by giemsa and polymerase chain reaction (PCR) methods. During winter 2013, 160 native cattl...

Efeito da idade de desmame e suplementação no desenvolvimento de novilhas de corte Effect of weaning age and supplementation on beef heifers growth

Directory of Open Access Journals (Sweden)

Luciane Salgueiro Pio de Almeida

2004-12-01

Full Text Available O experimento foi conduzido com o objetivo de avaliar o desempenho de 47 novilhas de corte cruzas Bos taurus x Bos indicus até os dois anos de idade, desmamadas precocemente (DP, com idade média de 91 dias e peso mínimo de 70 kg de peso vivo, ou desmamadas à idade convencional (DC, com média de 170 dias de idade e 130,3 kg, suplementadas (Su ou não (NSu com suplemento comercial com 14% de proteína bruta e 75% de NDT, durante 91 dias no primeiro inverno pós-desmame. Os animais do DP e o grupo não-suplementado apresentaram menores pesos vivos até um ano de idade. A idade do desmame não influenciou a taxa de prenhez das novilhas (77,3 e 72%, para o DP e DC, respectivamente. A suplementação no primeiro inverno não influenciou o desempenho das novilhas aos dois anos de idade. O desmame precoce não afetou o desenvolvimento e a fertilidade das novilhas aos dois anos de idade, quando comparado ao desmame à idade convencional.The experiment was conducted to evaluate the performance of 47 Bos taurus x Bos indicus beef heifers until two years of age. Heifers were early weaned (EW with average age of 91 days and minimum of 70 kg of liveweight or weaned at conventional age with average of 170 days and average liveweight of 130.3 kg (CW, supplemented (Su or not (NSu with concentrate containing 14% crude protein and 75% total digestible nutrients (TDN during 91 days in the first winter. The early weaning and the no supplemented group were lightier until one year of age. Weaning age did not affect pregnancy rate (77.3% and 72% to EW and CW, respectively. The supplementation during the first winter did not affect the heifers performance until two years of age. Early weaning did not affected the growth and the fertility of heifers until two years of age when compaired with the weaning at the conventional age.

Influence of cow breed type, age and previous lactation status on cow height, calf growth, and patterns of body weight, condition, and blood metabolites for cows grazing bahiagrass pastures.

Science.gov (United States)

Coleman, S W; Chase, C C; Riley, D G; Williams, M J

2017-01-01

This study was initiated to evaluate performance and patterns of cow traits and blood metabolites of 3 breeds of cows grazing bahiagrass (Paspalum notatum Flügge) pastures in central Florida. Purebred cows (n = 411) of either Angus (Bos taurus), Brahman (Bos indicus), or Romosinuano (Bos taurus) breeding, rotationally grazed (moved twice weekly) bahiagrass pastures year-round, and received bahiagrass hay supplemented with molasses and soyhulls or legume hay supplemented with unfortified molasses from October to June each production year. At monthly intervals, all cows were weighed, measured at the hip (HH), scored for BCS, and blood samples collected by jugular puncture from 10 cows per cow breed/block group for plasma urea N (PUN), glucose and non-esterified fatty acids (NEFA). Data were analyzed on cows that calved with a statistical model that included fixed effects of year, cowage, cow breed, month, block, supplement group (n = 2, but not presented), and whether the cow weaned a calf the previous year. Cow was a repeated observation over mo. Three-way interactions involving monthly patterns for cowage x year, year x lactation status the previous year, cowage × cow breed, year × cow breed, and cow breed × lactation status the previous year were significant (P cow breed × month was important (P cows compared to 3-yr old cows; 2) greater BW and BCS before calving for cows that did not lactate the previous year; 3) PUN levels were above 11 mg/dl except for February, August and September, and was generally greater in tropically adapted breeds; 4) GLU was greatest in Brahman, lowest in Angus, and intermediate in Romosinuano cows; and 5) plasma levels of NEFA escalated at calving and then declined, but Brahman cows maintained greater (P Cows that lactated the previous year had less NEFA than those that did not lactate. Brahman cows were less fertile than Bos taurus breeds, and weaned heavier calves.

in silico identification of cross affinity towards Cry1Ac pesticidal protein with receptor enzyme in Bos taurus and sequence, structure analysis of crystal proteins for stability.

Science.gov (United States)

Ebenezer, King Solomon; Nachimuthu, Ramesh; Thiagarajan, Prabha; Velu, Rajesh Kannan

2013-01-01

Any novel protein introduced into the GM crops need to be evaluated for cross affinity on living organisms. Many researchers are currently focusing on the impact of Bacillus thuringiensis cotton on soil and microbial diversity by field experiments. In spite of this, in silico approach might be helpful to elucidate the impact of cry genes. The crystal a protein which was produced by Bt at the time of sporulation has been used as a biological pesticide to target the insectivorous pests like Cry1Ac for Helicoverpa armigera and Cry2Ab for Spodoptera sp. and Heliothis sp. Here, we present the comprehensive in silico analysis of Cry1Ac and Cry2Ab proteins with available in silico tools, databases and docking servers. Molecular docking of Cry1Ac with procarboxypeptidase from Helicoverpa armigera and Cry1Ac with Leucine aminopeptidase from Bos taurus has showed the 125(th) amino acid position to be the preference site of Cry1Ac protein. The structures were compared with each other and it showed 5% of similarity. The cross affinity of this toxin that have confirmed the earlier reports of ill effects of Bt cotton consumed by cattle.

Expression of androgen-producing enzyme genes and testosterone concentration in Angus and Nellore heifers with high and low ovarian follicle count.

Science.gov (United States)

Loureiro, Bárbara; Ereno, Ronaldo L; Favoreto, Mauricio G; Barros, Ciro M

2016-07-15

Follicle population is important when animals are used in assisted reproductive programs. Bos indicus animals have more follicles per follicular wave than Bos taurus animals. On the other hand, B taurus animals present better fertility when compared with B indicus animals. Androgens are positively related with the number of antral follicles; moreover, they increase growth factor expression in granulose cells and oocytes. Experimentation was designed to compare testosterone concentration in plasma, and follicular fluid and androgen enzymes mRNA expression (CYP11A1, CYP17A1, 3BHSD, and 17BHSD) in follicles from Angus and Nellore heifers. Heifers were assigned into two groups according to the number of follicles: low and high follicle count groups. Increased testosterone concentration was measured in both plasma and follicular fluid of Angus heifers. However, there was no difference within groups. Expression of CYP11A1 gene was higher in follicles from Angus heifers; however, there was no difference within groups. Expression of CYP17A1, 3BHSD, and 17BHSD genes was higher in follicles from Nellore heifers, and expression of CYP17A1 and 3BHSD genes was also higher in HFC groups from both breeds. It was found that Nellore heifers have more antral follicles than Angus heifers. Testosterone concentration was higher in Angus heifers; this increase could be associated with the increased mRNA expression of CYP11A1. Increased expression of androgen-producing enzyme genes (CYP17A1, 3BHSD, and 17BHSD) was detected in Nellore heifers. It can be suggested that testosterone is acting through different mechanisms to increase follicle development in Nellore and improve fertility in Angus heifers. Copyright © 2016 Elsevier Inc. All rights reserved.

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

Directory of Open Access Journals (Sweden)

Norberto Villa-Duque

2016-01-01

Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

Controle do carrapato Boophilus microplus (Acari: Ixodidae em sistemas de produção de leite da microrregião fisiográfica fluminense do grande Rio - Rio de Janeiro Control of the cattle tick Boophilus microplus (Acari: Ixodidae in dairy farm systems of the physiographic microrregion of grande Rio, Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Juracy de Castro Borba Santos Júnior

2000-04-01

Full Text Available O objetivo do trabalho foi analisar os métodos de controle do carrapato Boophilus microplus realizados em três fazendas representativas dos sistemas de produção de leite da Microrregião Fisiográfica Fluminense do Grande Rio, Rio de Janeiro, levando-se em consideração o manejo das fazendas, o grau de sangue Bos taurus e Bos indicus dos rebanhos, os fatores climáticos e a prevalência estacional do carrapato. Para efeito de avaliação, foi utilizada a contagem periódica de fêmeas ingurgitadas medindo entre 4,5 e 8mm, no antímero direito de 20% das vacas em lactação de cada fazenda, durante um ano. A diferença no manejo das pastagens, a composição genética dos rebanhos e as condições climáticas influenciaram a prevalência estacional de B. microplus. A maior lotação animal por hectare, o elevado "stand" vegetativo das pastagens e o maior grau de sangue B. taurus contribuíram para as maiores infestações de carrapatos nas fazendas. O controle de B. microplus realizado pelos proprietários teve importância secundária em relação as outras atitudes de manejo dos rebanhos. Ficou evidenciado o uso excessivo e ineficiente de produtos químicos para o controle de B. microplus nas fazendas. Para implantação de medidas de controle estratégico do B. Microplus, fazem-se necessários esforços para a transferência e adoção dos resultados de pesquisas disponíveis aos produtores rurais.The objective of the study was to analyse the control methods of the cattle tick, Boophilus microplus. The experiment was carried out on three farms of the dairy production systems of the Fluminense Physiographic Microregion of Grande Rio, Rio de Janeiro State, Brazil. Farm management, the Bos indicus and Bos taurus composition of herds, climatic factors and seasonal variation in tick infestation level of cattle was taken into account. Counts of engorged female ticks, measuring between 4.5 and 8.0mm, in 20% of the lactating cows of each farm

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore (Bos indicus beef cattle

Directory of Open Access Journals (Sweden)

Artur J.M. Rosa

2007-01-01

Full Text Available We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS of Nellore (Bos indicus beef cattle embryos prior to transplantation to reduce the age at first calving (AFC. We found that MAS resulted in increased genetic gain as compared to selection without AFC quantitative trait loci (AFC-QTL information. With single-stage selection the genetic response (GR increased as follows: GR = 0.68% when the AFC-QTL explained 0.02 of the AFC additive genetic variance (sigma2A; GR = 1.76% for AFC-QTL explaining 0.05 sigma2A; GR = 3.7% for AFC-QTL explaining 0.1 sigma2A; and GR = 55.76% for AFC-QTL explaining 0.95 sigma2A. At the same total selected proportion, two-stage selection resulted in less genetic gain than single stage MAS at two-years of age. A single stage selection responses of > 95% occurred with pre-selected proportions of 0.4 (0.1 sigma2A explained by AFC-QTL, 0.2 (0.3 sigma2A explained by AFC-QTL and 0.1 (0.5 sigma2A explained by AFC-QTL, indicating that the combined use of MAS and pre-selection can substantially reduce the cost of keeping recipient heifers in MOET breeding schemes. When the number of recipients was kept constant, the benefit of increasing embryo production was greater for the QTL explaining a higher proportion of the additive genetic variance. However this advantage had a diminishing return especially for QTL explaining a small proportion of the additive genetic variance. Thus, marker assisted selection of embryos can be used to achieve increased genetic gain or a similar genetic response at reduced expense by decreasing the number of recipient cows and number of offspring raised to two-years of age.

Physiological Responses and Lactation to Cutaneous Evaporative Heat Loss in , , and Their Crossbreds

Directory of Open Access Journals (Sweden)

Wang Jian

2015-11-01

Full Text Available Cutaneous evaporative heat loss in Bos indicus and Bos taurus has been well documented. Nonetheless, how crossbreds with different fractional genetic proportions respond to such circumstances is of interest. A study to examine the physiological responses to cutaneous evaporative heat loss, also lactation period and milk yield, were conducted in Sahiwal (Bos indicus, n = 10, 444±64.8 kg, 9±2.9 years, Holstein Friesian (Bos taurus, HF100% (n = 10, 488±97.9 kg, 6±2.8 years and the following crossbreds: HF50% (n = 10, 355±40.7 kg, 2±0 years and HF87.5% (n = 10, 489±76.8 kg, 7±1.8 years. They were allocated so as to determine the physiological responses of sweating rate (SR, respiration rate (RR, rectal temperature (RT, and skin temperature (ST with and without hair from 06:00 h am to 15:00 h pm. And milk yield during 180 days were collected at days from 30 to 180. The ambient temperature-humidity-index (THI increased from less than 80 in the early morning to more than 90 in the late afternoon. The interaction of THI and breed were highly affected on SR, RR, RT, and ST (p0.05 but did change over time. The ST with and without hair were similar, and was higher in HF100% (37.4°C; 38.0°C and their crossbred HF50% (35.5°C; 35.5°C and HF87.5% (37.1°C; 37.9°C than Sahiwal (34.8°C; 34.8°C (p<0.01. Moreover, the early lactation were higher at HF100% (25 kg and 87.5% (25 kg than HF50% (23 kg which were higher than Sahiwal (18 kg while the peak period of lactation was higher at HF100% (35 kg than crossbreds both HF87.5% and HF50% (32 kg which was higher than Sahiwal (26 kg (p<0.05. In conclusion, sweating and respiration were the main vehicle for dissipating excess body heat for Sahiwal, HF and crossbreds, respectively. The THI at 76 to 80 were the critical points where the physiological responses to elevated temperature displayed change.

Effects of retinol on the in vitro development of Bos indicus embryos to blastocysts in two different culture systems.

Science.gov (United States)

Lima, P F; Oliveira, M A L; Gonçalves, P B D; Montagner, M M; Reichenbach, H-D; Weppert, M; Neto, C C C; Pina, V M R; Santos, M H B

2004-10-01

The objective of this study was to evaluate the effect of retinol on the in vitro development of early embryos of cultured Bos indicus (Expt 1) to the blastocyst stage in medium simplex of optimization (KSOM) or sintetic fluid of oviduct (SOF) or co-cultured (Expt 2) with an oviduct cell monolayer (OCM) in KSOM or SOF. A total of 3149 cumulus-oocyte complexes obtained by aspirating follicles (2-5 mm diameter) from ovaries of slaughtered animals were selected for IVM and incubated in TCM 199 supplemented with 25 mM HEPES at 39 degrees C in air with 5% CO(2) and maximum humidity for 24 h. In vitro fertilization (IVF) was performed in modified defined medium (mDM) medium. Eighteen hours after IVF, cumulus cells were removed and presumptive zygotes were randomly allocated to the experimental groups. Zygotes cultured (Expt 1) in KSOM + retinol, KSOM, SOF + retinol and SOF were incubated in maximum humidity at 39 degrees C, 5% CO(2), 5% O(2) and 90% N(2). Zygotes co-cultured (Expt 2) in KSOM + retinol + OCM, KSOM + OCM, SOF + retinol + OCM and SOF + OCM were incubated at 39 degrees C, 5% CO(2). In both experiments media were partially changed 48 h after IVF and unfertilized ova were removed. Afterwards embryos were kept in culture or co-culture for further 9 days. In Expt 1, blastocyst rates (day 7) were 14.6% (KSOM + retinol), 15.8% (KSOM), 16.4% (SOF + retinol) and 15.9% (SOF). In Expt 2, the blastocyst rates (day 7) were 25.4% (KSOM + retinol + OCM) 14.2% (KSOM + OCM), 24.3% (SOF + retinol + OCM) and 15.9% (SOF + OCM). The same influence profile of retinol was observed in the formation of the expanded (day 9) and hatched (day 11) blastocysts. The results obtained in Expt 2 demonstrated that the addition of 0.28 microg/ml retinol to the embryo culture media used in this study had a significant (p < 0.05) positive effect on bovine early embryonic development, under the conditions tested, and can be used to enhance in vitro embryo production.

Adaptive traits of indigenous cattle breeds: The Mediterranean Baladi as a case study.

Science.gov (United States)

Shabtay, Ariel

2015-11-01

Generally taken, breeds of Bos taurus ancestry are considered more productive, in comparison with Bos indicus derived breeds that present enhanced hardiness and disease resistance, low nutritional requirements and higher capability of feed utilization. While breeds of B. taurus have been mostly selected for intensive production systems, indigenous cattle, developed mostly from indicine and African taurines, flourish in extensive habitats. Worldwide demographic and economic processes face animal production with new challenges - the increasing demand for animal food products. Intensification of animal husbandry is thus a desired goal in stricken parts of the world. An introduction of productive traits to indigenous breeds might serve to generate improved biological and economic efficiencies. For this to succeed, the genetic merit of traits like efficiency of feed utilization and product quality should be revealed, encouraging the conservation initiatives of indigenous cattle populations, many of which are already extinct and endangered. Moreover, to overcome potential genetic homogeneity, controlled breeding practices should be undertaken. The Baladi cattle are a native local breed found throughout the Mediterranean basin. Purebred Baladi animals are rapidly vanishing, as more European breeds are being introduced or used for backcrosses leading to improved production. The superiority of Baladi over large-framed cattle, in feedlot and on Mediterranean pasture, with respect to adaptability and efficiency, is highlighted in the current review. Copyright © 2015 Elsevier Ltd. All rights reserved.

Compression distance can discriminate animals by genetic profile, build relationship matrices and estimate breeding values.

Science.gov (United States)

Hudson, Nicholas J; Porto-Neto, Laercio; Kijas, James W; Reverter, Antonio

2015-10-13

Genetic relatedness is currently estimated by a combination of traditional pedigree-based approaches (i.e. numerator relationship matrices, NRM) and, given the recent availability of molecular information, using marker genotypes (via genomic relationship matrices, GRM). To date, GRM are computed by genome-wide pair-wise SNP (single nucleotide polymorphism) correlations. We describe a new estimate of genetic relatedness using the concept of normalised compression distance (NCD) that is borrowed from Information Theory. Analogous to GRM, the resultant compression relationship matrix (CRM) exploits numerical patterns in genome-wide allele order and proportion, which are known to vary systematically with relatedness. We explored properties of the CRM in two industry cattle datasets by analysing the genetic basis of yearling weight, a phenotype of moderate heritability. In both Brahman (Bos indicus) and Tropical Composite (Bos taurus by Bos indicus) populations, the clustering inferred by NCD was comparable to that based on SNP correlations using standard principal component analysis approaches. One of the versions of the CRM modestly increased the amount of explained genetic variance, slightly reduced the 'missing heritability' and tended to improve the prediction accuracy of breeding values in both populations when compared to both NRM and GRM. Finally, a sliding window-based application of the compression approach on these populations identified genomic regions influenced by introgression of taurine haplotypes. For these two bovine populations, CRM reduced the missing heritability and increased the amount of explained genetic variation for a moderately heritable complex trait. Given that NCD can sensitively discriminate closely related individuals, we foresee CRM having possible value for estimating breeding values in highly inbred populations.

ORF Alignment: NT_033779 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available rEMBL::g2674107:GUANINE NUCLEOTIDE-EXCHANGE ... PROTEIN. organism:BOS TAURUS (BOVINE). dbxref:GenBank...; ... AF023451; g2674107; -.'', species:''BOS TAURUS ... Length = 185 ... Query: 586 METGIELFNRKP

Effectiveness of a 95 SNP panel for the screening of breed label fraud in the Chinese meat market.

Science.gov (United States)

Rogberg-Muñoz, A; Wei, S; Ripoli, M V; Guo, B L; Carino, M H; Lirón, J P; Prando, A J; Vaca, R J A; Peral-García, P; Wei, Y M; Giovambattista, G

2016-01-01

Breed assignment has proved to be useful to control meat trade and protect the value of special productions. Meat-related frauds have been detected in China; therefore, 95 SNPs selected from the ISAG core panel were evaluated to develop an automated and technologically updated tool to screen breed label fraud in the Chinese meat market. A total of 271 animals from four Chinese yellow cattle (CYC) populations, six Bos taurus breeds, two Bos indicus and one composite were used. The allocation test distinguished European, Japanese and Zebu breeds, and two Chinese genetic components. It correctly allocated Japanese Black, Zebu and British breeds in 100, 90 and 89% of samples, respectively. CYC evidenced the Zebu, Holstein and Limousin introgression. The test did not detect CYC components in any of the 25 samples from Argentinean butchers. The method could be useful to certify Angus, Hereford and Japanese Black meat, but a modification in the panel would be needed to differentiate other breeds. Copyright © 2015 Elsevier Ltd. All rights reserved.

Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

Directory of Open Access Journals (Sweden)

Roberto César Araujo Lima

2014-02-01

Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

Science.gov (United States)

Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

2013-10-01

The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

Science.gov (United States)

Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

2017-01-01

The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo ( Bos taurus coreanae ) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

A microsatellite-based analysis for the detection of selection on BTA1 and BTA20 in northern Eurasian cattle (Bos taurus populations

Directory of Open Access Journals (Sweden)

Li Meng-Hua

2010-08-01

Full Text Available Abstract Background Microsatellites surrounding functionally important candidate genes or quantitative trait loci have received attention as proxy measures of polymorphism level at the candidate loci themselves. In cattle, selection for economically important traits is a long-term strategy and it has been reported that microsatellites are linked to these important loci. Methods We have investigated the variation of seven microsatellites on BTA1 (Bos taurus autosome 1 and 16 on BTA20, using bovine populations of typical production types and horn status in northern Eurasia. Genetic variability of these loci and linkage disequilibrium among these loci were compared with those of 28 microsatellites on other bovine chromosomes. Four different tests were applied to detect molecular signatures of selection. Results No marked difference in locus variability was found between microsatellites on BTA1, BTA20 and the other chromosomes in terms of different diversity indices. Average D' values of pairwise syntenic markers (0.32 and 0.28 across BTA 1 and BTA20 respectively were significantly (P FST-test indicated elevated or decreased genetic differentiation, at SOD1 and AGLA17 markers respectively, deviating significantly (P SOD1 and AGLA17. Our data also indicate significant intergenic linkage disequilibrium around the candidate loci and suggest that hitchhiking selection has played a role in shaping the pattern of observed linkage disequilibrium. Conclusion Hitchhiking due to tight linkage with alleles at candidate genes, e.g. the POLL gene, is a possible explanation for this pattern. The potential impact of selective breeding by man on cattle populations is discussed in the context of selection effects. Our results also suggest that a practical approach to detect loci under selection is to simultaneously apply multiple neutrality tests based on different assumptions and estimations.

Body condition and suckling as factors influencing the duration of postpartum anestrus in cattle: a review.

Science.gov (United States)

Montiel, F; Ahuja, C

2005-01-01

Prolonged postpartum anestrus is a main factor limiting reproductive efficiency in cattle, particularly in Bos indicus and Bos taurus/Bos indicus cows from tropical regions, because it prevents achievement of a 12 month calving interval. During anestrus, ovulation does not occur despite ovarian follicular development, because growing follicles do not mature. Although many factors affect postpartum anestrus, nutrition and suckling are the major factors influencing the resumption of postpartum ovarian cycles, as they affect hypothalamic, pituitary and ovarian activity and thus inhibit follicular development. Under-nutrition contributes to prolonged postpartum anestrus, particularly among cows dependent upon forages to meet their feed requirements and it apparently interacts with genetic, environmental or management factors to influence the duration of anestrus. The nutritional status or balance of an animal is evaluated through body condition score (BCS), as it reflects the body energy reserves available for metabolism, growth, lactation and activity. There is a converse relationship between energy balance and time to resumption of postpartum ovarian activity; inadequate nutrient intake results in loss of weight and BCS and finally cessation of estrous cycles. Suckling interferes with hypothalamic release of GnRH, provoking a marked suppression in pulsatile LH release, resulting in extended postpartum anestrus. The effects of suckling on regulation of tonic LH release are determined by the ability of the cow to identify a calf as her own or as unrelated. Vision and olfaction play critical roles in the development of the maternal-offspring bond, allowing the cow to identify her own calf, and abolition of both senses attenuates the negative effects of suckling on LH secretion. Thus, the maternal-offspring bond is essential for prolonged postpartum suckling-induced anovulation, and the suppressive influence of suckling is independent of neurosensory pathways within the

Factors affecting the first service conception rate of cows in smallholder dairy farms in Bangladesh.

Science.gov (United States)

Siddiqui, M A R; Das, Z C; Bhattacharjee, J; Rahman, M M; Islam, M M; Haque, M A; Parrish, J J; Shamsuddin, M

2013-06-01

The successful outcome of an insemination is a combination of both male and female fertility-linked factors. We investigated the first service conception rate of cows at artificial insemination (AI) in the smallholder dairy farms in Bangladesh. Frozen straws were prepared from ejaculates of Bos indicus (n = 7) and Bos indicus × Bos taurus (n = 7) AI bulls. Fertility was determined from 6101 first services in cows that were performed by 18 technicians in four regions between April 2004 and March 2005. Pregnancy was diagnosed by rectal palpation between 60 and 90 days post-insemination. The Asian version of Artificial Insemination Database Application (AIDA ASIA) was used for bulls-, cows- and AI-related data recording, and later retrieved for analysis. The mean ± SD number of inseminations performed from individual bulls and their conception rates were 436.0 ± 21.6 and 50.7 ± 1.9%, respectively. Logistic regression demonstrated body condition scores (BCS), heat detection signs, months of AI and their interactions had greatest effects (odds ratios: 1.24-16.65, p conception rate in cows. Fertility differed (p conception rate of 53.6%, 48.8% and 50.1%, respectively (p Conception rate between technicians ranged between 43.4% and 58.6% (p < 0.05). The days interval from calving to first service (overall mean ± SD = 153.4 ± 80.6) had relationship (p < 0.001) with BCS, months of previous calving and parity of the cows. Fertility at AI in smallholder farms can be improved by training farmers on nutrition and reproductive management of the cows. © 2012 Blackwell Verlag GmbH.

Evaluation of pregnancy rates of Bos indicus cows subjected to different synchronization ovulation protocols using injectable progesterone or an intravaginal device

Directory of Open Access Journals (Sweden)

Jefferson Tadeu Campos

2016-12-01

Full Text Available This study evaluated the pregnancy rate in Nelore cows (Bos indicus that were subjected to fixed-time artificial insemination (FTAI using different protocols consisting of injectable progesterone (P4 or an intravaginal device (impregnated with P4. Multiparous cows 72-84 months in age, 30-45 days postpartum, were selected on the basis of the absence of a corpus luteum (CL and follicles < 8 mm after transrectal palpation and ultrasound examinations. On a random day of the estrus cycle (D0, the selected animals (n = 135 were randomly assigned to one of three experimental groups (n = 45 each. Group I (injectable P4/FTAI 36 hours received 250 mg of injectable P4 and 2 mg EB on D0; on D7, they received 500 µg of cloprostenol; on D8, 300 IU of eCG and 1 mg of EB were administered; and finally, FTAI was performed 36 hours after the application of EB. Group II (injectable P4/FTAI 48 hours received the same protocol as Group I, except that the FTAI was performed 48 hours after ovulation induction. The animals of Group III (Control/CIDR received a conventional protocol for FTAI using an intravaginal device (D0: P4 and 2 mg EB; D8: device removal, 500 µg cloprostenol, 300 IU eCG, 1 mg EB; and FTAI performed 48 hours after removal of the device. The results showed that cows synchronized with the conventional protocol for FTAI (Control/CIDR had a higher pregnancy rate (60 %, 27/45 than those synchronized with an injectable P4/FTAI 36 hours (33.33 %; 15/45, P = 0.010. However, the group receiving injectable P4 group/FTAI 48 hours had a similar pregnancy rate (48.9 %; 22/45; P = 0.290 when compared to both the group receiving the conventional protocol and that receiving injectable P4/FTAI 36 hours (P = 0.134. Although the injectable P4 may affect pregnancy rate with the FTAI performed in 36 hours, we found similar pregnancy rates from cows inseminated 48 hours after induction ovulation, considering injectable or intravaginal P4. Therefore, we suggest that

NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0499 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-175 86% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0106 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2314 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-161 89% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0894 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-176 84% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0235 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-169 83% ...

NCBI nr-aa BLAST: CBRC-GGAL-23-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-23-0005 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-120 65% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0428 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-149 76% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1596 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1596 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 89% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1190 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0287 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0287 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1487 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1487 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-179 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1010 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 92% ...

Características da carcaça e da carne de novilhos mantidos em pastagem de capim-marandu submetidos a diferentes estratégias de suplementação Carcass and meat traits from crossbred steers submitted to different supplementation strategies

Directory of Open Access Journals (Sweden)

Roberta Carrilho Canesin

2006-12-01

Full Text Available Este trabalho foi realizado com o objetivo de avaliar as características quantitativas e qualitativas da carcaça e da carne de 24 novilhos submetidos a três estratégias de suplementação em pastagem: SD - suplementação diária; DA - suplementação em dias alternados; e FS - suplementação oferecida de segunda à sexta-feira e suspensa aos sábados e domingos. Foram utilizados 24 bovinos mestiços (Bos indicus x Bos taurus com peso inicial de 230 kg mantidos em pastagem de Brachiaria brizantha cv. Marandu no período das águas de 2003 e nos períodos de seca e das águas de 2004, quando atingiram o peso de abate. O delineamento experimental utilizado foi o inteiramente casualizado, com três tratamentos e oito repetições. As características quantitativas e qualitativas da carcaça e da carne não foram influenciadas pelas diferentes estratégias de suplementação, mesmo quando o suplemento foi fornecido apenas em dias alternados ou quando não foi fornecido nos finais de semana. Na média, os animais apresentaram peso de abate de 468,21 kg de PV, rendimento de carcaça quente de 50,26%, área de olho-de-lombo de 59,67 cm² e espessura de gordura de 3,3 mm. A carne foi classificada como macia, com suculência e palatabilidade levemente acima da média.The objective of this trial was to evaluate quantitative and qualitative traits of carcass and meat from grazing steers submitted to one of the following three supplementation strategies: daily supplementation (DS, alternate days supplementation (AS or Monday to Friday supplementation (MFS. Twenty-four crossbred steers (Bos indicus x Bos taurus averaging 230 kg of initial body were used in a completely randomized block design (three treatments and eight replicates/treatment. Animals were maintained in pasture of Brachiaria brizantha cv. Marandu from the rainy season of 2003 to the dry and rainy seasons of 2004, when they reached the expected slaughter weight. The quantitative and

NCBI nr-aa BLAST: CBRC-TTRU-01-0672 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0672 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-178 74% ...

PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds.

Directory of Open Access Journals (Sweden)

Sunil W Kolte

Full Text Available Tick-borne pathogens (TBP are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD, most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey with native Bos indicus (numerous breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type. The model showed significant association between infection with TBP (particularly apicomplexan parasites and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic

PCR diagnosis of tick-borne pathogens in Maharashtra state, India indicates fitness cost associated with carrier infections is greater for crossbreed than native cattle breeds.

Science.gov (United States)

Kolte, Sunil W; Larcombe, Stephen D; Jadhao, Suresh G; Magar, Swapnil P; Warthi, Ganesh; Kurkure, Nitin V; Glass, Elizabeth J; Shiels, Brian R

2017-01-01

Tick-borne pathogens (TBP) are responsible for significant economic losses to cattle production, globally. This is particularly true in countries like India where TBP constrain rearing of high yielding Bos taurus, as they show susceptibility to acute tick borne disease (TBD), most notably tropical theileriosis caused by Theileria annulata. This has led to a programme of cross breeding Bos taurus (Holstein-Friesian or Jersey) with native Bos indicus (numerous) breeds to generate cattle that are more resistant to disease. However, the cost to fitness of subclinical carrier infection in crossbreeds relative to native breeds is unknown, but could represent a significant hidden economic cost. In this study, a total of 1052 bovine blood samples, together with associated data on host type, sex and body score, were collected from apparently healthy animals in four different agro-climatic zones of Maharashtra state. Samples were screened by PCR for detection of five major TBPs: T. annulata, T. orientalis, B. bigemina, B. bovis and Anaplasma spp.. The results demonstrated that single and co-infection with TBP are common, and although differences in pathogen spp. prevalence across the climatic zones were detected, simplistic regression models predicted that host type, sex and location are all likely to impact on prevalence of TBP. In order to remove issues with autocorrelation between variables, a subset of the dataset was modelled to assess any impact of TBP infection on body score of crossbreed versus native breed cattle (breed type). The model showed significant association between infection with TBP (particularly apicomplexan parasites) and poorer body condition for crossbreed animals. These findings indicate potential cost of TBP carrier infection on crossbreed productivity. Thus, there is a case for development of strategies for targeted breeding to combine productivity traits with disease resistance, or to prevent transmission of TBP in India for economic benefit.

Systemic and local anti-Mullerian hormone reflects differences in the reproduction potential of Zebu and European type cattle.

Science.gov (United States)

Stojsin-Carter, Anja; Mahboubi, Kiana; Costa, Nathalia N; Gillis, Daniel J; Carter, Timothy F; Neal, Michael S; Miranda, Moyses S; Ohashi, Otavio M; Favetta, Laura A; King, W Allan

2016-04-01

This study was conducted to evaluate plasma anti-Mullerian hormone (Pl AMH), follicular fluid AMH (FF AMH) and granulosa cell AMH transcript (GC AMH) levels and their relationships with reproductive parameters in two cattle subspecies, Bos taurus indicus (Zebu), and Bos taurus taurus (European type cattle). Two-dimensional ultrasound examination and serum collection were performed on Zebu, European type and crossbreed cows to determine antral follicle count (AFC), ovary diameter (OD) and Pl AMH concentration. Slaughterhouse ovaries for Zebu and European type cattle were collected to determine FF AMH concentrations, GC AMH RNA levels, AFC, oocyte number, cleavage and blastocyst rate. Additionally GC AMH receptor 2 (AMHR2) RNA level was measured for European type cattle. Relationship between AMH and reproductive parameters was found to be significantly greater in Zebu compared to European cattle. Average Pl AMH mean ± SE for Zebu and European cattle was 0.77 ± 0.09 and 0.33 ± 0.24 ng/ml respectively (p = 0.01), whereas average antral FF AMH mean ± SE for Zebu and European cattle was 4934.3 ± 568.5 and 2977.9 ± 214.1 ng/ml respectively (p cattle. Levels of GC AMHR2 RNA in European cattle were correlated to oocyte number (p = 0.01). Crossbred animals were found more similar to their maternal Zebu counterparts with respect to their Pl AMH to AFC and OD relationships. These results demonstrate that AMH reflects differences between reproduction potential of the two cattle subspecies therefore can potentially be used as a reproductive marker. Furthermore these results reinforce the importance of separately considering the genetic backgrounds of animals when collecting or interpreting bovine AMH data for reproductive performance. Copyright © 2016 Elsevier B.V. All rights reserved.

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

Directory of Open Access Journals (Sweden)

Ali Abdirahman A

2012-07-01

Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle.

Science.gov (United States)

Ali, Abdirahman A; O'Neill, Christopher J; Thomson, Peter C; Kadarmideen, Haja N

2012-07-27

Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre

Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

Directory of Open Access Journals (Sweden)

Reinsch Norbert

2009-09-01

Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

South-East Asia bovine populations and the Japanese cattle breeds do not harbour the E211K variant of the PRNP

Directory of Open Access Journals (Sweden)

George Msalya

2014-02-01

Full Text Available An important outcome of intensive worldwide Bovine spongiform encephalopathy (BSE obtained with the surveillance by The National Creutzfeldt-Jakob Disease Surveillance Unit (http://www.cjd.ed.ac.uk/figures. htm, has been the detection of atypical BSE in cattle. The discovery of a prion protein gene (PRNP E211K variant in an atypical BSE case is particularly remarkable because it is analogous to the most common pathogenic mutation in humans (E200K, which causes hereditary Creutzfeldt-Jakob disease (CJD. Knowledge of the distribution and frequency of PRNP E211K variants in cattle populations is critical for understanding and managing atypical BSE. This study was carried out to investigate the prevalence of the E211K variant in the South-East Asia bovine populations and in the Japanese cattle breeds. It was discovered that E211K variant was monomorphic for a G allele and the GG genotype in the 745 animals analyzed in this study. Therefore, neither the Bos indicus nor the Bos taurus animals analyzed are presently known to harbor the 211K variant predicting that the number of carriers for this variant will also be vanishingly low.

Quantitative trait loci (QTL mapping for growth traits on bovine chromosome 14

Directory of Open Access Journals (Sweden)

Marcelo Miyata

2007-03-01

Full Text Available Quantitative trait loci (QTL mapping in livestock allows the identification of genes that determine the genetic variation affecting traits of economic interest. We analyzed the birth weight and weight at 60 days QTL segregating on bovine chromosome BTA14 in a F2 resource population using genotypes produced from seven microsatellite markers. Phenotypes were derived from 346 F2 progeny produced from crossing Bos indicus Gyr x Holstein Bos taurus F1 parents. Interval analysis to detect QTL for birth weight revealed the presence of a QTL (p < 0.05 at 1 centimorgan (cM from the centromere with an additive effect of 1.210 ± 0.438 kg. Interval analysis for weight at 60 days revealed the presence of a QTL (p < 0.05 at 0 cM from the centromere with an additive effect of 2.122 ± 0.735 kg. The region to which the QTL were assigned is described in the literature as responsible for some growth traits, milk yield, milk composition, fat deposition and has also been related to reproductive traits such as daughter pregnancy rate and ovulation rate. The effects of the QTL described on other traits were not investigated.

THE TAURUS SPITZER SURVEY: NEW CANDIDATE TAURUS MEMBERS SELECTED USING SENSITIVE MID-INFRARED PHOTOMETRY

International Nuclear Information System (INIS)

Rebull, L. M.; Padgett, D. L.; McCabe, C.-E.; Noriega-Crespo, A.; Carey, S. J.; Brooke, T.; Hillenbrand, L. A.; Stapelfeldt, K. R.; Angione, J. R.; Huard, T.; Terebey, S.; Audard, M.; Baldovin-Saavedra, C.; Monin, J.-L.; Menard, F.; Bouvier, J.; Fukagawa, M.; Guedel, M.; Knapp, G. R.; Allen, L. E.

2010-01-01

We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in seven mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously identified members of the Taurus star-forming region in our ∼44 deg 2 map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ∼20% of the bona fide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 new candidate members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, three probable new members, and 10 possible new members, an increase of 15%-20% in Taurus members. Of the objects for which we have spectroscopy, seven are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candidate objects await additional analysis and/or data to be confirmed or rejected as Taurus members. Most of the new members are Class II M stars and are located along the same cloud filaments as the previously identified Taurus members. Among non-members with Spitzer colors similar to young, dusty stars are evolved Be stars, planetary nebulae, carbon stars, galaxies, and active galactic nuclei.

Quantitative trait loci mapping of calving and conformation traits on Bos taurus autosome 18 in the German Holstein population.

Science.gov (United States)

Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch

2010-03-01

Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a

Demographic consequences of increased winter births in a large aseasonally breeding mammal (Bos taurus) in response to climate change.

Science.gov (United States)

Burthe, Sarah; Butler, Adam; Searle, Kate R; Hall, Stephen J G; Thackeray, Stephen J; Wanless, Sarah

2011-11-01

1. Studies examining changes in the scheduling of breeding in response to climate change have focused on species with well-defined breeding seasons. Species exhibiting year-round breeding have received little attention and the magnitudes of any responses are unknown. 2. We investigated phenological data for an enclosed feral population of cattle (Bos taurus L.) in northern England exhibiting year-round breeding. This population is relatively free of human interference. 3. We assessed whether the timing of births had changed over the last 60 years, in response to increasing winter and spring temperatures, changes in herd density, and a regime of lime fertilisation. 4. Median birth date became earlier by 1·0 days per year. Analyses of the seasonal distribution of calving dates showed that significantly fewer calves were born in summer (decline from 44% of total births to 20%) and significantly more in winter (increase from 12% to 30%) over the study period. The most pronounced changes occurred in winter, with significant increases in both the proportion and number of births. Winter births arise from conceptions in the previous spring, and we considered models that investigated climate and weather variables associated with the winter preceding and the spring of conceptions. 5. The proportion of winter births was higher when the onset of the plant growing season was earlier during the spring of conceptions. This relationship was much weaker during years when the site had been fertilised with lime, suggesting that increased forage biomass was over-riding the impacts of changing plant phenology. When the onset of the growing season was late, winter births increased with female density. 6. Recruitment estimates from a stage-structured state-space population model were significantly negatively correlated with the proportion of births in the preceding winter, suggesting that calves born in winter are less likely to survive than those born in other seasons. 7.�

NCBI nr-aa BLAST: CBRC-AGAM-04-0111 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-AGAM-04-0111 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 hom...olog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 2e-72 51% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0762 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 2e-97 40% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3294 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 1e-135 48% ...

Antibiogram profile of pathogens isolated from processed cow meat

African Journals Online (AJOL)

2016-06-30

Jun 30, 2016 ... Cow meat or beef is the culinary name for meat from bovines especially cattle. The generic name of cow meat is Bos taurus and the habitable weather of Bos taurus includes temperature of 101.50F (38.60C) and ability to live in a harsh terrains (Li et al., 2006). The processing of cow meat begins from ...

Controle ultra-sonográfico de gestações, de mortalidades embrionárias e fetais e do sexo de fetos bovinos zebuínos

Directory of Open Access Journals (Sweden)

Breno José Pelozo de Barros

2001-01-01

Full Text Available Este trabalho avaliou a eficácia do ultra-som no diagnóstico precoce de prenhez e nas avaliações das mortalidades embrionárias e fetais e dos sexos de fetos em dois grupos de vacas zebuínas. Os animais que não retornaram ao estro aos 21 dias da Inseminação Artificial (G1 ou aos 14 dias da Transferência de Embriões (G2B foram examinados aos 25 dias de gestação para o diagnóstico precoce de prenhez, aos 45 dias para avaliação das perdas embrionárias entre 26 e 45 dias e aos 60 dias para avaliações das perdas fetais entre 45 e 60 dias e dos sexos de fetos. O Grupo G2A foi examinado por palpação retal aos 45 dias para diagnóstico de prenhez e aos 60 dias para avaliações das perdas fetais e dos sexos de fetos. As taxas de prenhez foram, respectivamente, 94,6%, 88,1% e 83,4% aos 25, 45 e 60 dias de gestação. As taxas de perdas embrionárias e fetais e de abortos foram, respectivamente, 4,6%, 4,7% e 1,2%. As taxas de acertos do diagnóstico precoce de gestação e dos sexos de fetos foram 88,5% e 90,7%, respectivamente. A ultra-sonografia mostrou-se eficaz no diagnóstico precoce de prenhez aos 25 dias, nas avaliações das perdas embrionárias aos 45 dias e fetais aos 60 dias e no diagnóstico do sexo de fetos a partir dos 60 dias de gestação. Os exames ultra-sonográficos não causaram perdas gestacionais nos animais Bos indicus ou Bos indicus X Bos taurus.

Biomass Briquette Investigation from Pterocarpus Indicus Leaves Waste as an Alternative Renewable Energy

Science.gov (United States)

Anggono, Willyanto; Sutrisno; Suprianto, Fandi D.; Evander, Jovian

2017-10-01

Indonesia is a tropical country located in Southeast Asia. Indonesia has a lot of variety of plant species which are very useful for life. Pterocarpus indicus are commonly used as greening and easily found everywhere in Surabaya city because of its characteristics that they have dense leaves and rapid growth. Pterocarpus indicus leaves waste would be a problem for residents of Surabaya and disturbing the cleanliness of the Surabaya city. Therefore, the Pterocarpus indicus leaves waste would be used as biomass briquettes. This research investigated the calorific value of biomass briquettes from the Pterocarpus indicus leaves waste, the effect of tapioca as an adhesive material to the calorific value of biomass briquettes from the Pterocarpus indicus leaves waste, the optimum composition for Pterocarpus indicus leaves waste biomass briquette as an alternative renewable fuel and the property of the optimum resulted biomass briquette using ultimate analysis and proximate analysis based on the ASTM standard. The calorific value biomass briquettes from the Pterocarpus indicus leaves waste were performed using an oxygen bomb calorimeter at various composition of Pterocarpus indicus from 50% to 90% rising by 10% for each experiment. The experimental results showed that the 90% raw materials (Pterocarpus indicus leaves waste)-10% adhesive materials (tapioca) mixtures is the optimum composition for biomass briquette Pterocarpus indicus leaves waste. The lower the percentage of the mass of tapioca in the biomass briquettes, the higher calorific value generated.

Carbapenem-resistance and pathogenicity of bovine Acinetobacter indicus-like isolates.

Directory of Open Access Journals (Sweden)

Peter Klotz

Full Text Available The objective of this study was to characterize blaOXA-23 harbouring Acinetobacter indicus-like strains from cattle including genomic and phylogenetic analyses, antimicrobial susceptibility testing and evaluation of pathogenicity in vitro and in vivo. Nasal and rectal swabs (n = 45 from cattle in Germany were screened for carbapenem-non-susceptible Acinetobacter spp. Thereby, two carbapenem resistant Acinetobacter spp. from the nasal cavities of two calves could be isolated. MALDI-TOF mass spectrometry and 16S rDNA sequencing identified these isolates as A. indicus-like. A phylogenetic tree based on partial rpoB sequences indicated closest relation of the two bovine isolates to the A. indicus type strain A648T and human clinical A. indicus isolates, while whole genome comparison revealed considerable intraspecies diversity. High mimimum inhibitory concentrations were observed for carbapenems and other antibiotics including fluoroquinolones and gentamicin. Whole genome sequencing and PCR mapping revealed that both isolates harboured blaOXA-23 localized on the chromosome and surrounded by interrupted Tn2008 transposon structures. Since the pathogenic potential of A. indicus is unknown, pathogenicity was assessed employing the Galleria (G. mellonella infection model and an in vitro cytotoxicity assay using A549 human lung epithelial cells. Pathogenicity in vivo (G. mellonella killing assay and in vitro (cytotoxicity assay of the two A. indicus-like isolates was lower compared to A. baumannii ATCC 17978 and similar to A. lwoffii ATCC 15309. The reduced pathogenicity of A. indicus compared to A. baumannii correlated with the absence of important virulence genes encoding like phospholipase C1+C2, acinetobactin outer membrane protein BauA, RND-type efflux system proteins AdeRS and AdeAB or the trimeric autotransporter adhesin Ata. The emergence of carbapenem-resistant A. indicus-like strains from cattle carrying blaOXA-23 on transposable elements and

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds.

Directory of Open Access Journals (Sweden)

Yao Xu

Full Text Available Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus and Qinchuan (Bos taurus are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 to 12 fold on average of 97.86% and 98.98% coverage of genomes, respectively. Comparison with the Bos_taurus_UMD_3.1 reference assembly yielded 9,010,096 SNPs for Nanyang, and 6,965,062 for Qinchuan cattle, 51% and 29% of which were novel SNPs, respectively. A total of 154,934 and 115,032 small indels (1 to 3 bp were found in the Nanyang and Qinchuan genomes, respectively. The SNP and indel distribution revealed that Nanyang showed a genetically high diversity as compared to Qinchuan cattle. Furthermore, a total of 2,907 putative cases of copy number variation (CNV were identified by aligning Nanyang to Qinchuan genome, 783 of which (27% encompassed the coding regions of 495 functional genes. The gene ontology (GO analysis revealed that many CNV genes were enriched in the immune system and environment adaptability. Among several CNV genes related to lipid transport and fat metabolism, Lepin receptor gene (LEPR overlapping with CNV_1815 showed remarkably higher copy number in Qinchuan than Nanyang (log2 (ratio = -2.34988; P value = 1.53E-102. Further qPCR and association analysis investigated that the copy number of the LEPR gene presented positive correlations with transcriptional expression and phenotypic traits, suggesting the LEPR CNV may contribute to the higher fat deposition in muscles of Qinchuan cattle. Our findings provide evidence that the distinct phenotypes of Nanyang and Qinchuan breeds may be due to the different genetic variations including SNPs

Some effects of partial suckling on milk yield, reproduction and calf growth in crossbred dairy cattle in north east coastal Tanzania

International Nuclear Information System (INIS)

Bryant, M.J.; Msanga, Y.N.

1999-01-01

Two experiments are described where a progeny of Bos taurus x Bos indicus crossbred cows were reared by partial suckling or bucket rearing (Experiment I), and partially suckled calves were weaned at 12 or 24 weeks of age (Experiment II). The results of Experiment I suggest that calf rearing method had no significant effect in the yield of milk extracted from the cows by hand milking although there were effects on the shape of the lactation curve. Cows showed similar patterns of live weight and body condition losses and gains and there were no significant effects on the length of the post partum interval. Suckled calves were lighter at weaning (P <0.01) but there were no differences in live weight between treatments at 52 weeks of age. The main advantage of partial suckling was that the calves took advantage of residual milk which was estimated as 28-29% of the total yield. The results from Experiment II suggest that there were no advantages in terms of milk yield or calf growth by extending the suckling period to 24 weeks. The post partum intervals observed in Experiment II were substantially longer than those in Experiment I, possibly because of greater live weight/body condition losses experienced by cows in the second experiment. (author)

EFFECT OF FSH β-SUB UNIT AND FSHR GENES POLYMORPHISMS ON SUPEROVULATORY RESPONSE TRAITS

Directory of Open Access Journals (Sweden)

E. Andreas

2015-09-01

Full Text Available Follicle stimulating hormone (FSH is a pituitary expressed glycoprotein hormone that regulatesreproduction in mammals which composed of α and β-sub unit. The β-sub unit dictates its bindingspecificity with their receptor (FSHR. This study aimed to identify polymorphism of FSH β-sub unitand FSHR genes, and its effect to superovulatory response traits on superovulated cows. Study was doneon 32 cows including Angus, Friesian Holstein (FH, Limousin, Simmental and Brahman in CipelangLivestock Embryo Center. Cows used have been treated superovulation and mated by artificialinsemination. Superovulation response (SR, ovulation rate (OR, fertilization percentage (FP andviable transfer embryo percentage (VP were analyzed to investigate the effect of FSH β-sub unit andFSHR polymorphism. Allele frequency of FSH β-sub unit|PstI and FSH|AluI were opposite withinspecies. Mostly B allele and C allele for FSH β-sub unit and FSHR respectively have a high number inBos taurus species while those were in contrast in Bos indicus species. The highest heterozygosity wasfound in FH cattle (0.250 for FSH β-sub unit and Brahman (0.333 for FSHR. Significant effect was found between FSHR gene polymorphism with ovulation rate where CC genotype was higher (P<0.05than CG and GG genotypes.

Importance of silvopastoral systems on caloric stress reduction in tropical livestock productions

Directory of Open Access Journals (Sweden)

Alexander Navas Panadero

2010-06-01

Full Text Available Livestock systems in Colombia have been developed taking concepts and technologies from the green revolution, where gramineous monocrop is privileged over arboreal cover in grazing lands. This model has not taken into account the climatic conditions of the different tropical ecosystems, in which variables as temperature, relative humidity and evaporation can limit the animal´s productive and reproductive efficiency, besides being a risk factor for illness occurrence in the herd. Bos Taurus and Bos Indicus breeds show termoneutral ranges where its genetic potential can be express. However, out of this comfort area animals can enter in caloric stress which in consequence reduces its performance and sometimes can end up causing death. Silvopastoral systems comprise several functions; it contributes to lessen caloric stress since temperature under the tree canopy can reach between 2 and 9°C lower in comparison to open pastures. Differences in temperature reduction have been found among silvopastoral systems and species, being the tree group arrangements and the species with high density canopy, those with superior effect. Interactions among components should be analyzed in order to design systems that incorporate enough arboreal cover to achieve caloric stress reductions, but without affecting forage production in pastures. Silvopastoral systems contribute to improve animal welfare.

Toleransi Tanaman Peneduh Polyalthia longifolia dan Pterocarpus indicus terhadap Ganoderma sp.

Directory of Open Access Journals (Sweden)

Siti Muslimah Widyastuti

2014-08-01

Full Text Available Susceptibility of Urban Trees Polyalthia longifolia and Pterocarpus indicus to Infection of  the red root rot fungus Ganoderma sp. Urban trees on the Gadjah Mada University (UGM area play an important role in increasing environmental qualities as well as in supporting the teaching and learning processes. However, red root rot disease caused by Basidiomycete Ganoderma sp. has severely infected some existing urban trees. This experiment was aimed to determine the susceptibility of Polyalthia longifolia (glodokan and Pterocarpus indicus (angsana to the infection of Ganoderma sp. Identification of infected trees was performed in UGM area. Further steps were carried out to achieve those objectives : (1 isolation of Ganoderma spp. and testing of Koch’s postulate and (2 examination of the susceptibility of  P. longifolia and P. indicus to infection of Ganoderma sp. The susceptibility test of P. longifolia and P. indicus to Ganoderma sp. indicated that P. longifolia was more resistant to fungal pathogen infection than that of P. indicus. Based on this experiment, it can be concluded that P. longifolia is a species that is more suitable than P. indicus.  P. longifolia should be planted on the areas that have been infested with inocula of Ganoderma sp..

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprint...ed in Prader-Willi/Angelman syndrome region protein 2 homolog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 1e-140 88% ...

Ethanol Production from Lignocellulose by the Dimorphic Fungus Mucor Indicus

Energy Technology Data Exchange (ETDEWEB)

Lennartsson, P.R.; Taherzadeh, M.J. (School of Engineering, Univ. of Boraas, SE-50190, Boraas (Sweden)). e-mail: Patrik.Lennartsson@hb.se; Karimi, K. (Dept. of Chemical Engineering, Isfahan Univ. of Technology, 84156-83111, Isfahan (IR)); Edebo, L. (Dept. of Clinical Bacteriology, Univ. of Goeteborg, SE-41346, Goeteborg (Sweden))

2008-10-15

Ethanol production from dilute-acid lignocellulosic hydrolyzate by the dimorphic fungus Mucor indicus was investigated. A mixture of different forest wood chips dominated by spruce was hydrolyzed with 0.5 g/L sulfuric acid at 15 bar for 10 min, yielding different sugars including galactose, glucose, mannose, and xylose, but also different fermentation inhibitors such as acetic acid, furfural, hydroxymethyl furfural (HMF), and phenolic compounds. We induced different morphological growth of M. indicus from purely filamentous, mostly filamentous, mostly yeast-like to purely yeast-like. The different forms were then used to ferment the hydrolyzate. They tolerated the presence of the inhibitors under anaerobic batch cultivation well and the ethanol yield was 430-440 g/kg consumed sugars. The ethanol productivity depended on the morphology. Judging from these results, we conclude that M. indicus, is useful for ethanol production from toxic substrates independent of its morphology. Keywords: bio-ethanol, lignocellulosic materials, dilute acid hydrolysis, Mucor indicus, dimorphic fungi

Description of Mycobacterium chelonae subsp. bovis subsp. nov., isolated from cattle (Bos taurus coreanae), emended description of Mycobacterium chelonae and creation of Mycobacterium chelonae subsp. chelonae subsp. nov.

Science.gov (United States)

Kim, Byoung-Jun; Kim, Ga-Na; Kim, Bo-Ram; Jeon, Che Ok; Jeong, Joseph; Lee, Seon Ho; Lim, Ji-Hun; Lee, Seung-Heon; Kim, Chang Ki; Kook, Yoon-Hoh; Kim, Bum-Joon

2017-10-01

Three rapidly growing mycobacterial strains, QIA-37 T , QIA-40 and QIA-41, were isolated from the lymph nodes of three separate Korean native cattle, Hanwoo (Bos taurus coreanae). These strains were previously shown to be phylogenetically distinct but closely related to Mycobacterium chelonae ATCC 35752 T by taxonomic approaches targeting three genes (16S rRNA, hsp6 and rpoB) and were further characterized using a polyphasic approach in this study. The 16S rRNA gene sequences of all three strains showed 99.7 % sequence similarity with that of the M. chelonae type strain. A multilocus sequence typing analysis targeting 10 housekeeping genes, including hsp65 and rpoB, revealed a phylogenetic cluster of these strains with M. chelonae. DNA-DNA hybridization values of 78.2 % between QIA-37 T and M. chelonae indicated that it belongs to M. chelonae but is a novel subspecies distinct from M. chelonae. Phylogenetic analysis based on whole-genome sequences revealed a 95.44±0.06 % average nucleotide identity (ANI) value with M. chelonae, slightly higher than the 95.0 % ANI criterion for determining a novel species. In addition, distinct phenotypic characteristics such as positive growth at 37 °C, at which temperature M. chelonae does not grow, further support the taxonomic status of these strains as representatives of a novel subspecies of M. chelonae. Therefore, we propose an emended description of Mycobacterium chelonae, and descriptions of M. chelonae subsp. chelonae subsp. nov. and M. chelonae subsp. bovis subsp. nov. are presented; strains ATCC 35752 T (=CCUG 47445 T =CIP 104535 T =DSM 43804 T =JCM 6388 T =NCTC 946 T ) and QIA-37 T (=KCTC 39630 T =JCM 30986 T ) are the type strains of the two novel subspecies.

Genetic polymorphisms related to meat traits in purebred and crossbred Nelore cattle Polimorfismos genéticos relacionados às características da carne em bovinos Nelore puros e cruzados

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2009-12-01

Full Text Available The objective of this work was to estimate the allelic and genotypic frequencies of CAST/XmnI, a calpastatin gene polymorphism, and CAPN530, a calpain 1 large subunit gene polymorphism, in different beef genetic groups (Nelore and Nelore x Bos taurus, and to investigate associations between these polymorphisms and carcass and meat traits. Three hundred animals - comprising 114 Nelore, 67 Angus x Nelore, 44 Rubia Gallega x Nelore, 41 Canchim, 19 Brangus three-way cross and 15 Braunvieh three-way cross- were genotyped by PCR-RFLP and phenotyped for rib-eye area (REA, back-fat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The occurrence of the two alleles of the CAST/XmnI and CAPN530 single nucleotide polymorphisms (SNPs in a B. indicus breed, which permitted association studies in purebred and crossbred Nelore cattle, was first shown in the present work. No relationship was found between the CAST or CAPN1 SNPs and growth-related traits (REA or fat deposition (BT and IF, since calpastatin and µ-calpain are not physiologically involved with these traits. Moreover, the association results between genotypes and aged meat tenderness (assessed by SF and MFI showed that these markers are useless in assisted selection for purebred Nelore and their crosses with B. taurus.O presente trabalho objetivou estimar, em bovinos de corte de diferentes grupos genéticos (Nelore e Nelore x Bos taurus, as frequências alélicas e genotípicas dos polimorfismos CAST/XmnI, do gene da calpastatina, e CAPN530, do gene da calpaína, bem como avaliar a ocorrência de associações entre esses polimorfismos e características da carcaça e da carne produzida. Trezentos animais - 114 Nelore, 67 Angus x Nelore, 44 Rubia Galega x Nelore, 41 Canchim, 19 tricross Brangus e 15 tricross Braunvieh - foram genotipados por PCR-RFLP e fenotipados para área de olho de lombo (AOL, cobertura de gordura subcutânea (CGS, gordura

Abundancia relativa de Amblyomma spp. (Acari: Ixodidae en bovinos (Bos taurus y B. indicus de Costa Rica

Directory of Open Access Journals (Sweden)

V. Alvarez

2003-06-01

Full Text Available El estudio describe la abundancia de garrapatas del género Amblyomma encontradas sobre bovino a través de muestreos mensuales llevados a cabo en diez fincas pertenecientes a ocho zonas ecológicas (ZE de Costa Rica. Durante la visita se recolectaban garrapatas >4 mm del lado derecho de los bovinos. El estudio recopiló información meteorológica para algunas de las fincas ubicadas en el ensayo, mostrando que la variable que más fluctúa es la de precipitación. La principal especie de Amblyomma encontrada fue A. cajennense. La presencia de ninfas del género Amblyomma se localizan solo en los meses de enero a mayo, coincidente con la época de menor humedad en la zona de estacionalidad de lluvias, por lo que es esperable solo una generación por año. En el trabajo de laboratorio se mantienen ninfas de Amblyomma a las cuales se les mide el tiempo de muda y de sobrevivencia bajo condiciones controladas, sin encontrar mayores diferencias entre sexo. Los períodos de sobrevivencia muestran la imposibilidad de efectuar un manejo de potreros con el fin de controlar a las especies de este género. La presencia de adultos del género Amblyomma es a lo largo del año sin presentar una preferencia particular por alguna época. El estudio dividió las zonas de estudio en régimen lluvioso estacional y régimen sin patrón de estacionalidad. La mayor presencia de adultos de Amblyomma se da precisamente en el de estacionalidad, o de influencia Pacífico. Se reporta la presencia de A. maculatum solo en la ZE correspondiente al Bosque húmedo Tropical transición a premontano. Igualmente, se informa de la presencia de Ixodes boliviensis en la ZE denominada Bosque muy húmedo Montano bajo.The research describe the big amount of ticks of the Amblyomma genus, found on bovines through monthly samplings carried out in ten farms in eight ecological zones (EZ of Costa Rica. Ticks larger than 4 mm were picked up from the right side of the animals during the visit. The study compiled meteorological information for some farms located in the experiment, showing that the most fluctuant variable is rainfall. The most important Amblyomma species found was A. cajennense. Amblyomma nymphs were found only from January to May, which coincides with the lower humidity season in the rain seasonality area; as for it is expected only one generation per year. In the lab work Amblyomma nymphs are kept to measure the moulting season and the surviving time under controlled conditions, but no major differences were found between both sexes. The surviving periods show that it is not possible to do a grazing land handling, in order to control this genus species. Adults of the genus Amblyomma are present through all the year, not showing any specific preference for a season. The research divided the investigation areas in rain seasonality and not-seasonality systems. The highest amount of Amblyomma is found given in the rain seasonality system or of Pacific influence. A. maculatum is present only in the EZ of Tropical Humid Forest transition to pre-montainous. Likewise, Ixodes boliviensis is found in the EZ of low mountainous Very Humid Forest.

Comet assay to determine genetic damage by the use of ivermectin in zebu cows (Bos taurus indicus

Directory of Open Access Journals (Sweden)

Donicer Montes-Vergara

2017-05-01

Full Text Available Objective. The objective of the work was evaluate the damage genetic caused by the use of ivermectin (IVM in cows zebu to concentrations of 1% and 3.15% through the test comet. Material and methods. 15 cows, were taken with age between 3 and 4 years old, average weight of 350 kg, body condition between 3 and 3.5. Three experimental groups with five animals per group, which were exposed to the concentration of IVM to 1% to 3.15% more group control (without application of IVM were used. Animal blood sample was performed by venipuncture jugular or medial flow with vacutainer® needle, extracting 8 ml of blood. The blood samples it was collected at 9, 18 and 27 days post-treatment. Results. The display of the comets is made by using fluorescence microscope, the cells were evaluated by means of visual log and the Comet image software. Evidenced the presence of nuclei with DNA migration in all analyzed plates. The values of classification of comets indicate cells with high levels of damage (grade 3: cells with high damage. The rate of DNA damage of the treatment to 1% to 3.15% was significant, to relate to the control group. Conclusions. The results obtained in this study demonstrate the likely genotoxic potential of the use of IVM in cattle.

Genome-Enabled Prediction of Breeding Values for Feedlot Average Daily Weight Gain in Nelore Cattle

Directory of Open Access Journals (Sweden)

Adriana L. Somavilla

2017-06-01

Full Text Available Nelore is the most economically important cattle breed in Brazil, and the use of genetically improved animals has contributed to increased beef production efficiency. The Brazilian beef feedlot industry has grown considerably in the last decade, so the selection of animals with higher growth rates on feedlot has become quite important. Genomic selection (GS could be used to reduce generation intervals and improve the rate of genetic gains. The aim of this study was to evaluate the prediction of genomic-estimated breeding values (GEBV for average daily weight gain (ADG in 718 feedlot-finished Nelore steers. Analyses of three Bayesian model specifications [Bayesian GBLUP (BGBLUP, BayesA, and BayesCπ] were performed with four genotype panels [Illumina BovineHD BeadChip, TagSNPs, and GeneSeek High- and Low-density indicus (HDi and LDi, respectively]. Estimates of Pearson correlations, regression coefficients, and mean squared errors were used to assess accuracy and bias of predictions. Overall, the BayesCπ model resulted in less biased predictions. Accuracies ranged from 0.18 to 0.27, which are reasonable values given the heritability estimates (from 0.40 to 0.44 and sample size (568 animals in the training population. Furthermore, results from Bos taurus indicus panels were as informative as those from Illumina BovineHD, indicating that they could be used to implement GS at lower costs.

Efeito estacional sobre características ovarianas e produção de oócitos em vacas Bos indicus no Mato Grosso do Sul

Directory of Open Access Journals (Sweden)

Carlos Eurico Fernandes

2001-01-01

Full Text Available Verificou-se o efeito de duas distintas estações do ano (seca e chuvosa sobre algumas características ovarianas em vacas Bos indicus abatidas na região de Campo Grande, MS. Ovários (n = 10 foram obtidos nos meses de novembro e dezembro de 1998 e de janeiro a outubro de 1999. No laboratório, os ovários foram avaliados quanto ao peso (g, volume (Vol. (cm³ = 3/4 p x comprimento/2 x largura/2 x espessura/2, número de corpos lúteos, número de folículos com >; 9 mm de diâmetro, número total de folículos com menos de 9 mm, número de oócitos, oócitos viáveis e oócitos degenerados. O efeito principal da estação (seca ou chuvosa foi estimado pela análise de variância (teste t, para modelos completamente ao acaso. Utilizou-se a análise da correlação simples entre as variáveis estudadas, ajustadas para o efeito da estação. Os resultados revelaram que o peso dos ovários (5,1 x 6,5 g, folículos totais (10,1 x 13,7, corpos lúteos (0,32 x 0,47, p < 0,05 e a percentagem de oócitos viáveis (19,6% x 35,6% sobre o total de oócitos variaram significativamente (p < 0,01 entre as estações seca e chuvosa, respectivamente. A análise da correlação (r mostrou coeficientes significativos (p < 0,01 entre peso e volume (r = 0,78, peso e total de folículos (r = 0,32, peso e corpos lúteos (r = 0,41, total de folículos e oócitos viáveis (r = 57, entre outros. Concluiu-se que importantes modificações na função ovariana, com base na produção e qualidade dos oócitos, podem ser estimadas entre a estação seca e chuvosa. Com base nestas características, a estação chuvosa torna-se mais favorável para a implantação de programas reprodutivos em rebanhos comerciais.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study

Directory of Open Access Journals (Sweden)

JOSEFA M. NASCIMENTO-ROCHA

2017-08-01

Full Text Available ABSTRACT Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli], and farm level i.e., milking room hygiene (-Milking room, dunghill location, and replacement female. Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31; +Mycoplasma spp (OR, 5.67; yearly milk production (4500 kg or more (OR, 1.99; +Bos taurus (OR, 1.68; +E. coli (OR, 4.96; -milking room (OR, 2.31; and replacement females (OR, 1.89. Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study.

Science.gov (United States)

Nascimento-Rocha, Josefa M; Oliveira, Benedito D DE; Arnhold, Emannuel; Pôrto, Regiani N G; Lima, Svetlana F; Gambarini, Maria Lucia

2017-01-01

Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli]), and farm level i.e., milking room hygiene (-Milking room), dunghill location, and replacement female). Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31); +Mycoplasma spp (OR, 5.67); yearly milk production (4500 kg or more) (OR, 1.99); +Bos taurus (OR, 1.68); +E. coli (OR, 4.96); -milking room (OR, 2.31); and replacement females (OR, 1.89). Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

First record of Galeodes indicus Pocock, 1900 (Arachnida: Solifugae: Galeodidae from Rajasthan, India

Directory of Open Access Journals (Sweden)

Ruquaeya Bano

2016-03-01

Full Text Available During a regular survey to collect soil arthropods in Lasiurus sindicus Henrard grassland by pitfall methods at Chandan Village near Jaisalmer City, Rajasthan, we found a dead specimen of Galeodes indicus in a sample.  Galeodes indicus (Pocock, 1900 has been reported from Madhya Pradesh, Maharashtra, Andhra Pradesh and Telangana but so far was unknown to Rajasthan, India.  In this communication, we report Galeodes indicus from Jaisalmer District, Rajasthan, India. 

Identification and isolation of gene differentially expressed on scrotal ...

African Journals Online (AJOL)

Results of BLAST with GenBank show that three genes or expressed sequence tag (ESTs) were unknown, and there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and other sequences were B. taurus ebd-P2 pseudogene, B. taurus similar to F-box only protein 21 isoform 2, ...

Investigation of body and udder skin surface temperature differentials as an early indicator of mastitis in Holstein Friesian crossbred cows using digital infrared thermography technique

Directory of Open Access Journals (Sweden)

M. Sathiyabarathi

2016-12-01

Full Text Available Aim: The objective of this study was to investigate the ability of infrared thermography (IRT technique and its interrelationship with conventional mastitis indicators for the early detection of mastitis in Holstein Friesian (HF crossbred cows. Materials and Methods: A total of 76 quarters of lactating HF crossbred (Bos indicus × Bos taurus cows (n=19 were monitored for body temperature (i.e., eye temperature and udder skin surface temperature (USST before milking using forward-looking infrared (FLIR i5 camera. Milk samples were collected from each quarter and screened for mastitis using Somatic Cell Count (SCC, Electrical Conductivity (EC, and California mastitis test. Thermographic images were analyzed using FLIR Quick Report 1.2 image analysis software. Data on body and USST were compiled and analyzed statistically using SPSS 16.0 and Sigmaplot 11. Results: The mean±standard deviation (SD body (37.23±0.08°C and USST (37.22±0.04°C of non-mastitic cow did not differ significantly; however, the mean USST of the mastitis-affected quarters were significantly higher than the body temperature and USST of unaffected quarters (p37.61°C. Conclusion: It is concluded that infrared thermal imaging technique could be used as a potential noninvasive, quick cowside diagnostic technique for screening and early detection of SCM and clinical mastitis in crossbred cows.

Some effects of partial suckling on milk yield, reproduction and calf growth in crossbred dairy cattle in north east coastal Tanzania

Energy Technology Data Exchange (ETDEWEB)

Bryant, M J [Department of Agriculture, University of Reading, Reading (United Kingdom); Msanga, Y N [Livestock Research Centre, Ministry of Agriculture, Tanga (Tanzania)

1999-07-01

Two experiments are described where a progeny of Bos taurus x Bos indicus crossbred cows were reared by partial suckling or bucket rearing (Experiment I), and partially suckled calves were weaned at 12 or 24 weeks of age (Experiment II). The results of Experiment I suggest that calf rearing method had no significant effect in the yield of milk extracted from the cows by hand milking although there were effects on the shape of the lactation curve. Cows showed similar patterns of live weight and body condition losses and gains and there were no significant effects on the length of the post partum interval. Suckled calves were lighter at weaning (P <0.01) but there were no differences in live weight between treatments at 52 weeks of age. The main advantage of partial suckling was that the calves took advantage of residual milk which was estimated as 28-29% of the total yield. The results from Experiment II suggest that there were no advantages in terms of milk yield or calf growth by extending the suckling period to 24 weeks. The post partum intervals observed in Experiment II were substantially longer than those in Experiment I, possibly because of greater live weight/body condition losses experienced by cows in the second experiment. (author) 22 refs, 8 figs, 2 tabs

Influence of season of birth on growth and reproductive development of Brahman bulls.

Science.gov (United States)

Tatman, Shawn R; Neuendorff, Don A; Wilson, Timothy W; Randel, Ronald D

2004-07-01

Seasonal effects on reproduction are more dramatic in Bos indicus than Bos taurus cattle. This experiment evaluated reproductive development of fall- (n=7) versus spring- (n = 10) born Brahman bulls to determine if season of birth affects reproductive development. Measurements of growth and reproductive development began after weaning and continued at bi-weekly intervals until each bull reached sexual maturity. Different stages of sexual development were classified according to characteristics of the ejaculate and included first sperm in the ejaculate, puberty (> 50 x 10(6) sperm/ejaculate), and sexual maturity (two ejaculates with > 500 = 10(6) sperm/ejaculate). Average daily increases in all measured traits were similar in fall- and spring-born bulls and there were no differences in age, body weight, scrotal circumference, or paired testis volume between groups at first sperm or puberty. However, fall-born bulls were older (P days versus 481 days, respectively) as the interval between puberty and sexual maturity was longer (P days versus 54 days, respectively). The prolonged interval between puberty and sexual maturity in fall-born calves coincided with a short photoperiod (winter) whereas the short interval between puberty and sexual maturity in spring-born calves coincided with a long photoperiod (summer). In conclusion, season of birth affected sexual development; photoperiod might be involved in regulating testicular function immediately after puberty in Brahman bulls.

Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

Directory of Open Access Journals (Sweden)

Daniel Perotto

2009-09-01

Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

Cattle Tick Rhipicephalus microplus-Host Interface: A Review of Resistant and Susceptible Host Responses

Directory of Open Access Journals (Sweden)

Ala E. Tabor

2017-12-01

Full Text Available Ticks are able to transmit tick-borne infectious agents to vertebrate hosts which cause major constraints to public and livestock health. The costs associated with mortality, relapse, treatments, and decreased production yields are economically significant. Ticks adapted to a hematophagous existence after the vertebrate hemostatic system evolved into a multi-layered defense system against foreign invasion (pathogens and ectoparasites, blood loss, and immune responses. Subsequently, ticks evolved by developing an ability to suppress the vertebrate host immune system with a devastating impact particularly for exotic and crossbred cattle. Host genetics defines the immune responsiveness against ticks and tick-borne pathogens. To gain an insight into the naturally acquired resistant and susceptible cattle breed against ticks, studies have been conducted comparing the incidence of tick infestation on bovine hosts from divergent genetic backgrounds. It is well-documented that purebred and crossbred Bos taurus indicus cattle are more resistant to ticks and tick-borne pathogens compared to purebred European Bos taurus taurus cattle. Genetic studies identifying Quantitative Trait Loci markers using microsatellites and SNPs have been inconsistent with very low percentages relating phenotypic variation with tick infestation. Several skin gene expression and immunological studies have been undertaken using different breeds, different samples (peripheral blood, skin with tick feeding, infestation protocols and geographic environments. Susceptible breeds were commonly found to be associated with the increased expression of toll like receptors, MHC Class II, calcium binding proteins, and complement factors with an increased presence of neutrophils in the skin following tick feeding. Resistant breeds had higher levels of T cells present in the skin prior to tick infestation and thus seem to respond to ticks more efficiently. The skin of resistant breeds also

Antibody titers to vaccination are not predictive of level of protection against a BVDV type 1b challenge in Bos indicus - Bos taurus steers

Science.gov (United States)

Subclinical illness associated with infection is thought to reduce performance and increase production costs in feedlot cattle, but underlying components remain largely unidentified. Vaccination is frequently used in feedlot settings but producers lack metrics that evaluate the effectiveness of vacc...

PRODUCTIVITY AND TICK LOAD IN Bos Indicus X B. taurus CATTLE IN A TROPICAL DRY FOREST SILVOPASTORAL SYSTEM

Directory of Open Access Journals (Sweden)

Raquel Sofía Salazar Benjumea

2015-04-01

Full Text Available Rhipicephalus (Boophilus microplus ticks cause significant economic losses to the Colombian cattle sector: reduction in meat and milk production, blood losses and transmission of blood parasites. The degree of infestation depends on the breed, physiological state and nutrition of the animal and on microclimatic characteristics, which affect the tick life cycle. Diverse studies suggest that given the characteristics of intensive silvopastoral systems (ISS, tick loads within these systems are lower. In this study, the tick loads of grazing animals were monitored for five animal groups: three at an ISS and two at traditional farms located on the Valley of Ibague (Tolima. within the ISS, there were greater tick loads in high production cows (P = 0.026 and a positive relationship (P < 0.05 between milk production and tick load in August sampling. Greater tick counts were also observed in the in San Javier (traditional farm group compared to all other animal groups. We conclude that the dynamics of ticks is a complex phenomenon affected by many factors, whose association determines the observed tick population at any given time.

Photometric peculiarities of the RY Taurus

International Nuclear Information System (INIS)

Zajtseva, G.V.

1982-01-01

The results are presented of photoelectric UBV-observations of RY Taurus carried out in 1965-80 at the Crimean Station of the State Sternberg Astronomical Institute. Two components of brightness variations are observed: fast (days) and slow (years). During fast variations the colour indices U-B and B-V change independently of brightness, however, in particular time inter-- vals the rather strong correlation with the star brightness is observed, positive or negative. During the slow variations only the reverse dependence is observed; the brightness increase is followed by the increase of colour indices (reddening of the star). The comparison of the RY TAURUS intrinsic polarization variations has shown that the dependence of polarization degree on brightness is nonmonotonic. At minimum and maximum brightness the RY TAURUS intrinsic polarization is maximum and reaches 5-6 %. At the general amplitude of RY TAURUS brightness variations in V rays from 10.sup(m)1 to 11.sup(m)7 the V=11.sup(m)0 value is singled out. First a certain ''avoidance'' of this brightness value by the star is observed. Second, the fracture in the course of polarization dependence on brightness occurs as well in the V=11sup(m) region

Effects of temperament and acclimation to handling on feedlot performance of Bos taurus feeder cattle originated from a rangeland-based cow-calf system.

Science.gov (United States)

Francisco, C L; Cooke, R F; Marques, R S; Mills, R R; Bohnert, D W

2012-12-01

= 0.03) and tended to have decreased DMI (P = 0.07) compared with controls. Acclimated steers had greater plasma haptoglobin on d 4 (P = 0.04) and greater ceruloplasmin from d 0 to 10 (P ≤ 0.04) and tended to have greater cortisol on d 1 (P = 0.08) than controls. In conclusion, temperament affects productivity of beef operations based on Bos taurus feeder cattle reared in extensive rangeland systems until weaning whereas acclimation to handling ameliorated cattle temperament but did not benefit feedlot receiving performance.

Meiotic Chromosome Analysis of the Giant Water Bug, Lethocerus indicus

Science.gov (United States)

Wisoram, Wijit; Saengthong, Pradit; Ngernsiri, Lertluk

2013-01-01

The giant water bug, Lethocerus indicus (Lepeletier and Serville) (Heteroptera: Belostomatidae), a native species of Southeast Asia, is one of the largest insects belonging to suborder Heteroptera. In this study, the meiotic chromosome of L. indicus was studied in insect samples collected from Thailand, Myanmar, Loas, and Cambodia. Testicular cells stained with lacto-acetic orcein, Giemsa, DAPI, and silver nitrate were analyzed. The results revealed that the chromosome complement of L. indicus was 2n = 22A + neo-XY + 2m, which differed from that of previous reports. Each individual male contained testicular cells with three univalent patterns. The frequency of cells containing neo-XY chromosome univalent (∼5%) was a bit higher than that of cells with autosomal univalents (∼3%). Some cells (∼0.5%) had both sex chromosome univalents and a pair of autosomal univalents. None of the m-chromosome univalents were observed during prophase I. In addition, this report presents clear evidence about the existence of m-chromosomes in Belostomatidae. PMID:23895100

Genome variability in European and American bison detected using the BovineSNP50 BeadChip

DEFF Research Database (Denmark)

Pertoldi, C.; Wójcik, Jan M; Tokarska, Małgorzata

2010-01-01

 The remaining wild populations of bison have all been through severe bottlenecks. The genomic consequences of these bottlenecks present an interesting area to study. Using a very large panel of SNPs developed in Bos taurus we have carried out a genome-wide screening on the European bison (Bison...... bonasus; EB) and on two subspecies of American bison: the plains bison (B. bison bison; PB) and the wood bison (B. bison athabascae; WB). One hundred bison samples were genotyped for 52,978 SNPs along with seven breeds of domestic bovine Bos taurus. Only 2,209 of the SNPs were polymorphic in the bison...

THE DISK POPULATION OF THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Espaillat, C.; Hartmann, L.; Calvet, N.

2010-01-01

We have analyzed nearly all images of the Taurus star-forming region at 3.6, 4.5, 5.8, 8.0, and 24 μm that were obtained during the cryogenic mission of the Spitzer Space Telescope (46 deg 2 ) and have measured photometry for all known members of the region that are within these data, corresponding to 348 sources, or 99% of the known stellar population. By combining these measurements with previous observations with the Spitzer Infrared Spectrograph and other facilities, we have classified the members of Taurus according to whether they show evidence of circumstellar disks and envelopes (classes I, II, and III). Through these classifications, we find that the disk fraction in Taurus, N(II)/N(II+III), is ∼75% for solar-mass stars and declines to ∼45% for low-mass stars and brown dwarfs (0.01-0.3 M sun ). This dependence on stellar mass is similar to that measured for Chamaeleon I, although the disk fraction in Taurus is slightly higher overall, probably because of its younger age (1 Myr versus 2-3 Myr). In comparison, the disk fraction for solar-mass stars is much lower (∼20%) in IC 348 and σ Ori, which are denser than Taurus and Chamaeleon I and are roughly coeval with the latter. These data indicate that disk lifetimes for solar-mass stars are longer in star-forming regions that have lower stellar densities. Through an analysis of multiple epochs of Spitzer photometry that are available for ∼200 Taurus members, we find that stars with disks exhibit significantly greater mid-infrared (mid-IR) variability than diskless stars, which agrees with the results of similar variability measurements for a smaller sample of stars in Chamaeleon I. The variability fraction for stars with disks is higher in Taurus than in Chamaeleon I, indicating that the IR variability of disks decreases with age. Finally, we have used our data in Taurus to refine the observational criteria for primordial, evolved, and transitional disks. The ratio of the number of evolved and

TAURUS - a wide field imaging Fabry-Perot spectrometer

International Nuclear Information System (INIS)

Atherton, P.D.; Taylor, K.

1983-01-01

TAURUS, an imaging Fabry-Perot system developed by the Royal Greenwich Observatory and Imperial College London, is described. The imaging process is explained and the technique is compared with grating spectrographs. It is argued that TAURUS is superior for obtaining field information from extended emission line sources. (Auth.)

Diversity and ecology of Varanus indicus in Pepaya Island at Teluk Cenderawasih National Park, West Irian Jaya

Directory of Open Access Journals (Sweden)

DENY ANJELIUS IYAI

2006-04-01

Full Text Available Monitor lizard (Varanidae has dispersed widely in Indonesia, even in Papua. Papua contents of six species. It’s distribution, abundance, both in land and island have been known yet, even carrying capacity of feeding relative limited. However, species extinction rates in nature were increasing both in it. This research was done in Papaya Island in Teluk Cenderawasih National Park, Nabire, Papua since 24th -25th October 2005. Descriptive method was done to answer this study. This research resulted that in Papaya island contents only one species that is Varanus indicus. The V. indicus chosen same habitat in southern part of Papaya island. This species dispersed on 0-4 m above sea level, humidity about 78.6%, and temperature about 23.90C. Vegetation was dominated by coconut (Cocos nucifera, bitangur (Calophyllum inophyllum and tikar (Pandanus sp., papaya (Carica papaya, and ketapang (Terminalia catappa. V. indicus chosen Megapodius reinwadt nest as nesting area. Population of V. indicus was estimated as much 36.3 ≈ 36 pieces by King Method. The nest of V. indicus placed in Cassuarina sp. tree where cutting down. The diet of V. indicus was found such as megapods, sea birds, lizard (sauria, butterflies and bats (Macrochyroptera. People were caused threatened both direct and indirect toward the V. indicus existence.

A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

Directory of Open Access Journals (Sweden)

Ceiridwen J Edwards

Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

LENUS (Irish Health Repository)

Edwards, Ceiridwen J

2010-01-01

BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

BREEDING SOUNDNESS EVALUATION OF TWO AND THREE YEAR OLD NELORE (BOS TAURUS INDICUS BULLS, RAISED UNDER PASTURE CONDITION CLASSIFICAÇÃO ANDROLÓGICA POR PONTOS (CAP DE TOUROS NELORE (Bos taurus indicus DE DOIS E TRÊS ANOS DE IDADE, CRIADOS SOB PASTEJO

Directory of Open Access Journals (Sweden)

Juliano Cesar Dias

2009-12-01

Full Text Available

Background-Oriented Schlieren (BOS) for Scramjet Inlet-isolator Investigation

Science.gov (United States)

Che Idris, Azam; Rashdan Saad, Mohd; Hing Lo, Kin; Kontis, Konstantinos

2018-05-01

Background-oriented Schlieren (BOS) technique is a recently invented non-intrusive flow diagnostic method which has yet to be fully explored in its capabilities. In this paper, BOS technique has been applied for investigating the general flow field characteristics inside a generic scramjet inlet-isolator with Mach 5 flow. The difficulty in finding the delicate balance between measurement sensitivity and measurement area image focusing has been demonstrated. The differences between direct cross-correlation (DCC) and Fast Fourier Transform (FFT) raw data processing algorithm have also been demonstrated. As an exploratory study of BOS capability, this paper found that BOS is simple yet robust enough to be used to visualize complex flow in a scramjet inlet in hypersonic flow. However, in this case its quantitative data can be strongly affected by 3-dimensionality thus obscuring the density value with significant errors.

Comparison of SNP Variation and Distribution in Indigenous Ethiopian and Korean Cattle (Hanwoo Populations

Directory of Open Access Journals (Sweden)

Zewdu Edea

2012-09-01

Full Text Available Although a large number of single nucleotide polymorphisms (SNPs have been identified from the bovine genome-sequencing project, few of these have been validated at large in Bos indicus breeds. We have genotyped 192 animals, representing 5 cattle populations of Ethiopia, with the Illumina Bovine 8K SNP BeadChip. These include 1 Sanga (Danakil, 3 zebu (Borana, Arsi and Ambo, and 1 zebu × Sanga intermediate (Horro breeds. The Hanwoo (Bos taurus was included for comparison purposes. Analysis of 7,045 SNP markers revealed that the mean minor allele frequency (MAF was 0.23, 0.22, 0.21, 0.21, 0.23, and 0.29 for Ambo, Arsi, Borana, Danakil, Horro, and Hanwoo, respectively. Significant differences of MAF were observed between the indigenous Ethiopian cattle populations and Hanwoo breed (p < 0.001. Across the Ethiopian cattle populations, a common variant MAF (≥0.10 and ≤0.5 accounted for an overall estimated 73.79% of the 7,045 SNPs. The Hanwoo displayed a higher proportion of common variant SNPs (90%. Investigation within Ethiopian cattle populations showed that on average, 16.64% of the markers were monomorphic, but in the Hanwoo breed, only 6% of the markers were monomorphic. Across the sampled Ethiopian cattle populations, the mean observed and expected heterozygosities were 0.314 and 0.313, respectively. The level of SNP variation identified in this particular study highlights that these markers can be potentially used for genetic studies in African cattle breeds.

Effect of feed supplements on dry season milk yield and profitability of crossbred cows in Honduras.

Science.gov (United States)

Reiber, Christoph; Peters, Michael; Möhring, Jens; Schultze-Kraft, Rainer

2013-06-01

The contribution of dry season silage feeding on daily milk yield (MY) and dairying profitability in terms of income over feed cost (IOFC) was evaluated in dual-purpose cattle production systems in Honduras. MY records of 34 farms from two milk collection centres were collected over a 2-year period. Farms were surveyed to obtain information on the type, quantity and cost of supplemented feed, breed type and number of lactating cows in each month. Farms were classified in silage farms (SF, with a short silage supplementation period), non-silage farms (NSF) and prototype farms (PF, with an extended silage supplementation period). Data were analysed using descriptive statistics and a linear mixed model approach. PF had significantly higher MY than SF and NSF but, due to higher expenses for both concentrate and silage, similar IOFC compared to NSF. SF had similar MY but lower IOFC compared to NSF, due to higher feed expenses. The effect of silage feeding, particularly maize silage, on MY was significant and superior to that of other forage supplements. Silage supplementation contributed to the highest MY and IOFC on farms with crossbred cows of >62.5 % Bos taurus and to the second highest profitability on farms with >87.5 % Bos indicus share. It is concluded that silage can play an important role in drought-constrained areas of the tropics and can contribute to profitable dairying, irrespective of breed.

Identification and characterization of variants in the 5' flanking region ...

African Journals Online (AJOL)

enoh

2012-04-05

Apr 5, 2012 ... productivity, reduction in costs, enrichment of milk compositions and extension of ... from six bovine species, 18 samples of Leiqiong cattle (Bos indicus) ..... growth hormone receptor genes with blood serum insulin-like growth.

Gene : CBRC-TTRU-01-1304 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

SPECTROSCOPY OF PUTATIVE BROWN DWARFS IN TAURUS

International Nuclear Information System (INIS)

Luhman, K. L.; Mamajek, E. E.

2010-01-01

Quanz and coworkers have reported the discovery of the coolest known member of the Taurus star-forming complex (L2 ± 0.5), and Barrado and coworkers have identified a possible protostellar binary brown dwarf in the same region. We have performed infrared spectroscopy on the former and the brighter component of the latter to verify their substellar nature. The resulting spectra do not exhibit the strong steam absorption bands that are expected for cool objects, demonstrating that they are not young brown dwarfs. The optical magnitudes and colors for these sources are also indicative of background stars rather than members of Taurus. Although the fainter component of the candidate protostellar binary lacks spectroscopy, we conclude that it is a galaxy rather than a substellar member of Taurus based on its colors and the constraints on its proper motion.

Dicty_cDB: Contig-U05787-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 534 ) Bos taurus clone CH240-467E17, WORKING DRAFT SEQU... 32 2.9 2 ( BD142887 ) Method of simple and quick determ.... 34 3.1 3 ( AR634817 ) Sequence 19 from patent US 6852489. 34 3.1 3 ( BD142885 ) Method of simple and quick determ...clone SSL573. 172 9e-64 2 ( EK498372 ) 1095505197154 Global-Ocean-Sampling_GS-32-...0.049 12 ( AC161851 ) Bos taurus clone CH240-99E24, WORKING DRAFT SEQUE... 44 0.049 2 ( EK274769 ) 1095462272251 Global-Ocean-Sampli...95458103663 Global-Ocean-Sampling_GS-26-01-01-1... 44 0.23 2 ( AC208960 ) Nomascu

Genotyping of β-Lactoglobulin gene by PCR-RFLP in Sahiwal and Tharparkar cattle breeds

Directory of Open Access Journals (Sweden)

Gupta Neelam

2006-05-01

population. Conclusion Genotype frequencies of AA were the lowest compared to that of BB genotype in Sahiwal cattle while AB genotypes were more frequent in Tharparkar cattle. The frequency of A allele was found to be lower than that of B allele in both the breeds studied. These results further confirm that Bos indicus cattle are predominantly of β-Lactoglobulin B type than Bos taurus breeds.

TAURUS, Post-processor of 3-D Finite Elements Plots

International Nuclear Information System (INIS)

Brown, B.E.; Hallquist, J.O.; Kennedy, T.

2002-01-01

Description of program or function: TAURUS reads the binary plot files generated by the LLNL three-dimensional finite element analysis codes, NIKE3D (NESC 9725), DYNA3D (NESC 9909), TACO3D (NESC 9838), TOPAZ3D (NESC9599) and GEMINI and plots contours, time histories, and deformed shapes. Contours of a large number of quantities may be plotted on meshes consisting of plate, shell, and solid type elements. TAURUS can compute a variety of strain measures, reaction forces along constrained boundaries, and momentum. TAURUS has three phases: initialization, geometry display with contouring, and time history processing

Le Flaubert de Charles Du Bos

Directory of Open Access Journals (Sweden)

Jacques Neefs

2009-01-01

Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

Science.gov (United States)

2014-01-01

Background Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in particular genome-wide single nucleotide polymorphism (SNP) markers, can complement historic and archaeological records to elucidate these past events. However, SNP ascertainment in cattle has been optimized for taurine breeds, imposing limitations to the study of diversity in zebu cattle. As amplified fragment length polymorphism (AFLP) markers are discovered and genotyped as the samples are assayed, this type of marker is free of ascertainment bias. In order to obtain unbiased assessments of genetic differentiation and structure in taurine and zebu cattle, we analyzed a dataset of 135 AFLP markers in 1,593 samples from 13 zebu and 58 taurine breeds, representing nine continental areas. Results We found a geographical pattern of expected heterozygosity in European taurine breeds decreasing with the distance from the domestication centre, arguing against a large-scale introgression from European or African aurochs. Zebu cattle were found to be at least as diverse as taurine cattle. Western African zebu cattle were found to have diverged more from Indian zebu than South American zebu. Model-based clustering and ancestry informative markers analyses suggested that this is due to taurine introgression. Although a large part of South American zebu cattle also descend from taurine cows, we did not detect significant levels of taurine ancestry in these breeds, probably because of systematic backcrossing with zebu bulls. Furthermore, limited zebu introgression was found in Podolian taurine breeds in Italy. Conclusions The assessment of cattle diversity reported here contributes an unbiased global view to genetic differentiation and structure of taurine and zebu cattle

Crossbreeding to increase beef production: additive and non ...

African Journals Online (AJOL)

GScholtz

2013-06-06

Jun 6, 2013 ... indicus x taurus direct heterosis effects on all weight traits were greater than .... An important advantage of partitioning breed effects as described above is .... value-unit of products under varying management and marketing ...

Inseminação artificial em tempo fixo e diagnóstico precoce de gestação em vacas leiteiras mestiças Timed artificial insemination and early pregnancy diagnosis in crossbred dairy cows

Directory of Open Access Journals (Sweden)

Cláudio França Barbosa

2011-01-01

Full Text Available Avaliou-se, durante um ano, o desempenho reprodutivo de 94 vacas leiteiras mestiças Bos taurus x Bos indicus submetidas a um programa de reprodução assistida. Um protocolo de inseminação artificial em tempo fixo (IATF foi executado por meio de dispositivo intravaginal contendo progesterona e das injeções de prostaglandina F2α e de cipionato de estradiol. Por meio de ultrassonografia, entre 7 e 14 dias após as inseminações ou montas controladas, realizou-se a detecção de corpo lúteo nos ovários a fim de determinar a taxa de ovulação e, no 28º dia, fez-se o diagnóstico de gestação para cálculo da taxa de concepção. Respeitou-se um período mínimo de 34 dias após o parto antes do tratamento. Não houve influência do escore de condição corporal e da presença de corpo lúteo no início do protocolo, nem da reutilização do dispositivo intravaginal e da monta controlada ou inseminação artificial, sobre as taxas de ovulação, concepção e concepção das vacas ovuladas. As taxas de concepção e de concepção das vacas ovuladas foram afetadas negativamente pelo elevado número de dias pós-parto (DPP, ou dias em lactação e pela época quente do ano, primavera/verão. A resposta ao protocolo de inseminação artificial em tempo fixo baseado no uso de progesterona, PGF2α e cipionato de estradiol é prejudicada pelo aumento dos dias em lactação e pela época quente do ano. A condição corporal não afeta a resposta ao protocolo de inseminação artificial, desde que as vacas tratadas apresentem escore acima de 2,25 pontos.It was evaluated, during a period of one year, the reproductive performance of 94 Bos taurus x Bos indicus crossbred dairy cows submitted to an assisted reproduction program. A timed artificial insemination (TAI protocol was carried out by using an intra-vaginal progesterone device containing progesterone and through injections with Prostaglandin F2α and estradiol cypionate. By using ultrasound

Soil bulk density and biomass partitioning of Brachiaria decumbens in a silvopastoral system Densidade do solo e partição de biomassa de Brachiaria decumbens em um sistema silvopastoril

Directory of Open Access Journals (Sweden)

Domingos Sávio Campos Paciullo

2010-10-01

Full Text Available Shade in silvopastoral systems improves the thermal comfort of animals, but it may also affect the pasture productivity and can contribute to soil compaction in the shaded areas due to the increase in the number of animals looking for comfort. The effect of grazing at various distances from tree rows (under the tree canopy, at 6 and at 12 m away from the trees on the soil bulk density and on the aerial and root biomass of Brachiaria decumbens was evaluated in both the dry and the rainy seasons. The study was carried out on an Orthic Ferralsol in a randomized block design with two replications. Tree rows were composed of Eucalyptus grandis and Acacia mangium species, and the paddocks were submitted to a rotational stocking management, using Holstein (Bos taurus × Zebu (Bos indicus heifers. The shade intensity in the pasture decreased with an increasing distance from the tree row. Soil bulk density did not vary with the distance from the tree row, but varied seasonally, being greater in the rainy season (1.47 g cm-3 than in the dry season (1.28 g cm-3. Green forage and root mass, expressed as dry matter, were lower under the tree canopy and were greater in the rainy season. There were decreases of 22.3 and 41.4% in the aerial and root biomasses, respectively, in the tree rows. The greatest shoot/root ratio for B. decumbens under moderate and intensive shading indicates a modification in the forage biomass allocation pattern that favours the aerial development in detriment of the root system.O sombreamento em sistemas silvipastoris concorre para o conforto térmico dos animais; no entanto pode afetar a produção do pasto e contribuir para a compactação do solo, pelo aumento da concentração de animais nas áreas sombreadas. Avaliou-se o efeito da distância do renque de árvores (sob a copa das árvores, 6 e 12 m de distancia das árvores na densidade do solo e na biomassa aérea e de raízes de Brachiaria decumbens, nas épocas seca e chuvosa

Exome-wide DNA capture and next generation sequencing in domestic and wild species

Directory of Open Access Journals (Sweden)

Ng Sarah B

2011-07-01

Full Text Available Abstract Background Gene-targeted and genome-wide markers are crucial to advance evolutionary biology, agriculture, and biodiversity conservation by improving our understanding of genetic processes underlying adaptation and speciation. Unfortunately, for eukaryotic species with large genomes it remains costly to obtain genome sequences and to develop genome resources such as genome-wide SNPs. A method is needed to allow gene-targeted, next-generation sequencing that is flexible enough to include any gene or number of genes, unlike transcriptome sequencing. Such a method would allow sequencing of many individuals, avoiding ascertainment bias in subsequent population genetic analyses. We demonstrate the usefulness of a recent technology, exon capture, for genome-wide, gene-targeted marker discovery in species with no genome resources. We use coding gene sequences from the domestic cow genome sequence (Bos taurus to capture (enrich for, and subsequently sequence, thousands of exons of B. taurus, B. indicus, and Bison bison (wild bison. Our capture array has probes for 16,131 exons in 2,570 genes, including 203 candidate genes with known function and of interest for their association with disease and other fitness traits. Results We successfully sequenced and mapped exon sequences from across the 29 autosomes and X chromosome in the B. taurus genome sequence. Exon capture and high-throughput sequencing identified thousands of putative SNPs spread evenly across all reference chromosomes, in all three individuals, including hundreds of SNPs in our targeted candidate genes. Conclusions This study shows exon capture can be customized for SNP discovery in many individuals and for non-model species without genomic resources. Our captured exome subset was small enough for affordable next-generation sequencing, and successfully captured exons from a divergent wild species using the domestic cow genome as reference.

Exome-wide DNA capture and next generation sequencing in domestic and wild species.

Science.gov (United States)

Cosart, Ted; Beja-Pereira, Albano; Chen, Shanyuan; Ng, Sarah B; Shendure, Jay; Luikart, Gordon

2011-07-05

Gene-targeted and genome-wide markers are crucial to advance evolutionary biology, agriculture, and biodiversity conservation by improving our understanding of genetic processes underlying adaptation and speciation. Unfortunately, for eukaryotic species with large genomes it remains costly to obtain genome sequences and to develop genome resources such as genome-wide SNPs. A method is needed to allow gene-targeted, next-generation sequencing that is flexible enough to include any gene or number of genes, unlike transcriptome sequencing. Such a method would allow sequencing of many individuals, avoiding ascertainment bias in subsequent population genetic analyses.We demonstrate the usefulness of a recent technology, exon capture, for genome-wide, gene-targeted marker discovery in species with no genome resources. We use coding gene sequences from the domestic cow genome sequence (Bos taurus) to capture (enrich for), and subsequently sequence, thousands of exons of B. taurus, B. indicus, and Bison bison (wild bison). Our capture array has probes for 16,131 exons in 2,570 genes, including 203 candidate genes with known function and of interest for their association with disease and other fitness traits. We successfully sequenced and mapped exon sequences from across the 29 autosomes and X chromosome in the B. taurus genome sequence. Exon capture and high-throughput sequencing identified thousands of putative SNPs spread evenly across all reference chromosomes, in all three individuals, including hundreds of SNPs in our targeted candidate genes. This study shows exon capture can be customized for SNP discovery in many individuals and for non-model species without genomic resources. Our captured exome subset was small enough for affordable next-generation sequencing, and successfully captured exons from a divergent wild species using the domestic cow genome as reference.

Effect of Cooking on Quality Commonly Consumed Marine Fish Platycephalidae (Platycephalus indicus in Iran

Directory of Open Access Journals (Sweden)

Ali Aberoumand

2015-11-01

Full Text Available Fish Platycephalus indicus usually are consumed by southern people in Iran. The present study assessed the effect of processing on proximate compositions in the fillets of P.indicus. The fish samples were prepared by boiling, baking and frying, while proximate analysis was done by standard methods. Boiling processing method significantly reduced ash content in the fillet whereas fat content was significantly increased in frying. Baking method recorded highest ash content of 10.64%. The highest protein concentration was obtained for boiled fillet (82.73%. Lipid content was recorded highest in fried fillet (17.27%. P. indicus was, rich in fat, protein, and ash, thus its consumption should be encouraged.

Phylogenetic analysis reveals two genotypes of the emerging fungus Mucor indicus, an opportunistic human pathogen in immunocompromised patients.

Science.gov (United States)

Taj-Aldeen, Saad J; Almaslamani, Muna; Theelen, Bart; Boekhout, Teun

2017-07-12

Mucormycosis is a rare fungal infection caused by Mucor indicus. Phylogenetic analysis of many M. indicus isolates, mainly sampled from different clinical and environmental specimens collected worldwide, revealed two genotypes, I and II, based on ITS and D1/D2 LSU rDNA sequences. A retrospective review of the literature revealed 13 cases. Eight (76.9%) patients had disseminated infections, and the overall mortality rate was 30.7%. A pulmonary infection caused by M. indicus genotype I in a liver transplant recipient was disseminated to include the skin and was successfully treated with liposomal amphotericin B and aggressive surgery. M. indicus can infect a wide variety of patients with no real preference for the site of infection. We concluded that M. indicus has emerged as a significant cause of invasive mycosis in severely immunocompromised patients worldwide. Early diagnosis and initiation of appropriate therapy could enhance survival in these immunocompromised patient populations.

Bacterial flora of pond reared Penaeus indicus (Milne Edwards)

Digital Repository Service at National Institute of Oceanography (India)

Singh, I.S.B.; Lakshmanaperumalsamy, P.; Chandramohan, D.

The population size, generic diversity and potential to produce hydrolytic enzymes of heterotrophic bacteria associated with pond reared Penaeus indicus was worked out following standard bacteriological procedures. Chitinoclastic vibrios were found...

Solid CO in the Taurus dark clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; McFadzean, A.D.

1985-01-01

The infrared vibrational feature of solid state CO at 4.67 μm wavelength is detected towards five sources in or behind the dark cloud complex in Taurus. A comparison with millimetre-wave data suggests that a significant fraction (up to 40 per cent) of the CO may be depleted on to grains. The adjacent CN feature at 4.62 μm observed in W33A by previous authors is absent from the present spectra, suggesting that the grain mantles in Taurus are unannealed. (author)

Mucor indicus: biology and industrial application perspectives: a review.

Science.gov (United States)

Karimi, Keikhosro; Zamani, Akram

2013-01-01

Mucor indicus, one of the most important strains of zygomycetes fungi, has been the subject of several studies since a couple of hundred years ago. This fungus, regarded as a non-pathogenic dimorphic microorganism, is used for production of several beers and foods. Morphology of the fungus can be manipulated and well controlled by changing a number of parameters. Furthermore, M. indicus can grow on a variety of substrates including lignocellulosic hydrolysates which are mixtures of hexoses, pentoses, and different severe fermentation inhibitors. Indeed, high yield ethanol production is among the most important features of this strain. Presence of considerable amounts of chitosan in the cell wall is another important aspect of the fungus. Besides production of ethanol and chitosan, the biomass of this fungus has shown a great potential to be used as a rich nutritional source, e.g. fish feed. The fungus is also among the oleaginous fungi and produces high amounts of polyunsaturated fatty acids particularly γ-linolenic acid. Furthermore, the biomass autolysate has a high potential for yeast extract replacement in fermentation by the fungus. Additionally, the strain has shown promising results in heavy metal removal from wastewaters. This review discusses different aspects of biology and industrial application perspectives of M. indicus. Furthermore, open areas for the future basic and applied levels of research are also presented. Copyright © 2013 Elsevier Inc. All rights reserved.

Gene : CBRC-CPOR-01-1484 [SEVENS

Lifescience Database Archive (English)

Full Text Available 2e-35 41% ref|XP_870944.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 6e-71 60% M...SIPKATNQSKKITLHILFLSTLFIISNTLRQPRCPSMETCECAFYSSVVVPKLLENLLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTRFRAVCHPLLYMVAY

GENERAL ASPECTS OF BODY MEASURES, WEIGHT AND SCORE CONDITION FEMALE NELORE BREED (Bos taurus indicus ON THE PERIOD OF 12 MONTHS ESTUDIO DE MEDIDAS CORPORALES, PESO VIVO Y CONDICIÓN CORPORAL DE BOVINOS HEMBRAS DE LA RAZA NELORE (Bos taurus indicus POR 12 MESES ESTUDO DE MEDIDAS CORPORAIS, PESO VIVO E CONDIÇÃO CORPORAL DE FÊMEAS DA RAÇA NELORE (Bos taurus indicus AO LONGO DE 12 MESES

Directory of Open Access Journals (Sweden)

Arcádio de Los Reys Borjas

2008-04-01

Full Text Available Four hundred and eighty cattle were used to verify alterations and correlations among corporal measures in Nelore zebu herd with cows and heifers. Body weight and length, corporal condition, heart girth, withers height and hip measures were evaluated. Eight collections were accomplished along the months of October of 2002 and October of 2003. In heifers there was increase of the averages of corporal measures with significant difference (p <0,05 among collections only the heart girth was different (p <0,05 in cows. The relationship between the body weight and body condition with the time were quadratic parallel curves (p <0,001. There were correlations among lineal measures body with hip measures (p<0,001 except for heart girth with hip length. The correlations of body weight and body condition among body measures were significant (p<0,001 except body condition with hip length in cows. It could be concluded that there was a growing variation of the body measures in heifers in the experimental period. The body weight, the body condition and heart girth were related with different periods of the year that the evaluation was accomplished. In cows the variations along the year were of 14,79%, 31,53% and 6,74%, respectively. The isquiun – iliun external measures, as height and width were correlated with size measures and weight. The body weight and body condition in heifers behave in way similar to cows. Further researches in relationship among body measures, body weight and body condition with productive and reproductive aspect are necessary. Con el objetivo de verificar alteraciones y correlaciones entre medidas corporales en un rebaño bovino de vaquillonas y vacas de la raza Nelore. Evaluaron-se 487 hembras en peso vivo, condición corporal, perímetro toráxico, largura corporal, altura de la cruz y medidas da anca. Fueron realizadas ocho coletas a lo largo de los meses de octubre de 2002 y octubre de 2003. En las vaquillonas hubo un aumento de las medidas corporales (p<0,05 entre colectas. Para las vacas el perímetro toráxico presentó diferencia significativa (p<0,05. La relación entre peso vivo condición corporal con el tiempo mostró ecuación cuadrática y fueron parecidas y paralelas para a condición corporal. En el peso vivo, la parte cóncava de la curva para las vacas fue mas abierta comparada a las de vaquillonas. Los coeficientes de correlación entre medidas corporales lineares con las medidas de la anca fueron elevadas (p<0,001, excepto para el perímetro toráxico con largura de la anca. Las correlaciones del peso vivo y condición corporal con medidas corporales fueron significativas (p<0,001, excepto para la condición corporal con la largura de la anca en las categorías; condición corporal versus altura de la anca y peso vivo con largura de la anca para las vacas. Como conclusiones de este trabajo: hubo una variación creciente de las medidas corporales en las vaquillonas en el período de las colecta. El peso vivo, la condición corporal y perímetro toráxico estuvieron relacionados con diferentes períodos del ano que fue realizada el experimento. En vacas las variações a lo largo de año fueron de 14,79%, 31,53% e 6,74%, respectivamente. Las medidas externas ísquio-iliacas, como altura e largura, estuvieron correlacionadas con medidas de tamaño y peso. Vaquillonas en fase de crecimiento tuvieron un comportamiento de forma análoga a las vacas con respecto al peso vivo y condición corporal. Mas investigaciones serian necesarias de las relaciones de las medidas corporales, peso vivo y condición corporal con los aspectos productivos e reproductivos. RESUMO – Objetivou-se verificar alterações e correlações entre medidas corporais em rebanho bovino de novilhas e vacas da raça Nelore. Avaliaram-se 487 fêmeas, quanto ao peso vivo, condição corporal, perímetro torácico, comprimento corporal, altura de cernelha e medidas da garupa. Foram realizadas oito coletas ao longo dos meses de outubro de 2002 e outubro de 2003. Nas novilhas houve aumento das médias de medidas corporais com diferença significativa (p<0,05 entre coletas. Para vacas o perímetro torácico apresentou diferença significativa (p<0,05. Na análise quadrática do peso vivo e condição corporal, as curvas se assemelharam, de maneira paralela para a condição corporal. Quanto ao peso vivo, a parte côncava da curva para vacas foi mais aberta comparada às novilhas. Coeficientes de correlação entre medidas lineares com medidas de garupa apresentaram significância (p<0,001, exceto para perímetro torácico com comprimento de garupa. Nas correlações do peso vivo e condição corporal com medidas corporais foram significativas (p<0,001, exceto para condição corporal versus comprimento de garupa nas categorias; condição corporal versus altura de garupa e peso vivo versus comprimento de garupa para vacas. Pode-se concluir que houve uma variação crescente das medidas corporais nas novilhas no período de coleta. O peso vivo, a condição corporal e perímetro torácico estiveram relacionados com diferentes períodos do ano que foi realizada a avaliação. Em vacas as variações ao longo do ano foram de 14,79%, 31,53% e 6,74%, respectivamente. As medidas externas ísquio-iliacas, como altura e largura, estão correlacionadas com medidas de tamanho e peso. Fêmeas em fase de crescimento comportam-se de maneira análoga às fêmeas adultas quanto ao peso vivo e condição corporal. Pesquisas da relação das medidas corporais, peso vivo e condição corporal com o aspecto produtivo e reprodutivo são necessários.

Gene : CBRC-DNOV-01-1811 [SEVENS

Lifescience Database Archive (English)

Full Text Available _HUMAN 1e-69 68% ref|XP_588566.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 2e-7...9 78% MQHCLSSWCPSWTLNSTLLCIFFLSHFSFLDLCFLSSIIPQLLVNLKCSDKSITYVDCMIQLYVSLVMGYTECIHLAVMTYDHYVAVCHPLHYIFFMHLWLRHVLASME

stress and adaptation in beef heifers: 1. effect of pen conditions on ...

African Journals Online (AJOL)

Korthoring). Bos indicus (Afrikaner) en intermedibre (Bonsmara) tipe, is ingekraal teen. 'n vloer- .... body mass on average, and were in a state of sub-mainte- nance nutrition for 87 /, of the 2l week trial period. (Fig. l). At termination, Afrikaner heifers ...

Correlation analysis of the Taurus molecular cloud complex

International Nuclear Information System (INIS)

Kleiner, S.C.

1985-01-01

Autocorrelation and power spectrum methods were applied to the analysis of the density and velocity structure of the Taurus Complex and Heiles Cloud 2 as traced out by 13 CO J = 1 → 0 molecular line observations obtained with the 14m antenna of the Five College Radio Astronomy Observatory. Statistically significant correlations in the spacing of density fluctuations within the Taurus Complex and Heiles 2 were uncovered. The length scales of the observed correlations correspond in magnitude to the Jeans wavelengths characterizing gravitational instabilities with (i) interstellar atomic hydrogen gas for the case of the Taurus complex, and (ii) molecular hydrogen for Heiles 2. The observed correlations may be the signatures of past and current gravitational instabilities frozen into the structure of the molecular gas. The appendices provide a comprehensive description of the analytical and numerical methods developed for the correlation analysis of molecular clouds

Ovarian activity and estrus behavior in early postpartum cows grazing Leucaena leucocephala in the tropics.

Science.gov (United States)

Bottini-Luzardo, Maria; Aguilar-Perez, Carlos; Centurion-Castro, Fernando; Solorio-Sanchez, Francisco; Ayala-Burgos, Armin; Montes-Perez, Ruben; Muñoz-Rodriguez, David; Ku-Vera, Juan

2015-12-01

The legume Leucaena leucocephala (Leucaena) is widely used to supplement forage in silvopastoral livestock systems in Latin America. Little is known about its possible effects on the cow reproductive dynamic. The aim was to evaluate the effect of Leucaena foliage intake on re-establishment of ovarian activity and estrus behavior in early postpartum (7-90 days) cows. Twenty-four multiparous Bos taurus × Bos indicus cows were divided into two homogenous groups and assigned to one of two treatments: a silvopastoral system (SS, n = 12), consisting of an association of Cynodon nlemfuensis grass and L. leucocephala; and a control system (CS, n = 12), consisting of C. nlemfuensis alone. Intake of Leucaena in the SS ranged from 3.80 to 6.43 kg DM/cow/day. Plasma mimosine concentrations ranged from 1270 to 1530 μg/mL, and those for 2,3-dihydroxypyridine (DHP) from 147 to 729 μg/mL. No 3,4-DHP was detected in plasma. No difference (P > 0.05) between treatments was observed for the number of cows exhibiting small, medium, or dominant follicles, or estrus behavior. The number of cows which re-established ovarian cyclicity (n = 6) was lower (P < 0.05) in the SS than in the CS (n = 9). Corpus luteum lifespan was longer (P < 0.05) in the SS than in the CS. Intake of Leucaena affected the number of cows exhibiting ovarian cyclicity and extended corpus luteum life, but did not affect follicular development and estrus behavior.

Viabilidade financeira da inseminação artificial em tempo fixo de bezerros cruzados Nelore e Aberdeen Angus = Economic feasibility of timed artificial insemination of Nellore and Aberdeen Angus crossbred calves

Directory of Open Access Journals (Sweden)

Nelson Zuchi Neto

2017-07-01

Full Text Available O cruzamento entre taurinos e zebuínos através de Inseminação Artificial em Tempo Fixo [IATF] é uma realidade presente em várias propriedades rurais no Brasil. Visando as vantagens da IATF em conjunto com as vantagens do cruzamento industrial o objetivo foi verificar a viabilidade financeira desta atividade em uma propriedade no município de Nova Lacerda, MT. Para tal, utilizou-se as ferramentas de matemática financeira Valor Presente Líquido [VPL], Taxa Interna de Retorno [TIR] e Payback. O projeto se mostrou viável com um VPL acima de R$ 300 mil, TIR de 23,03% e Payback descontado de aproximadamente oito anos. A venda de descartes e a suplementação dos bezerros em sistema de “creep feeding” se mostraram importantes para a viabilidade deste projeto. = Bos taurus and Bos indicus crossbred through Timed Artificial Insemination [TAI] is present in several farms in Brazil. Aiming the advantages of the TAI together with industrial crossing, the objective was to verify the economic feasibility of this activity on a farm in the city of Nova Lacerda, MT. Financial mathematics tools like Net Present Value [NPV], Internal Rate of Return [IRR] and Payback were used. The project was feasible with a NPV above R$ 300 thousand, an IRR of 23.03% and a Discounted Payback of approximately eight years. The sale of discards matrix and the supplementation of calves in a creep feeding system showed to be important for the viability of this project.

Worldwide Patterns of Ancestry, Divergence, and Admixture in Domesticated Cattle

Science.gov (United States)

Decker, Jared E.; McKay, Stephanie D.; Rolf, Megan M.; Kim, JaeWoo; Molina Alcalá, Antonio; Sonstegard, Tad S.; Hanotte, Olivier; Götherström, Anders; Seabury, Christopher M.; Praharani, Lisa; Babar, Masroor Ellahi; Correia de Almeida Regitano, Luciana; Yildiz, Mehmet Ali; Heaton, Michael P.; Liu, Wan-Sheng; Lei, Chu-Zhao; Reecy, James M.; Saif-Ur-Rehman, Muhammad; Schnabel, Robert D.; Taylor, Jeremy F.

2014-01-01

The domestication and development of cattle has considerably impacted human societies, but the histories of cattle breeds and populations have been poorly understood especially for African, Asian, and American breeds. Using genotypes from 43,043 autosomal single nucleotide polymorphism markers scored in 1,543 animals, we evaluate the population structure of 134 domesticated bovid breeds. Regardless of the analytical method or sample subset, the three major groups of Asian indicine, Eurasian taurine, and African taurine were consistently observed. Patterns of geographic dispersal resulting from co-migration with humans and exportation are recognizable in phylogenetic networks. All analytical methods reveal patterns of hybridization which occurred after divergence. Using 19 breeds, we map the cline of indicine introgression into Africa. We infer that African taurine possess a large portion of wild African auroch ancestry, causing their divergence from Eurasian taurine. We detect exportation patterns in Asia and identify a cline of Eurasian taurine/indicine hybridization in Asia. We also identify the influence of species other than Bos taurus taurus and B. t. indicus in the formation of Asian breeds. We detect the pronounced influence of Shorthorn cattle in the formation of European breeds. Iberian and Italian cattle possess introgression from African taurine. American Criollo cattle originate from Iberia, and not directly from Africa with African ancestry inherited via Iberian ancestors. Indicine introgression into American cattle occurred in the Americas, and not Europe. We argue that cattle migration, movement and trading followed by admixture have been important forces in shaping modern bovine genomic variation. PMID:24675901

Polarimetric study of the interstellar medium in Taurus Dark Clouds

International Nuclear Information System (INIS)

Hsu, J.

1985-01-01

An optical linear polarimetric survey was completed for more than 300 stars in an area of 6.5 0 x 10 0 toward the Taurus Dark Clouds Complex. It was found that the orientation of the magnetic field is roughly perpendicular to the elongation direction of the dust lanes, indicating cloud contraction along the magnetic field lines. The distance to the front edge of the dark clouds in Taurus is determined to be 126 pc. There is only insignificant amount of obscuring material between the cloud complex and the Sun. Besides the polarization data, the reddenings of about 250 stars were also obtained from the UBV photometry. The mean polarization to reddening ratio in the Taurus region is 4.6, which is similar to that of the general interstellar matter. The wavelengths of maximum polarization were determined for 30 stars in Taurus. They show an average value of lambda/sub max/ = 0.57 μm, which is only slightly higher than the mean value of the general interstellar medium, lambda/sub max/ = 0.55 μm. A few stars that show higher values of lambda/sub max/ are found near the small isolated regions of very high extinction. One such highly obscured small region where very complex long chain molecules have been discovered in the ratio spectra, is the Taurus Molecular Cloud 1

Study on the flare stars in the Taurus region

International Nuclear Information System (INIS)

Khodzhaev, A.S.

1986-01-01

The results of the search of flare stars and their photometric, Hsub(α)-spectroscopic and statistical study in the Taurus are presented. By means of photographic observations carried out during 1980-1984, 92 new flare stars were discovered, 13 of which are known Orion Population variables, and 16 repeated flare-ups among 13 known flare stars. Spatial distribution of these stars was considered and the problem of their membership was discussed. Comparative analysis of the data of flare stars in the Taurus with that of other systems has been carried out. The Herzsprung-Russel and two-colour (U-B, B-V) diagrams for the Taurus flare stars are similar to the diagrams of stellar clusters and associations (Pleiades, Orion etc.). The estimated total number of flare stars in this region is larger than 500

A WISE survey of circumstellar disks in Taurus

International Nuclear Information System (INIS)

Esplin, T. L.; Luhman, K. L.; Mamajek, E. E.

2014-01-01

We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M ☉ ).

A WISE survey of circumstellar disks in Taurus

Energy Technology Data Exchange (ETDEWEB)

Esplin, T. L.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E., E-mail: taran.esplin@psu.edu [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States)

2014-04-01

We have compiled photometry at 3.4, 4.6, 12, and 22 μm from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1-M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than ∼M8 (M ≳ 0.03 M {sub ☉}).

Interstellar ice grains in the Taurus molecular clouds

International Nuclear Information System (INIS)

Whittet, D.C.B.; Bode, M.F.; Baines, D.W.T.; Evans, A.

1983-01-01

Observations made in November 1981 using the United Kingdom Infrared Telescope (UKIRT) at Mauna Kea of the 3 μm ice absorption feature in the spectra of several obscured stars in the Taurus interstellar clouds are reported. The feature correlated in strength with extinction at visual wavelengths (Asub(v)), and is present in stars with Asub(v) as low as 4-6 mag. Ice may be widespread in the Taurus clouds, vindicating ideas on grain composition and growth first reported nearly 50 yr ago. (author)

T Tauri stars in Taurus - the IRAS view

International Nuclear Information System (INIS)

Harris, Stella; Clegg, Peter; Hughes, Joanne

1988-01-01

Statistical studies of star-formation have traditionally been beset with selection effects. We have developed a technique, using the completeness of the IRAS catalogue, which circumvents these effects. We have taken the properties of known T Tau stars within Taurus as a template to establish a purely IRAS-based definition of such sources. We then use this definition to extract, from the IRAS catalogue, all sources within a specific region of Taurus having those same IRAS properties. This wider class of source is examined and discussed. (author)

Population Structure Analysis of Bull Genomes of European and Western Ancestry

DEFF Research Database (Denmark)

Chung, Neo Christopher; Szyda, Joanna; Frąszczak, Magdalena

2017-01-01

Since domestication, population bottlenecks, breed formation, and selective breeding have radically shaped the genealogy and genetics of Bos taurus. In turn, characterization of population structure among diverse bull (males of Bos taurus) genomes enables detailed assessment of genetic resources...... and origins. By analyzing 432 unrelated bull genomes from 13 breeds and 16 countries, we demonstrate genetic diversity and structural complexity among the European/Western cattle population. Importantly, we relaxed a strong assumption of discrete or admixed population, by adapting latent variable models...... harboring largest genetic differentiation suggest positive selection underlying population structure. We carried out gene set analysis using SNP annotations to identify enriched functional categories such as energy-related processes and multiple development stages. Our population structure analysis of bull...

Characterization of pterin deaminase from Mucor indicus MTCC 3513

Science.gov (United States)

Thandeeswaran, M.; Karthika, P.; Mahendran, R.; Palaniswamy, M.; Angayarkanni, J.

2018-03-01

Pterin deaminase is an amidohydrolase enzyme which hydrolyses pteridines to produce lumazine derivatives and ammonia. Even though the enzyme was shown as early as 1959 for its anticancer efficacy there was a long gap in the communique after that which was in 2013. In our study we have chosen Mucor indicus MTCC 3513 which was a promising strain for production of different industrial products.The pterin deaminase enzyme was harvested and extracellular from M. indicus. The extracellular sample was partially purified by using ethanol precipitation and ion exchange column (Hi-Trap QFF) in Fast Protein Liquid Chromatography. The molecular weight of the purified pterin deaminase enzyme was apparently determined by SDS-PAGE. The purified enzyme was further biochemically characterized. Molecular docking studies with the predicted sequence showed higher binding affinity towards folic acid interaction. The structure of this protein may open the windows for new drug targets for cancer therapy.

Analgesic Activity of Sphaeranthus indicus Linn

OpenAIRE

P. Malairajan; G. Venu Babu; A. Saral; S. Mahesh; Gitanjali

2012-01-01

The ethanol extracts of the whole plant Sphaeranthus indicus Linn. (ALSI) (Compositae) was tested for analgesic activity by tail immersion method in rat models. The test extracts were tested at 250 mg and 500 mg/kg body weight. The analgesic activity was assessed by keeping pentazocine 10 mg/kg as standard drug. The parameters studied were tail withdrawal reflex and percentage protection. In tail immersion method ALSI pretreatment caused significant increase in analgesic activity and percenta...

Impact of Balance Of System (BOS) costs on photovoltaic power systems

Science.gov (United States)

Hein, G. F.; Cusick, J. P.; Poley, W. A.

1978-01-01

The Department of Energy has developed a program to effect a large reduction in the price of photovoltaic modules, with significant progress already achieved toward the 1986 goal of 50 cents/watt (1975 dollars). Remaining elements of a P/V power system (structure, battery storage, regulation, control, and wiring) are also significant cost items. The costs of these remaining elements are commonly referred to as Balance-of-System (BOS) costs. The BOS costs are less well defined and documented than module costs. The Lewis Research Center (LeRC) in 1976/77 and with two village power experiments that will be installed in 1978. The costs were divided into five categories and analyzed. A regression analysis was performed to determine correlations of BOS Costs per peak watt, with power size for these photovoltaic systems. The statistical relationship may be used for flat-plate, DC systems ranging from 100 to 4,000 peak watts. A survey of suppliers was conducted for comparison with the predicted BOS cost relationship.

EGRET observations of diffuse gamma-ray emission in taurus and perseus

International Nuclear Information System (INIS)

Digel, Seth W.; Grenier, Isabelle A.

2001-01-01

We present an analysis of the interstellar gamma-ray emission observed toward the extensive molecular cloud complexes in Taurus and Perseus by the Energetic Gamma-Ray Experiment Telescope (EGRET). The region's large size (more than 300 square degrees) and location below the plane in the anticenter are advantageous for straightforward interpretation of the interstellar emission. The complex of clouds in Taurus has a distance of ∼140 pc and is near the center of the Gould Belt. The complex in Perseus, adjacent to Taurus on the sky, is near the rim of the Belt at a distance of ∼300 pc. The findings for the cosmic-ray density and the molecular mass-calibrating ratio N(H 2 )/W CO in Taurus and Perseus are compared with results for other nearby cloud complexes resolved by EGRET. The local clouds that now have been studied in gamma rays can be used to trace the distribution of high-energy cosmic rays within 1 kpc of the sun

B- AND A-TYPE STARS IN THE TAURUS-AURIGA STAR-FORMING REGION

International Nuclear Information System (INIS)

Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

2013-01-01

We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), τ Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

Phylogenetic analysis reveals two genotypes of the emerging fungus Mucor indicus, an opportunistic human pathogen in immunocompromised patients

NARCIS (Netherlands)

Taj-Aldeen, Saad J.; Almaslamani, Muna; Theelen, B.J.F.; Boekhout, Teun

2017-01-01

Mucormycosis is a rare fungal infection caused by Mucor indicus. Phylogenetic analysis of many M. indicus isolates, mainly sampled from different clinical and environmental specimens collected worldwide, revealed two genotypes, I and II, based on ITS and D1/D2 LSU rDNA sequences. A retrospective

Factors affecting conception rates in cattle following embryo transfer ...

African Journals Online (AJOL)

Embryo Transfer Technology (ETT) plays an important role in improving productivity of dairy cattle (Bos indicus). Embryo Transfer Technology allows top quality female livestock to improve a herd or flock in much the same way that artificial insemination has allowed greater use of superior sires. The technology hastens ...

Zvířecí kosterní pozůstatky z popraviště ve Vodňanech

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2006-01-01

Roč. 58, č. 4 (2006), s. 813-814 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : scaffold * Bos taurus * burned bones * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

Nuclear and mitochondrial DNA markers in traceability of retail beef samples Marcadores de DNA nuclear e mitocondrial para rastreabilidade da carne bovina comercializada

Directory of Open Access Journals (Sweden)

Aline S.M. Cesar

2010-09-01

Full Text Available Several characteristics are important in a traceability system of animal products, such as age at slaughter, breed composition, besides information of the productive chain. In general, the certification agent records information about the animals and the system which it came from, although cannot guarantee that the slaughtering, meat processing and distribution are error proof. Besides, there is a differential price, at least at the international market, based on sex and breed composition of the animals. Genetic markers allow identification of characteristics controlled in the beef cattle traceability program, as sex and breed composition, in order to correctly identify and appraise the final product for the consumer. The hypothesis of this study was that the majority beef samples retailed in the local market originate from female with a great participation of zebu breeds. Therefore, the objective of this work was to characterize retail beef samples with DNA markers that identify cattle sex and breed composition. Within 10 beef shops localized in Pirassununga, SP, Brazil, 61 samples were collected, all were genotyped as harboring Bos taurus mitochondrial DNA and 18 were positive for the Y chromosome amplification (male. For the marker sat1711b-Msp I the frequency of the allele A was 0.278 and for the marker Lhr-Hha I the frequency of the allele T was 0.417. The results of sat1711b-Msp I and Lhr-Hha I allelic frequencies are suggestive that the proportion of indicus genome compared with the taurine genome in the market meat is smaller than the observed in the Nellore breed. The procedure described in this study identified sex and subspecies characteristics of beef meat samples, with potential application in meat products certification in special as an auxiliary tool in beef cattle traceability programs.Várias características são importantes no sistema de rastreabilidade, como o sexo, a idade, a raça e/ou a composição racial dos animais, al

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_776444.1| chondroadherin [Bos taurus] sp|Q27972|CHAD_BOVIN Chondroad...herin precursor (Cartilage leucine-rich protein) (38 kDa bone protein) [Contains: Chondroadherin m

A study of flare stars in the taurus region

International Nuclear Information System (INIS)

Khodzhaev, A.S.

1986-01-01

The results are given of a search for flare stars in the region of the dark clouds in Taurus together with the results of photometric, H /sub alpha/ -spectroscopic, and statistical investigations of them. Photographic observations during 1980-1984 revealed 92 new flare stars, 13 of which were found to be known Orion variables with 16 repeated flares of 13 previously known flare stars. Their apparent distribution is considered. The question of whether the flare stars belong to a dark cloud is discussed. A comparative analysis of the flare stars in the Taurus region and other aggregates is made. The Hertzsprung-Russell (V, B - V) and two-color (U - B, B - V) diagrams for the flare stars are similar to the corresponding diagrams constructed for star clusters and associations (Pleiades, Orion, etc.). The total number of flare stars in the region of the dark clouds in Taurus is estimated at ≥ 500

Strategic control of ticks with synthetic pyrethroids in Theileria parva ...

African Journals Online (AJOL)

The effect of tick control by strategic dipping in synthetic pyrethroids on growth and survival rates of calves in Eastern Tanzania where Theileria parva and other tick borne infections (babesiosis, anaplasmosis and ehrlichiosis) are endemic was measured. One day to five months old Tanganyika short horn zebu (Bos indicus) ...

Dietary nitrate supplementation reduces methane emission in beef cattle fed sugarcane-based diets

NARCIS (Netherlands)

Hulshof, R.B.A.; Berndt, A.; Gerrits, W.J.J.; Dijkstra, J.; Zijderveld, van S.M.; Newbold, J.R.; Perdok, H.B.

2012-01-01

The objective of this study was to determine the effect of dietary nitrate on methane emission and rumen fermentation parameters in Nellore × Guzera (Bos indicus) beef cattle fed a sugarcane based diet. The experiment was conducted with 16 steers weighing 283 ± 49 kg (mean ± SD), 6 rumen cannulated

Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2011-01-01

Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

Nature conservation and grazing management. Free-ranging cattle as a driving force for cyclic vegetation seccession

NARCIS (Netherlands)

Bokdam, J.

2003-01-01

Key-words : biodiversity, herbivory, wilderness, non-linear dynamics, mosaic cycling, grassland, wood encroachment, forest, Bos taurus , Calluna vulgaris , Deschampsia flexuosa.This thesis examines the suitability of controlled and wilderness grazing as conservation management tool for open,

BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.

Science.gov (United States)

Zhang, Xiaoyu; Wessler, Susan R

2005-05-01

Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.

Black gram ( L. foliage supplementation to crossbred cows: effects on feed intake, nutrient digestibility and milk production

Directory of Open Access Journals (Sweden)

Avijit Dey

2017-02-01

Full Text Available Objective An experiment was conducted to examine the effect of dietary supplementation of dried and ground foliage of black gram (Vigna mungo L. on feed intake and utilization, and production performance of crossbred lactating cows. Methods Eighteen lactating crossbred (Bos taurus×Bos indicus cows (body weight 330.93± 10.82 kg at their second and mid lactation (milk yield 6.77±0.54 kg/d were randomly divided into three groups of six each in a completely randomized block design. Three supplements were formulated by quantitatively replacing 0, 50, and 100 per cent of dietary wheat bran of concentrate mixture with dried and ground foliage of black gram. The designated supplement was fed to each group with basal diet of rice straw (ad libitum to meet the requirements for maintenance and milk production. Daily feed intake and milk yield was recorded. A digestion trial was conducted to determine the total tract digestibility of various nutrients. Results The daily feed intake was increased (p0.05, the fibre digestibility was increased (p0.05 among the groups, milk yield was increased by 10 per cent with total replacement of wheat bran in concentrate mixture with of black gram foliage. The economics of milk production calculated as feed cost per kg milk yield (INR 10.61 vs 7.98 was reduced by complete replacement of wheat bran with black gram foliage. Conclusion Black gram foliage could be used as complete replacement for wheat bran in concentrate mixture of dairy cows in formulating least cost ration for economic milk production in small holders’ animal production.

Idade de desmame e suplementação no desenvolvimento e em características de carcaças de novilhos de corte

Directory of Open Access Journals (Sweden)

Almeida Luciane Salgueiro Pio de

2003-01-01

Full Text Available O experimento foi conduzido na Estação Experimental da Universidade Federal do Rio Grande do Sul, município de Eldorado do Sul, Brasil, a fim de avaliar o desempenho de 40 bezerros filhos de vacas cruzas Bos indicus x Bos taurus até os dois anos de idade, desmamados precocemente (DP, com média de idade de 91 dias e mínimo de 70 kg de peso vivo, ou desmamados à idade convencional (DC, média de 170 dias de idade e peso médio de 131,2 kg, suplementados (Su ou não (NSu com ração energético-protéica com 14% de proteína bruta e 75% de nutrientes digestíveis totais, durante 91 dias no primeiro inverno. O delineamento experimental utilizado foi o delineamento completamente casualizado. Os novilhos do DP foram mais leves até um ano de idade (DP=208,7 kg x DC=233,5 kg. Aos 18-20 meses de idade, os novilhos não eram mais estatisticamente diferentes em seus pesos vivos (DP=279,9 kg x DC=292,5 kg. Ao abate, os pesos vivos médios foram de 432,3 kg (DC e 414,0 kg (DP, não diferindo também no rendimento, acabamento, conformação e classificação das carcaças. O desmame precoce não impediu o desenvolvimento e o abate dos novilhos aos dois anos de idade. A suplementação no primeiro inverno não alterou o desempenho dos novilhos ao abate.

Action of exogenous oxytocin on stress modulation in crossbred Red Angus cows

Directory of Open Access Journals (Sweden)

Janne Paula Neres de Barros

2016-10-01

Full Text Available Cattle (Bos taurus and Bos indicus are organised on the basis of leadership and dominance in such a manner that a disturbance by an external stressor causes negative effects on their health, productivity, well-being, and behaviour. One of these effects is the excessive release of glucocorticoids, which results in increased alertness. We evaluated the action of exogenous oxytocin (OT on serum cortisol levels in crossbred Red Angus heifers. Twelve Red Angus crossbred heifers were moved daily from the pasture to the corral in weeks 1 and 2 for adaptation to human contact and handling in the cattle crush. In weeks 3 and 4, they were divided into two groups of six (T1 and T2. The T1 group was administered 20 IU (2 mL of OT via intramuscular injection and the T2 group was administered 2 mL of saline solution 0.85% (SS. In weeks 5 and 6, they were only contained in the cattle crush for evaluation. On days 01, 07, 14, 21, 28, 35, and 42, blood samples were collected by jugular venepuncture in vacuum tubes without anticoagulants. Then, serum cortisol levels were measured using a radioimmunoassay. In the period of adaptation, during weeks 1 and 2, serum cortisol levels decreased in both the groups, with higher levels in the SS group; the same result was obtained in weeks 5 and 6. During treatment, however, there was a significant difference between the two groups in week 4, with a reduction in cortisol levels in the OT group. This result suggests a modulator effect of OT on neuroendocrine response to stress.

New functions to estimate 305-days milk production of Gir cows : Novas Funções para Estimar a Produção de Leite, em 305 Dias de Lactação, de Vacas da Raça Gir

NARCIS (Netherlands)

Reboucas, G.F.; Moraes Goncalves, de T.; Martines, M.L.; Azevedo Junior, J.; Koops, W.J.

2008-01-01

This study aimed to calculate new accumulated and daily functions based on the Michaelis-Menten equation to estimate the 305-days production of Gir cows using test day milk yields. Data consisted of 7,412 lactation records of 3,416 Gir cows (Bos indicus) collected from 1987 to 2004 in 51 herds

Identification and isolation of gene differentially expressed on scrotal ...

African Journals Online (AJOL)

Yomi

2012-01-05

Jan 5, 2012 ... 1Laboratory of Molecular Biology and Bovine Breeding, Institute ... there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and ..... orchestrate microtubule dynamics and determine the.

The first complete mitochondrial genome of a Belostomatidae species, Lethocerus indicus, the giant water bug: An important edible insect.

Science.gov (United States)

Devi, Kshetrimayum Miranda; Shantibala, Tourangbam; Debaraj, Hajarimayum

2016-10-10

Lethocerus indicus of the family Belostomatidae is one of the most preferred and delicious edible insects in different parts of South-East Asia including North-East, India. The mitogenome of L. indicus represents the first complete mitogenome sequence of a Belostomatidae species in Heteroptera order. The mitogenome of L. indicus is 16,251bp and contains 37 genes including 13 protein coding genes (PCGs), 22 tRNA genes, two rRNA genes, and a large non-coding region. The genome has a typical gene order which is identical to other Heteroptera species. All tRNAs exhibit the classic cloverleaf secondary structure except tRNASer (AGN). All the PCGs employ a complete translation termination codon either TAA or TAG except COII. The nucleotide composition showed heavy biased toward AT accounting to 70.9% of total mitogenome. The overall A+T content of L. indicus mitogenome was comparatively lower than some other Heteropteran bugs mitogenomes. The control region is divided into seven different parts which includes the putative stem loop, repeats, tandem repeats, GC and AT rich regions. The phylogenetic relationship based on maximum-likelihood method using all protein coding genes was congruent with the traditional morphological classification that Belostomatidae is closely related to Nepidae. The complete mitogenome sequence of L. indicus provides fundamental data useful in conservation genetics and aquaculture diversification. Copyright © 2016. Published by Elsevier B.V.

A near-infrared survey for pre-main sequence stars in Taurus

Science.gov (United States)

Gomez, Mercedes; Kenyon, Scott J.; Hartmann, Lee

1994-01-01

We present a near-infrared survey of approximately 2 sq deg covering parts of L1537, L1538, and Heiles cloud 2 in the Taurus-Auriga molecular cloud. Although this study is more sensitive than previous attempts to identify pre-main sequence stars in Taurus-Auriga, our survey regions contain only one new optically visible, young star. We did find several candidate embedded protostars; additional 10 micrometer photometry is necessary to verify the pre-main sequence nature of these sources. Our results--combined with those of previous surveys--show that the L1537/L1538 clouds contain no pre-main sequence stars. These two clouds are less dense than the active star formation sites in Taurus-Auriga, which suggests a cloud must achieve a threshold density to form stars.

the occurrence of post partum anoestrus in bonsmara cows

African Journals Online (AJOL)

duration of post partum anoestrus than gain in body mass. Post pactum ... and Bos Taurus cattle to improve fertility and milk pro- duction in high .... The occurrence of post partum anoestrus in beef cows under ranching conditions. Proc.

UniProt search blastx result: AK289096 [KOME

Lifescience Database Archive (English)

Full Text Available AK289096 J090096D02 Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 precursor... (EC 3.4.23.-) (PAG 1) (Pregnancy-specific protein B) (PSP-B) - Bos taurus (Bovine) 9.00E-45 ...

Prevalence of infection and molecular confirmation by using ITS-2 region of Fasciola gigantica found in domestic cattle from Chiang Mai province, Thailand.

Science.gov (United States)

Phalee, Anawat; Wongsawad, Chalobol

2014-03-01

To investigate the infection of Fasciola gigantica (F. gigantica) in domestic cattle from Chiang Mai province and molecular confirmation using ITS-2 region. The liver and gall bladder of Bubalus bubalis (B. bubalis) and Bos taurus (B. taurus) from slaughterhouses were examined adult worms and prevalence investigation. The species confirmation with phylogenetic analysis using ITS-2 sequences was performed by maximum likelihood and UPGMA methods. The total prevalences of infection in B. bubalis and Bubalus taurus (B. taurus) were 67.27% and 52.94% respectively. The respective prevalence in both B. bubalis and B. taurus were acquired from Doi-Saket, Muang, and Sanpatong districts, with 81.25%, 62.50% and 60.00% for B. bubalis and 62.50%, 50.00% and 47.06% for Bos taurus respectively. The species confirmation of F. gigantica and some related species by basing on maximum likelihood and UPGMA methods used, 4 groups of trematodes were generated, first F. gigantica group including specimen of Chiang Mai, second 2 samples of F. hepatica, third group of 3 rumen flukes; Orthocoelium streptocoelium, F. elongatus and Paramphistomum epliclitum and fourth group of 3 minute intestinal flukes; Haplorchis taichui, Stellantchasmu falcatus, Haplorchoides sp. and liver fluke; Opisthorchis viverrini respectively. These results can be confirmed the Giant liver fluke which mainly caused fascioliasis in Chiang Mai was identified as F. gigantica and specimens were the same as those of F. gigantica recorded in other different countries. Nucleotide sequence of ITS-2 region has been proven as effective diagnostic tool for the identification of F. gigantica. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

Anti-oxidant and anti-hyperlipidemic activity of Hemidesmus indicus in rats fed with high-fat diet

Directory of Open Access Journals (Sweden)

Suganya Venkateshan

2016-08-01

Full Text Available Objective: Dietary changes playmajor risk roles in oxidative stress andcardiovascular disease and modulate normal metabolic function. The present study was designed to investigate the ameliorative potential of different extracts of Hemidesmus indicus to experimental high-fat diet in wistar rats, and their possible mechanism of action.  Materials and Methods: Male wistar rats were divided into 6 groups (n=6/group andfed with a standard diet (control, high-fat diet (HFD, high-fat diet supplemented with different extracts and positive control for 9 weeks. High-fat diet induced changes in average body weight andoxidative stress and elevated levels of plasma lipid profilein rats. Results: Oral administration of methanolic extract of H. indicus(200 mg/kg offered a significant dose-dependent protection against HFD-induced oxidative stress, as reflected in the levels of catalase (pConclusion: The present study revealed that the methanolic extract of H.indicus protects against oxidative stress, hyperlipidemia and liver damage.

The size of domestic cattle, sheep, goats and pigs in the Czech Neolithic and Eneolithic Periods: Temporal variations and their causes

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2016-01-01

Roč. 25, Junio (2016), s. 33-78 ISSN 1132-6891 Institutional support: RVO:67985912 Keywords : osteometry * body mass * domestication * cross-breeding * Chalcolithic * Bos taurus * Ovis aries * Capra hircus * Sus domesticus * aurochs * wild boar * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

Dicty_cDB: VHM242 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 74 3e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 74 4e-12 protein upda

Dicty_cDB: VHM737 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein upda

Optimization of xylanase production by Mucor indicus, Mucor hiemalis, and Rhizopus oryzae through solid state fermentation

Directory of Open Access Journals (Sweden)

Sanaz Behnam

2016-03-01

Full Text Available Introduction: Xylan is the main hemicellulosic polymer in a number of lignocelluloses which can be hydrolyzed by xylanolytic enzymes. One of the main ways for enzymes production is solid state fermentation (SSF. The ability of three fungal strains (Mucor indicus, Mucor hiemalis, and Rhizopus oryzae for xylanase production on wheat bran by SSF was investigated. Materials and methods: The effects of cultivation temperature, medium moisture content, and cultivation time on the enzyme production were investigated. Experiments were designed with an orthogonal central composite design on three variables using response surface methodology (RSM. Analysis of variance was applied and the enzyme production was expressed with a mathematical equation as a function of the three factors. The optimum operating conditions for the enzyme production was obtained. Results: For xylanase production by M. indicus, M. hiemalis and R. oryzae the optimum temperatures were 40.0, 43.4 and 43.4ºC respectively. These values were 49.8, 54.2 and 71.8% for moisture percent and 51.3, 53.2 and 53.5 h for cultivation time. The highest enzyme activities per g of dry substrate (gds were 43.1, 43.8 and 25.9 U/gds for M. indicus, M. hiemalis and R. oryzae respectively. Discussion and conclusion: All the fungi were able to produce xylanase. Maximum xylanase production was predicted by M. indicus and M. hiemalis at similar optimum conditions, while R. oryzae produced relatively lower xylanase activity even at the best condition. 

CO survey of the dark nebulae in Perseus, Taurus, and Auriga

International Nuclear Information System (INIS)

Ungerechts, H.; Thaddeus, P.

1987-01-01

A new SIS receiver with extremely low noise temperature, used on the Columbia 1.2-m telescope has permitted mapping CO rapidly with full sampling. Results are presented of a survey for which the angular resolution of the telescope was reduced to 0.5 deg, allowing the observations for the complete region of 750 square degrees to be finished within four months, while retaining sufficient resolution to see significant substructure. Most positions with emission are in the Taurus-Auriga dark nebulae, a cloud associated with IC 348 and NGC 1333, and a cloud associated with the California nebula (NGC 1499) and NGC 1579, which overlaps the northern Taurus-Auriga nebulae but is separated from them in velocity. Also seen were several small clouds at Galactic latitude -25 deg to -35 deg southwest of the Taurus clouds, and the L1558 and L1551 clouds in the south. 89 references

NEW YOUNG STAR CANDIDATES IN THE TAURUS-AURIGA REGION AS SELECTED FROM THE WIDE-FIELD INFRARED SURVEY EXPLORER

International Nuclear Information System (INIS)

Rebull, L. M.; Padgett, D. L.; Noriega-Crespo, A.

2011-01-01

The Taurus Molecular Cloud subtends a large solid angle on the sky, in excess of 250 deg 2 . The search for legitimate Taurus members to date has been limited by sky coverage as well as the challenge of distinguishing members from field interlopers. The Wide-field Infrared Survey Explorer has recently observed the entire sky, and we take advantage of the opportunity to search for young stellar object (YSO) candidate Taurus members from a ∼260 deg 2 region designed to encompass previously identified Taurus members. We use near- and mid-infrared colors to select objects with apparent infrared excesses and incorporate other catalogs of ancillary data to present a list of rediscovered Taurus YSOs with infrared excesses (taken to be due to circumstellar disks), a list of rejected YSO candidates (largely galaxies), and a list of 94 surviving candidate new YSO-like Taurus members. There is likely to be contamination lingering in this candidate list, and follow-up spectra are warranted.

Fibroblasts express OvHV-2 capsid protein in vasculitis lesions of American bison (Bison bison) with experimental sheep-associated malignant catarrhal fever

Science.gov (United States)

Sheep-associated malignant catarrhal fever (SA-MCF) caused by ovine herpesvirus-2 (OvHV-2), a '-herpesvirus, is an often fatal disease characterized by lymphoproliferation, vasculitis, and mucosal ulceration in American bison (Bison bison), cattle (Bos taurus), and other clinically susceptible speci...

NCBI nr-aa BLAST: CBRC-RNOR-05-0198 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0198 ref|XP_596853.2| PREDICTED: similar to T-cell acute lymphocytic leukemia...-1 protein (TAL-1 protein) (Stem cell protein) (T-cell leukemia/lymphoma-5 protein) [Bos taurus] XP_596853.2 1e-168 89% ...

Dicty_cDB: VHO851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available d:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...14006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 prote

Dicty_cDB: VHM169 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available one) Homo sapiens full open reading fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic...06_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein

Dicty_cDB: VHI393 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

Dicty_cDB: VHO630 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

Dicty_cDB: VHA439 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 CR457155_1( CR457155 |...pid:none) Homo sapiens full open reading fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHC785 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 75 1e-1...one) Homo sapiens full open reading fra... 75 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic

Dicty_cDB: VHD838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid.....06 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein update 2009. 6.29 PSORT psg: 0.67 gvh:

Dicty_cDB: VHF111 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

Dicty_cDB: VHL517 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available d:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...14006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 prote

USO DE ANTI-HELMÍNTICOS E BIOESTIMULANTES NO DESEMPENHO DE BOVINOS DE CORTE SUPLEMENTADOS A PASTO NO ESTADO DO PARÁ EFFECTS OF VERMIFUGES AND BIOSTIMULANTS ON BEEF CATTLE PERFORMANCE UNDER PASTURE SUPPLEMENTATION IN PARÁ STATE

Directory of Open Access Journals (Sweden)

Sâmia Rubielle Silva de Castro

2009-07-01

Full Text Available O experimento avaliou o efeito da vermifugação e da utilização de bioestimulantes no ganho de peso e no escore de condição corporal (ECC de bovinos de corte, criados em sistema de pastejo rotacionado com suplementação a pasto, no Estado do Pará, durante 160 dias. Foram utilizados 132 bovinos machos não castrados, com idade média de 24 meses, da raça Nelore (Bos taurus indicus. Os grupos experimentais compreenderam o grupo G1 (controle; n=33, G2 (moxidectina 1%; n=33, G3 (moxidectina 10%; n=33 e G4 (ivermectina 3,15%; n=33. Em todos os grupos foram estabelecidas três subparcelas, a fim de serem testados dois bioestimulantes de crescimento animal (bioestimulante 1 e bioestimulante 2. Não houve diferença estatística significativa no ganho de peso médio, no ECC e nas contagens de OPG entre animais do G1, G2, G3 e G4, independentemente dos anti-helmínticos e/ou bioestimulantes usados. Contudo, o tratamento baseado na associação de moxidectina 1% e o bioestimulante 2 apresentou maior receita líquida e incrementou a lucratividade da terminação em 1,24%. Os resultados sugerem que não há necessidade de um controle contra nematódeos durante a terminação, desde que os animais apresentem uma baixa carga parasitária, porém o uso de fármacos pode, sob certas condições, apresentar resultado econômico favorável.

PALAVRAS-CHAVES: Anti-helmíntico, bovinocultura, crescimento, rentabilidade, sistema de produção.
The experiment evaluated the effect of vermifuges and biostimulants on weight gain and body condition score (BCS of beef cattle, created in pasture supplementation system, in the State of Pará, during 160 days. Experimental animal were 132 Nelore (Bos taurus indicus, non-castrated male, with average age of 24 months. Experimental groups were: G1 group (control; n=33, G2 (1% moxidectin; n=33, G3 (10% moxidectin; n=33 and G4 (3.15% ivermectin; n=33. Each group was divided in three plots, in order to test

Feeding efficiency of Penaeus indicus and Metapenaeus dobsoni in different experimental substrata

Digital Repository Service at National Institute of Oceanography (India)

Devi, C.B.L.; Balasubramanian, T.; Iyer, H.K.; Kutty, M.K.

Preying efficiency in the substrata of different concentrations of mud sand, silt and clay and also in mud from natural habitat was examined with respect to Penaeus indicus and Metapenaeus dobsoni in order to understand the factors in their natural...

A novel polymorphism of resistin gene and its association with meat ...

African Journals Online (AJOL)

Searching for candidate gene polymorphisms and their relationship with meat quality traits is an important issue for Bos taurus industry. In this study, we evaluated polymorphism of resistin (RETN) gene involved in energy metabolism. Using the polymerase chain reaction-single strand conformation polymorphism ...

Congenital bovine spinal dysmyelination is caused by a missense mutation in the SPAST gene

DEFF Research Database (Denmark)

Thomsen, Bo; Nissen, Peter H.; Agerholm, Jørgen S

2010-01-01

 Bovine spinal dysmyelination (BSD) is a recessive congenital neurodegenerative disease in cattle (Bos taurus) characterized by pathological changes of the myelin sheaths in the spinal cord. The occurrence of BSD is a longstanding problem in the American Brown Swiss (ABS) breed and in several...

Antibiogram profile of pathogens isolated from processed cow meat ...

African Journals Online (AJOL)

... the antibiotic resistance tests revealed varied, but interesting susceptibility patterns. Our findings does highlight the fact that there exist obvious vehicles for pathogenic bacteria proliferation within our abattoirs, and hence, the need for caution. Key words: Abattoirs, Bos taurus, Pathogenic bacteria, Antibiotics, Resistance ...

50 CFR 14.4 - What terms do I have to understand?

Science.gov (United States)

2010-10-01

... under contract to and accredited by an accredited scientific institution for the purpose of conducting... an exhibit for the purpose of soliciting sales, without regard to quantity or weight. There is a... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus cuniculus...

UniProt search blastx result: AK287891 [KOME

Lifescience Database Archive (English)

Full Text Available AK287891 J065209I11 P47865|AQP1_BOVIN Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water c...hannel protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) - Bos taurus (Bovine) 1.00E-19 ...

Facilitative and competitive interactions between sympatric cattle, red deer and wild boar in Dutch woodland pastures

NARCIS (Netherlands)

Kuiters, A.T.; Groot Bruinderink, G.W.T.A.; Lammertsma, D.R.

2005-01-01

Use of cattle-grazed and ungrazed woodland pastures by red deer Cervus elaphus Linnaeus, 1758 and wild boar Sus scrofa Linnaeus, 1758 was investigated monthly by measuring dung-deposition rates. Cattle Bos taurus grazed pastures year-round, with peak intensities during the growing season

NUTGRANJA 2.0

NARCIS (Netherlands)

Prado, del A.; Corré, W.J.; Gallejones, P.; Pardo, G.; Pinto, M.; Hierro, del O.; Oenema, O.

2016-01-01

Farm nutrient management has been identified as one of the most important factors determining the economic and environmental performance of dairy cattle (Bos taurus) farming systems. Given the environmental problems associated with dairy farms, such as emissions of greenhouse gases (GHG), and the

Dicty_cDB: VHK777 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 75 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas.....ll open reading fra... 75 4e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 75 4e-

Dicty_cDB: SFL375 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 15 |pid:none) Rhodococcus opacus B4 DNA, comp... 88 4e-16 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecoli... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 87 1e-15 BC116493_1( B

Dicty_cDB: VHP706 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...3 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13

Dicty_cDB: VHF631 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid

Dicty_cDB: VHJ864 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 pro

Dicty_cDB: VHC661 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX882278_1( ...AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Genome sequence of the thermophilic sulfate-reducing ocean bacterium Thermodesulfatator indicus type strain (CIR29812T)

Energy Technology Data Exchange (ETDEWEB)

Anderson, Iain [U.S. Department of Energy, Joint Genome Institute; Saunders, Elizabeth H [Los Alamos National Laboratory (LANL); Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Han, Cliff [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Hauser, Loren John [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Chang, Yun-Juan [ORNL; Brambilla, Evelyne-Marie [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany

2012-01-01

Thermodesulfatator indicus Moussard et al. 2004 is a member of the genomically so far poorly characterized family Thermodesulfobacteriaceae in the phylum Thermodesulfobacteria. Members of this phylum are of interest because they represent a distinct, deep-branching, Gram-negative lineage. T. indicus is an anaerobic, thermophilic, chemolithoautotrophic sulfate reducer isolated from a deep-sea hydrothermal vent. Here we describe the features of this organism, together with the complete genome sequence, and annotation. The 2,322,224 bp long chromosome with its 2,233 protein-coding and 58 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Studies on the growth and reproduction of cattle in the tropics

International Nuclear Information System (INIS)

Frisch, J.E.

1990-01-01

The results of a number of studies that had the long term aim of increasing the productivity of cattle in the tropics are reported. The studies were conducted on the B (Brahman), HS (interbred Hereford x Shorthorn), F 1 BX (first cross B x HS) and F n BX (interbred B x HS) lines. These breeds were used to demonstrate the origins of the heterosis that occurs in both the realized growth and the reproductive rate of Bos indicus x Bos taurus. Genetic and environmental factors that limit the realized reproductive rates were also investigated. The reproductive rate of cows of each breed that differed in lactation status during the breeding season was compared in contrasting environments. It was shown that the main limitation to HS achieving high realized reproductive rates was of environmental origin. For B cows, the main limitation was associated with the stress of lactation. Unsuccessful attempts were made to overcome this limitation by using progesterone releasing intravaginal devices alone or in combination with temporary calf weaning to try to induce a fertile oestrus. Improvement of the realized reproductive rates in the HS line was achieved by increasing their resistance to environmental stresses. The prospects for increasing the realized reproductive rate of maiden heifers by increasing their live weight at the start of their first breeding season were also investigated. About half of the heifers of each breed were implanted with the synthetic growth promotant Synovex 'H' on three occasions before the start of the breeding season. Although the live weight of all breeds increased in response to Synovex 'H', the magnitude of the response was dependent on the presence or absence of parasite control. Previously implanted heifers had a lower pregnancy rate than non-implanted heifers. 4 refs, 6 tabs

RELAÇÃO ENTRE COMPONENTES DO CORPO VAZIO E RENDIMENTOS DE CARCAÇA DE NOVILHOS DE CORTE

Directory of Open Access Journals (Sweden)

Miguelangelo Ziegler Arboitte

2006-10-01

Full Text Available O objetivo deste experimento foi avaliar a relação entre os vários componentes das partes do corpo não-integrantes da carcaça com os rendimentos de carcaça quente (RCQ e fria (RCF expressos em relação ao peso de abate (PAB ou de corpo vazio (PCV de novilhos de corte. Foram utilizados 24 animais mestiços Charolês – Nelore,terminados em confinamento. Nenhum componente do corpo vazio, bem como os conjuntos dos componentes apresentaram relação significativa com os RCQ e RCF quando ajustados para PAB. Quando avaliados em relação ao PCV, o RCQ correlacionou-se positivamente com coração (r=0,41 e negativamente com as gorduras internas: inguinal (r=-0,62, renal (r=-0,48, toalete (r=-0,51 e ruminal+intestinal (r=-0,57. E o RCF apresentou relação positiva com cabeça (r=0,42, coração (r=0,45 e omaso (r=0,49, e negativa com couro (r=-0,45, abomaso (r=-0,52 e gorduras internas:inguinal (r=-0,46, renal (r=-0,43, toalete (r=-0,68 e ruminal+intestinal (r=-0,72. Para os conjuntos dos componentes, apenas as gorduras internas correlacionaram-se significativamente com os RCQ (r=-0,68 e RCF (r=-0,76 expressos em relação ao PCV. Correlação significativa foi verificada entre os conjuntos gorduras internas com componentes externos (r=0,50 e entre os conjuntos trato digestivo vazio com órgãos vitais (r=0,74. PALAVRAS-CHAVE: Bos indicus, Bos taurus, couro, cruzamento, gordura interna.

Suplementación y metabolismo de hierro en neonatos bovinos en condiciones de trópico

Directory of Open Access Journals (Sweden)

Paola Andrea Páez

2013-01-01

Full Text Available Se estudió el efecto del suministro de hierro en la dinámica hemática y su metabolismo en terneros; para el efecto se seleccionaron 72 neonatos bovinos pertenecientes a tres grupos raciales: dos de origen Bos taurus (Hartón de Valle y Holstein Friesian y uno de origen Bos indicus (Cebú Brahmán para un total de 24 animales por raza y ocho animales por grupo experimental. Los animales del grupo 1 recibieron 500 mg de hierro dextran intramuscular (T1, al grupo 2 se le suministraron 100 mg de espirulina oral (T2 y el grupo 3 permaneció como control (T3. El suministro de hierro se hizo cada mes desde el nacimiento hasta los 6 meses de edad de los terneros, mensualmente se tomaron muestras de sangre mediante venipunción yugular y sistema vacutainer en tubos con y sin anticoagulante (EDTA. El promedio de ganancia de peso vivo animal fue 509 ± 0.40 g/día. El número de leucocitos/mm³ fue de 16,059. El promedio de hemoglobina en sangre fue de 12.11 ± 2.8 g/dl, el hematocrito presentó un valor de 38.4% ± 7.6 y la concentración promedio de hemoglobina corpuscular fue de 31.62% ± 4.7. La proteína sérica presentó un valor promedio de 5.55 ± 0.7 g/dl, el valor promedio de hierro sérico fue de 18.70± 11.8 µmol/lt. Los análisis estadísticos mostraron que el factor mes de muestreo y raza fueron significativos para los valores séricos de los metabolitos analizados, mientras que los valores de la concentración promedio de hemoglobina corpuscular lo fueron para tratamiento (P < 0.01.

ÓPTIMO TÉCNICO Y ECONÓMICO EN BOVINOS PRODUCTORES DE CARNE ENGORDADOS EN CORRAL

Directory of Open Access Journals (Sweden)

S. Rebollar-Rebollar

2011-01-01

Full Text Available The feedlot cattle producers in the south zone of the State of Mexico, generally does not an correct planning of sale to the market of yours finished hooky. Likewise, they lack a technical and administrative managing in his productive units, focused with the efficient use of inputs, which has prevented that they maximize her monetary earnings. The present research was realized to estimate the levels technical (TOL and economic optimal (EOL in feedlot cattle, using two cubic functions of production with diminishing marginal returns. There was in use 100 hooky Bos taurus x Bos indicus. Alive weight-LW to beginning of the fattens of 290 ± 15 kg, age 21 to 24 months fattened in feedlot during 93 days consuming a diet totally mixed (Protein: 133.33, FDN: 237.44, FDA 114.33 g/kg MS and 2.62 MS's Mcal/kg of metabolisable energy. To estimate the both functions (TOL and EOL, the profit of weight was considered to be a dependent variable. For the first production function the food consumption was taken as an independent variable and in the second the time defined in days. For the first production function the TOL was of 475.04 and the EOL was of 473.94 kg of LW; with a food consumption of 12.58 and 12.36 kg/day. For the second production function the TOL it was 475.01 and the EOL of 460.21 kg of LW, with a period of 93.29 and 77.21 days. The ideal point of sale and the maximum profit is obtained by the second production function, when the animals they come an LW of 460.21 kg during a food period of 77.21 days

Genetic susceptibility to infectious disease in East African Shorthorn Zebu: a genome-wide analysis of the effect of heterozygosity and exotic introgression.

Science.gov (United States)

Murray, Gemma G R; Woolhouse, Mark E J; Tapio, Miika; Mbole-Kariuki, Mary N; Sonstegard, Tad S; Thumbi, Samuel M; Jennings, Amy E; van Wyk, Ilana Conradie; Chase-Topping, Margo; Kiara, Henry; Toye, Phil; Coetzer, Koos; deC Bronsvoort, Barend M; Hanotte, Olivier

2013-11-09

Positive multi-locus heterozygosity-fitness correlations have been observed in a number of natural populations. They have been explained by the correlation between heterozygosity and inbreeding, and the negative effect of inbreeding on fitness (inbreeding depression). Exotic introgression in a locally adapted population has also been found to reduce fitness (outbreeding depression) through the breaking-up of co-adapted genes, or the introduction of non-locally adapted gene variants. In this study we examined the inter-relationships between genome-wide heterozygosity, introgression, and death or illness as a result of infectious disease in a sample of calves from an indigenous population of East African Shorthorn Zebu (crossbred Bos taurus x Bos indicus) in western Kenya. These calves were observed from birth to one year of age as part of the Infectious Disease in East African Livestock (IDEAL) project. Some of the calves were found to be genetic hybrids, resulting from the recent introgression of European cattle breed(s) into the indigenous population. European cattle are known to be less well adapted to the infectious diseases present in East Africa. If death and illness as a result of infectious disease have a genetic basis within the population, we would expect both a negative association of these outcomes with introgression and a positive association with heterozygosity. In this indigenous livestock population we observed negative associations between heterozygosity and both death and illness as a result of infectious disease and a positive association between European taurine introgression and episodes of clinical illness. We observe the effects of both inbreeding and outbreeding depression in the East African Shorthorn Zebu, and therefore find evidence of a genetic component to vulnerability to infectious disease. These results indicate that the significant burden of infectious disease in this population could, in principle, be reduced by altered breeding

Identification of polymorphism in the SCL24A5 gene of cattle

Directory of Open Access Journals (Sweden)

Paola Crepaldi

2010-01-01

Full Text Available The SLC24A5 (Solute Carrier family 24, member 5 gene is implicated in skin pigmentation in zebrafish and humans as it regulates the morphogenesis of melanosomes, specialized lysosomes involved in melanin deposit. In humans, the ancestral allele predominates in African and East Asian populations, while the allelic variant is nearly fixed in European populations and correlates with lighter pigmentation. Considering the role of melanin in the protecting of DNA from ultraviolet radiation, the lack of information in cattle and the importance of polymorphisms associated with pigmentation phenotypes, we investigated the SLC24A5 gene in cattle with light and dark skin pigmentation. To identify SNPs (Single Nucleotide Polymorphisms in this gene and their association to dark skin pigmentation in cattle, each of the nine SLC24A5 exons, three introns (1, 3 and 8 and a portion of intron 5, were sequenced in a set of sixteen animals belonging to four Italian cattle breeds, two African zebu breeds and two African sanga breeds. The region spanning exons 3 and 4 was sequenced in fifteen animals belonging to seven additional breeds. A total of sixteen SNPs were identified: eleven positioned in introns (six in intron 1, one in intron 5 and four in intron 8 and five in exons (one in exon 1, two in exon 6 and two in exon 7. Three SNPs (located in exons 1, 6 and 7 were non synonymous, determining Pro19Leu, Ala238Val, and Met341Ile amino acid changes, respectively. All the SNPs identified were polymorphic between Bos taurus, Bos indicus and Sanga, while none of them resulted associated with the studied phenotype and discriminated the three breeds (Chianina, Mucubal and Goudali characterized by dark pigmented skin from the others.

Growth and maturation of Penaeus indicus under blue and green light

African Journals Online (AJOL)

growth of the penaeid prawn Penaeus indicus was tested by comparing dim green ... light quantity and quality. tank size and/or handling stress. It was decided to ... Three circular, temperature-controlled 8000 e (2,8 m diameter) glass ... of eggs and nauplii in the water. Occasional ..... Penaeus vannamei Boone. J. expo mar.

CO survey of the dark nebulae in Taurus and Perseus

International Nuclear Information System (INIS)

Baran, G.P.

1986-01-01

The thesis reports a large-scale survey of carbon monoxide ( 12 CO) emission (at λ = 2.6 mm) from dark nebulae in Taurus and Perseus. CO spectra at 4395 points were obtained within an area of about 800 square degrees generally west of the galactic anti-center. The spatial resolution of the instrument was eight arcminutes and velocity resolution was 2.6 km s -1 /. CO emission is strongest wherever extinction by dust is greatest, spilling over the apparent outer boundaries of the dust clouds observed optically. Combining CO velocity for the nebulae with optically determined distances shows that the clouds in the survey area form several layers. The molecular cloud mass closest to the sun is the Taurus and Auriga complex about 150 +/- 50 pc). Nearer to the Per )B2 OB association (at 350 +/- 100 pc) than the Taurus clouds are the Per OB2 molecular cloud (350 +/- 100 pc) and the California Nebula = NGC15979 molecular clouds (at 400 +/- 150 pc). Cloud masses were determined from integrated CO emission intensity alone by assuming that γ-ray emission intensities can be used to relate H 2 column densities to CO emission intensities

Biochemical changes of Litopenaeus vannamei and Fenneropenaeus indicus in the different stages of WSSV infection

Directory of Open Access Journals (Sweden)

Ramachandran Shalini

2013-01-01

Full Text Available Objective: To find out the difference in the proximate composition and fatty acid profile of both the species of shrimp Litopenaeus vannamei (L. vannamei and Fenneropenaeus indicus (F. indicus infected with different stages of white spot syndrome virus (WSSV. Methods: Standard methods were followed by estimating the proximate composition and fatty acid analysis. Each fish specimens were beheaded, eviscerated and filleted manually. The tissue samples were oven dried at 67 °C for 24 h. Then the samples were grounded finely with pestle and mortar. The saponified samples were cooled at room temperature for 25 min. They were acidified and methylated by adding 2 mL 54% 6 mol/L HCL in 46% aqueous methanol and incubated at 80 °C for 10 min in water bath. Following the base wash step, the fatty acid methyl esters were cleaned in anhydrous sodium sulphate and then transferred into gas chromatograph sample vial for analysis. Fatty acid methyl esters were separated by gas chromatograph. Results: The proximate composition was higher in the both control tissue than the three (low, moderate, severe infected ones. For L. vannamei and F. indicus, the carbohydrates are 5.07% and 6.18%, and the proteins are 25.01% and 22.17%, respectively. Lipid level recorded was little higher in the shrimps maintained and showed severe sign of WSSV infection than the control and the fatty acid profile result revealed that saturated fatty acids and monounsaturated fatty acid was in higher [48.72% (Severe & 16.87% (low] L. vannamei. In the polyunsaturated fatty acid, F. indicus was 40.47% (low. Conclusions: Our study showed that the healthy shrimps are nutritionally rich than the WSSV affected shrimps.

Biochemical changes of Litopenaeus vannamei and Fenneropenaeus indicus in the different stages of WSSV infection

Directory of Open Access Journals (Sweden)

Ramachandran Shalini

2013-08-01

Full Text Available Objective: To find out the difference in the proximate composition and fatty acid profile of both the species of shrimp Litopenaeus vannamei (L. vannamei and Fenneropenaeus indicus (F. indicus infected with different stages of white spot syndrome virus (WSSV. Methods: Standard methods were followed by estimating the proximate composition and fatty acid analysis. Each fish specimens were beheaded, eviscerated and filleted manually. The tissue samples were oven dried at 67 °C for 24 h. Then the samples were grounded finely with pestle and mortar. The saponified samples were cooled at room temperature for 25 min. They were acidified and methylated by adding 2 mL 54% 6 mol/L HCL in 46% aqueous methanol and incubated at 80 °C for 10 min in water bath. Following the base wash step, the fatty acid methyl esters were cleaned in anhydrous sodium sulphate and then transferred into gas chromatograph sample vial for analysis. Fatty acid methyl esters were separated by gas chromatograph. Results: The proximate composition was higher in the both control tissue than the three (low, moderate, severe infected ones. For L. vannamei and F. indicus, the carbohydrates are 5.07% and 6.18%, and the proteins are 25.01% and 22.17%, respectively. Lipid level recorded was little higher in the shrimps maintained and showed severe sign of WSSV infection than the control and the fatty acid profile result revealed that saturated fatty acids and monounsaturated fatty acid was in higher [48.72% (Severe & 16.87% (low] L. vannamei. In the polyunsaturated fatty acid, F. indicus was 40.47% (low. Conclusions: Our study showed that the healthy shrimps are nutritionally rich than the WSSV affected shrimps.

Resorptive tooth root lesions in the Malayan tapir (Tapirus indicus).

Science.gov (United States)

Da Silva, Mari-Ann O; Kortegaard, Hanne E; Choong, Siew Shean; Arnbjerg, Jens; Bertelsen, Mads F

2011-03-01

Facial abscessation and osteomyelitis due to dental disease is commonly seen in the Malayan tapir (Tapirus indicus), but little is known about the prevalence or etiology of these lesions. To determine the prevalence of dental ailments, 56 skulls and mandibles of deceased Malayan tapirs were visually and radiographically evaluated. Dental lesions were scored according to severity, and individuals were classified according to their age (juvenile/ young adult/adult) and origin (captive/free ranging). All of the lesions identified were of a resorptive nature. seemingly originating at the cementoenamel junction and burrowing towards the center of the tooth. Overall, 27% of the investigated skulls presented radiolucent dental lesions. The prevalence among captive animals was 52% (13/25), while only 6% (2/31) of the free-ranging tapirs had dental lesions. The second, third, and fourth premolars and first molar were the teeth most commonly affected, and the mandibular teeth were more often involved than the maxillary dentition. This study demonstrates a high prevalence of resorptive dental lesions in captive Malayan tapirs and provides a strong indication that age and captivity are significant risk factors in the development of these lesions. Dental disease, Malayan tapir, radiology, resorptive lesions, Tapirus indicus.

In situ rumen degradability characteristics of rice straw, soybean ...

African Journals Online (AJOL)

In situ rumen degradability characteristics of rice straw, soybean curd residue and peppermint (Mentha piperita) in Hanwoo steer (Bos Taurus coreanae). Byong Tae Jeon, KyoungHoon Kim, Sung Jin Kim, Na Yeon Kim, Jae Hyun Park, Dong Hyun Kim, Mi Rae Oh, Sang Ho Moon ...

Characterization and sequence analysis of cysteine and glycine-rich ...

African Journals Online (AJOL)

Primers specific for CSRP3 were designed using known cDNA sequences of Bos taurus published in database with different accession numbers. Polymerase chain reaction (PCR) was performed and products were purified and sequenced. Sequence analysis and alignment were carried out using CLUSTAL W (1.83).

Reproductive Performance And Superovulatory Response Of ...

African Journals Online (AJOL)

This study was undertaken to determine the reproductive performance of the endangered Bos-taurus Namshi breed of Cameroon. Ovarian response to superovulatory treatment was also evaluated. The following observations were recorded. The average calf mortality rate was 25.71% while the average birth weight was ...

Breed x sex effects on birth weight in Brahman-Simmental embryo transfer calves

Science.gov (United States)

Brahman cross calves exhibit unusual inheritance of birth weight: Brahman-sired crossbreds out of Bos taurus females are heavier with greater difference between sexes than calves of the reciprocal cross. The objective of this work was to compare birth weight in various crosses of Brahman, Simmenta...

Dicty_cDB: VHI816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available omal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... ...pid:none) Homo sapiens full open reading fra... 75 5e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHO717 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-12 AX882278_1( AX882278 |pid:none) Sequenc...e 17183 from Patent EP10746... 76 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

New insights on multiplicity and clustering in Taurus.

Science.gov (United States)

Joncour, Isabelle; Duchene, Gaspard; Moraux, Estelle; Mundy, Lee

2018-01-01

Multiplicity and clustering of young stars are critical clues to constraint star formation process. The Taurus molecular complex is the archetype of a quiescent star forming region that may retain primeval signature of star formation.Using statistical and clustering tools such as nearest neighbor statistics, correlation functions and the density-Based Spatial Clustering of Applications with Noise (DBSCAN) algorithm, this work reveals new spatial substructures in Taurus.We have identified unexpected ultra wide pairs (UWPs) candidates of high order multiplicity in Taurus in the 5-60 kAU separation range (Joncour et al 2017), beyond the separation assessed for wide pairs (Kraus & Hillenbrand 2009).Our work reveals 20 local stellar substructures, the Nested Elementary Structures (NESTs). These NESTs contain nearly half the stars of Taurus and 75% of the Class 0/I objects probing that they are the preferred sites of star formation (Joncour et al, sub.). The NESTs size ranges from few kAU up to 80 kAU making a length scale bridge between wide pairs and loose group (few hundreds kAU, Kirk & Myers, 2011). The NESTs mass ranges from 0.5-10 solar mass. The balance between Class I, II and III in NESTs suggests that they may be ordered as an evolutionary temporal scheme, some of them got infertile, while other shelter stars in infancy.The UWPs and the NESTs may be pristine imprints of their spatial configuration at birth. The UWPs population may result from a cascade fragmentation scenario of the natal molecular core. They could be the older counterparts, to the 0.5 Myr prestellar cores/Class 0 multiple objects observed at radio/millimeter wavelengths (Tobin et al 2010, 2016) and the precursors of the large number of UWPs (10–100 kAU) recently identified in older moving groups (Floriano-Alonso et al, 2015 ; Elliot et al 2016). The NESTs may result from the gravitational collapse of a gas clump that fragments to give a tight collection of stars within few millions years

Effects of Plant Growth Hormones on Mucor indicus Growth and Chitosan and Ethanol Production.

Science.gov (United States)

Safaei, Zahra; Karimi, Keikhosro; Golkar, Poorandokht; Zamani, Akram

2015-07-22

The objective of this study was to investigate the effects of indole-3-acetic acid (IAA) and kinetin (KIN) on Mucor indicus growth, cell wall composition, and ethanol production. A semi-synthetic medium, supplemented with 0-5 mg/L hormones, was used for the cultivations (at 32 °C for 48 h). By addition of 1 mg/L of each hormone, the biomass and ethanol yields were increased and decreased, respectively. At higher levels, however, an inverse trend was observed. The glucosamine fraction of the cell wall, as a representative for chitosan, followed similar but sharper changes, compared to the biomass. The highest level was 221% higher than that obtained without hormones. The sum of glucosamine and N-acetyl glucosamine (chitin and chitosan) was noticeably enhanced in the presence of the hormones. Increase of chitosan was accompanied by a decrease in the phosphate content, with the lowest phosphate (0.01 g/g cell wall) being obtained when the chitosan was at the maximum (0.45 g/g cell wall). In conclusion, IAA and KIN significantly enhanced the M. indicus growth and chitosan production, while at the same time decreasing the ethanol yield to some extent. This study shows that plant growth hormones have a high potential for the improvement of fungal chitosan production by M. indicus.

Characterization of PRLR and PPARGC1A genes in buffalo (Bubalus bubalis

Directory of Open Access Journals (Sweden)

Ruheena Javed

2011-01-01

Full Text Available More than 40 million households in India depend at least partially on livestock production. Buffaloes are one of the major milk producers in India. The prolactin receptor (PRLR gene and peroxisome proliferators activated receptor-γ coactivator 1-alpha (PPARGC1A gene are reportedly associated with milk protein and milk fat yields in Bos taurus. In this study, we sequenced the PRLR and PPARGC1A genes in the water buffalo Bubalus bubalis. The PRLR and PPARGC1A genes coded for 581 and 819 amino acids, respectively. The B. bubalis PRLR gene differed from the corresponding Bos taurus at 21 positions and four differences with an additional arginine at position 620 in the PPARGC1A gene were found in the amino acid sequence. All of the changes were confirmed by cDNA sequencing. Twelve buffalo-specific single nucleotide polymorphisms (SNPs were identified in both genes, with five of them being non-synonymous.

Uros, genética, indígenas y colonos. A propósito de la Neolitización de Europa

OpenAIRE

Alday, Alfonso .; Carretero, José Miguel; Anderung, Cecilia .; Götherström, Anders .

2012-01-01

Las analíticas genéticas realizadas sobre los uros (Bos primigenius) del yacimiento de Mendandia (Treviño), han ofrecido un resultado sorprendente: uno de los individuos pertenece al haplotypo T3, generalmente asociado a animales domésticos (Bos taurus). La datación de la muestra (7265 ± 70 BP; Ua 34366) es acorde con las otras conocidas de su nivel, el III-superior, incidiendo en la antigüedad de su Neolítico. El dato es la excusa para reflexionar sobre el proceso neolitizador y adentrarnos ...

Circumstellar disks around binary stars in Taurus

International Nuclear Information System (INIS)

Akeson, R. L.; Jensen, E. L. N.

2014-01-01

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10 –4 M ☉ . We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F mm ∝M ∗ 1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Encephalomyocarditis virus in a captive Malayan tapir (Tapirus indicus).

Science.gov (United States)

Vercammen, Francis; Bosseler, Leslie; Tignon, Marylène; Cay, Ann Brigitte

2017-01-01

A 5-month-old female captive Malayan tapir ( Tapirus indicus ) died suddenly without preceding symptoms. Gross necropsy revealed numerous white circular and linear foci in the myocard. Differential diagnosis all turned out negative, except for encephalomyocarditis virus. Histopathology revealed mineralisation of myocardial cells and interstitial infiltration of lymphocytes, plasma cells and less neutrophils. Encephalomyocarditis virus was detected by PCR. Although encephalomyocarditis virus occurs in many mammals, this is the first published description of this virus in a Malayan tapir.

AcEST: BP912479 [AcEST

Lifescience Database Archive (English)

Full Text Available |P81282|CSPG2_BOVIN Versican core protein OS=Bos taurus GN=VCA... 35 0.22 sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS...PSVNQRCLGG 325 + + + E+ KVPSV + G Sbjct: 2452 STTFVSD---RSLEKHPKVPSVEAVTVNG 2477 >sp|Q9Y2K

Morphological assessment of Niger Kuri cattle using multivariate ...

African Journals Online (AJOL)

This work confirms that at type trait level Kuri cattle is a unique population within the West African taurine cattle group. The implementation of genetic analyses aiming at ascertaining the degree of uniqueness of the breed is advised. Keywords: Body measurements, Bos taurus, multivariate analyses, qualitative traits, West ...

Livestock and elk grazing effects on stream morphology, brown trout population dynamics, movement, and growth rate, Valles Caldera National Preserve, New Mexico

Science.gov (United States)

Michael C. Anderson

2009-01-01

Ungulate grazing in riparian areas has been shown to detrimentally impact stream morphology and fish populations. Goals of this research were to assess changes in stream morphology and responses of a brown trout (Salmo trutta) population to exclusion of cattle (Bos taurus) and elk (Cervus elaphus) from riparian...

Chopped or long roughage: what do calves prefer? Using cross point analysis of double demand functions

NARCIS (Netherlands)

Webb, L.E.; Bak Jensen, M.; Engel, B.; Reenen, van C.G.; Gerrits, W.J.J.; Boer, de I.J.M.; Bokkers, E.A.M.

2014-01-01

The present study aimed to quantify calves'(Bos taurus) preference for long versus chopped hay and straw, and hay versus straw, using cross point analysis of double demand functions, in a context where energy intake was not a limiting factor. Nine calves, fed milk replacer and concentrate, were

Dicty_cDB: VHJ505 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available arcosine oxidase; S... 73 5e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 73 5e-...none) Homo sapiens full open reading fra... 72 9e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: AHA771 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 9e-13 AX882278_1( AX882278 |pid...:none) Sequence 17183 from Patent EP10746... 76 9e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

Dicty_cDB: VHN454 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 93_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 72 2e-11 AX882278_1( AX882278 |pid:none) Seq...uence 17183 from Patent EP10746... 72 2e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHD308 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eroxisomal sarcosine oxidase; S... 75 9e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxid...7155 |pid:none) Homo sapiens full open reading fra... 75 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHK674 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 77 2e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...0746... 77 2e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 77 3e-13 CP001291_518

Dicty_cDB: VHQ355 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ens full open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... ... 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 7

Dicty_cDB: VHA709 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 A...X882278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 6e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Peripheral blood mononuclear cells: a potential cellular system to understand differential heat shock response across native cattle (Bos indicus), exotic cattle (Bos taurus), and riverine buffaloes (Bubalus bubalis) of India.

Science.gov (United States)

Kishore, Amit; Sodhi, Monika; Kumari, Parvesh; Mohanty, A K; Sadana, D K; Kapila, Neha; Khate, K; Shandilya, Umesh; Kataria, R S; Mukesh, M

2014-09-01

Circulating leukocytes can be used as an effective model to understand the heat stress response of different cattle types and buffaloes. This investigation aimed to determine the temporal profile of HSPs (HSP40, HSP60, HSP70, and HSP90) expression in circulating peripheral blood mononuclear cells (PBMCs) of Murrah buffaloes, Holstein-Friesian (HF), and Sahiwal cows in response to sublethal heat shock at 42 °C. The viability data indicated HF PBMCs to be the most affected to the heat shock, whereas Sahiwal PBMCs were least affected, indicating its better survivability during the heat stress condition. The qRT-PCR expression data showed significant increase in mRNA expression of the analyzed HSPs genes after heat stimuli to the PBMCs under in vitro condition. In each case, the HSPs were most upregulated at 2 h after the heat stress. Among the HSPs, HSP70 was relatively more expressed followed by HSP60 indicating the action of molecular chaperones to stabilize the native conformation of proteins. However, PBMCs from different cattle types and buffaloes showed difference in the extent of transcriptional response. The level of expression of HSPs throughout the time period of heat stress was highest in buffaloes, followed by HF and Sahiwal cows. The higher abundance of HSP70 mRNA at each time point after heat stress showed prolonged effect of heat stress in HF PBMCs. The data presented here provided initial evidence of transcriptional differences in PBMCs of different cattle types and buffaloes and warrant further research.

Encephalomyocarditis virus in a captive Malayan tapir (Tapirus indicus

Directory of Open Access Journals (Sweden)

Francis Vercammen

2017-04-01

Full Text Available A 5-month-old female captive Malayan tapir (Tapirus indicus died suddenly without preceding symptoms. Gross necropsy revealed numerous white circular and linear foci in the myocard. Differential diagnosis all turned out negative, except for encephalomyocarditis virus. Histopathology revealed mineralisation of myocardial cells and interstitial infiltration of lymphocytes, plasma cells and less neutrophils. Encephalomyocarditis virus was detected by PCR. Although encephalomyocarditis virus occurs in many mammals, this is the first published description of this virus in a Malayan tapir.

AN INFRARED/X-RAY SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Luhman, K. L.; Allen, P. R.; Mamajek, E. E.; Cruz, K. L.

2009-01-01

We present the results of a search for new members of the Taurus star-forming region using data from the Spitzer Space Telescope and the XMM-Newton Observatory. We have obtained optical and near-infrared spectra of 44 sources that exhibit red Spitzer colors that are indicative of stars with circumstellar disks and 51 candidate young stars that were identified by Scelsi and coworkers using XMM-Newton. We also performed spectroscopy on four possible companions to members of Taurus that were reported by Kraus and Hillenbrand. Through these spectra, we have demonstrated the youth and membership of 41 sources, 10 of which were independently confirmed as young stars by Scelsi and coworkers. Five of the new Taurus members are likely to be brown dwarfs based on their late spectral types (>M6). One of the brown dwarfs has a spectral type of L0, making it the first known L-type member of Taurus and the least massive known member of the region (M ∼ 4-7 M Jup ). Another brown dwarf exhibits a flat infrared spectral energy distribution, which indicates that it could be in the protostellar class I stage (star+disk+envelope). Upon inspection of archival images from various observatories, we find that one of the new young stars has a large edge-on disk (r = 2.''5 = 350 AU). The scattered light from this disk has undergone significant variability on a timescale of days in optical images from the Canada-France-Hawaii Telescope. Using the updated census of Taurus, we have measured the initial mass function for the fields observed by XMM-Newton. The resulting mass function is similar to previous ones that we have reported for Taurus, showing a surplus of stars at spectral types of K7-M1 (0.6-0.8 M sun ) relative to other nearby star-forming regions, such as IC 348, Chamaeleon I, and the Orion Nebula Cluster.

Star Formation in Taurus: Preliminary Results from 2MASS

Science.gov (United States)

Beichman, C. A.; Jarrett, T.

1993-01-01

Data with the 2MASS prototype camera were obtained in a 2.3 sq. deg region in Taurus containing Heiles Cloud 2, a region known from IRAS observations to contain a number of very young solar type stars.

THE SPITZER INFRARED SPECTROGRAPH SURVEY OF T TAURI STARS IN TAURUS

International Nuclear Information System (INIS)

Furlan, E.; Luhman, K. L.; Espaillat, C.

2011-01-01

We present 161 Spitzer Infrared Spectrograph (IRS) spectra of T Tauri stars and young brown dwarfs in the Taurus star-forming region. All of the targets were selected based on their infrared excess and are therefore surrounded by protoplanetary disks; they form the complete sample of all available IRS spectra of T Tauri stars with infrared excesses in Taurus. We also present the IRS spectra of seven Class 0/I objects in Taurus to complete the sample of available IRS spectra of protostars in Taurus. We use spectral indices that are not significantly affected by extinction to distinguish between envelope- and disk-dominated objects. Together with data from the literature, we construct spectral energy distributions for all objects in our sample. With spectral indices derived from the IRS spectra we infer disk properties such as dust settling and the presence of inner disk holes and gaps. We find a transitional disk frequency, which is based on objects with unusually large 13-31 μm spectral indices indicative of a wall surrounding an inner disk hole, of about 3%, and a frequency of about 20% for objects with unusually large 10 μm features, which could indicate disk gaps. The shape and strength of the 10 μm silicate emission feature suggests weaker 10 μm emission and more processed dust for very low mass objects and brown dwarfs (spectral types M6-M9). These objects also display weaker infrared excess emission from their disks, but do not appear to have more settled disks than their higher-mass counterparts. We find no difference for the spectral indices and properties of the dust between single and multiple systems.

A SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION WITH THE SLOAN DIGITAL SKY SURVEY

International Nuclear Information System (INIS)

Luhman, K. L.; Mamajek, E. E.; Shukla, S. J.; Loutrel, N. P.

2017-01-01

Previous studies have found that ∼1 deg 2 fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg 2 ) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types.

A SURVEY FOR NEW MEMBERS OF THE TAURUS STAR-FORMING REGION WITH THE SLOAN DIGITAL SKY SURVEY

Energy Technology Data Exchange (ETDEWEB)

Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Mamajek, E. E. [Department of Physics and Astronomy, The University of Rochester, Rochester, NY 14627 (United States); Shukla, S. J. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Loutrel, N. P., E-mail: kluhman@astro.psu.edu [eXtreme Gravity Institute, Department of Physics, Montana State University, Bozeman, MT 59715 (United States)

2017-01-01

Previous studies have found that ∼1 deg{sup 2} fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC 348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the initial mass function, we have performed a survey for members of Taurus across a large field (∼40 deg{sup 2}) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields toward the stellar aggregates that were surveyed for previously measured mass functions in Taurus. In addition to spectra of our new members, we include in our study near-IR spectra of roughly half of the known members of Taurus, which are used to refine their spectral types and extinctions. We also present an updated set of near-IR standard spectra for classifying young stars and brown dwarfs at M and L types.

relationship of thyroid and adrenal function to growth rate in bos ...

African Journals Online (AJOL)

of thyroid function, lower energy turnover and therefore thermal stability of B. indicus breeds (Fuller, 1969). The significant negative correlations between growth rates and plasma cortisol levels agree with the finding that cattle with low levels of glucocorticoid activity tend to grow more rapidly (Purchas, 1970; Hafs et ai. 1971) ...

De prijsvorming van hout uit het Nederlandse bos

NARCIS (Netherlands)

Slangen, L.H.G.

1984-01-01

De prijsvorming van hout op stam en hout geveld uit het Nederlandse bos op het niveau van het bosbedrijf staat centraal in deze publikatie. Na een schets van een aantal facetten die invloed hebben op de prijsvorming wordt nader ingegaan op de prijsvorming zelf. Onderzocht wordt of er verschil in

Heterosis para pesos a los 18 meses y sacrificio en un hato cebú-cruzado.

Directory of Open Access Journals (Sweden)

Llano Arango Juan David

2003-12-01

Full Text Available El objetivo de la presente investigación fue evaluar comparativamente los pesos o los 18 meses y al sacrificio de machos cruzados ¼ , bos taurus (aberdeen angus. holstein, simmental americano, simmental alemán por cebú y animales brahman puros cebú comercial y mestizos.

AcEST: BP911627 [AcEST

Lifescience Database Archive (English)

Full Text Available 1-like protein OS=Bos taurus GN=TRM1L P... 30 5.0 sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolas...HVRRHVNKGETKSRYIAASAAKPPKE 233 >sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapie

Genomic divergence of zebu and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

Natural selection has molded the evolution across all taxa. At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically ad...

Natural (auto)antibodies in calves are affected by age and diet

NARCIS (Netherlands)

Khobondo, J.O.; Nieuwland, M.G.B.; Webb, L.E.; Bokkers, E.A.M.; Parmentier, H.K.

2015-01-01

Background: Natural autoantibodies (N(a)ab) were found in every species tested so far, and are likely important in maintaining homeostasis. Objectives: (1) To determine N(a)ab in Bos taurus calves, (2) evaluate effects of diet and age on N(a)ab binding repertoires in calves, and (3) delineate bovine

75 FR 43853 - Endangered and Threatened Wildlife and Plants; Final Rule to List the Medium Tree-Finch...

Science.gov (United States)

2010-07-27

... confirmation of the success of the goat eradication program, was provided by one peer reviewer and has been... habitat is unprotected. A large amount of the highlands has been cleared or altered for farming. Much of... animals include goats (Capra hircus), donkeys (Equus asinus), cattle (Bos taurus), and pigs (Sus scrofa...

Dicty_cDB: VHL117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ing fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 AX882278_... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 8e-13 protein update 2009. 7.15 PSORT psg: 0.6

Dicty_cDB: VHN233 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ns full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 7...7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13 protein update 2009. 7.

Dicty_cDB: VHA135 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ll open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-... BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 6.26 PS

Dicty_cDB: VHM587 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ns full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 7...7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13 protein update 2009. 7.

Dicty_cDB: VHD682 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...id:none) Homo sapiens L-pipecolic acid oxid... 75 5e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from

Complete genome sequence of the thermophilic sulfate-reducing ocean bacterium Thermodesulfatator indicus type strain (CIR29812(T)).

Science.gov (United States)

Anderson, Iain; Saunders, Elizabeth; Lapidus, Alla; Nolan, Matt; Lucas, Susan; Tice, Hope; Del Rio, Tijana Glavina; Cheng, Jan-Fang; Han, Cliff; Tapia, Roxanne; Goodwin, Lynne A; Pitluck, Sam; Liolios, Konstantinos; Mavromatis, Konstantinos; Pagani, Ioanna; Ivanova, Natalia; Mikhailova, Natalia; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Hauser, Loren; Jeffries, Cynthia D; Chang, Yun-Juan; Brambilla, Evelyne-Marie; Rohde, Manfred; Spring, Stefan; Göker, Markus; Detter, John C; Woyke, Tanja; Bristow, James; Eisen, Jonathan A; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C; Klenk, Hans-Peter

2012-05-25

Thermodesulfatator indicus Moussard et al. 2004 is a member of the Thermodesulfobacteriaceae, a family in the phylum Thermodesulfobacteria that is currently poorly characterized at the genome level. Members of this phylum are of interest because they represent a distinct, deep-branching, Gram-negative lineage. T. indicus is an anaerobic, thermophilic, chemolithoautotrophic sulfate reducer isolated from a deep-sea hydrothermal vent. Here we describe the features of this organism, together with the complete genome sequence, and annotation. The 2,322,224 bp long chromosome with its 2,233 protein-coding and 58 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

Livestock Production - Current Status in South and South-East Asia, Future Directions and Priority Areas for Research

Energy Technology Data Exchange (ETDEWEB)

Perera, B. M.A. Oswin, [Kandy (Sri Lanka)

2014-01-15

The role of livestock in agriculture in South and South-East Asia is complex and significantly different from that of industrialized nations. The traditional farming systems are mostly based on mixed crop-livestock systems, with small farms predominating. The most important livestock species in the region are cattle (Bos indicus, Bos taurus and their crosses), buffalo (Bubalus bubalis, both river and swamp types), goats, sheep, pigs and poultry. In some high altitude areas Yaks (Poephagus grunniens) and Mithun or Gayal (Bos frontalis) are also important. Although the contribution of the livestock sub-sector to national GDP in most Asian countries is low, it is a crucial source of high quality protein, minerals and vitamins to the population, by way of milk, meat and eggs. For millions of smallholder farmers it provides food security, draught power, fibre, manure and fuel, and also serves as a 'living bank' in periods of economic hardship. The farming systems in the region vary widely (Perera et al., 2005), determined by a matrix of several interacting factors that include climate (latitude, altitude and rainfall), location (rural, peri-urban or urban), cropping systems (rain-fed or irrigated, annual or perennial crops), type of operation (small or large farm, subsistence or commercial), and the species and their primary purpose (milk, meat, eggs, draught, capital or mixed). The ruminant production systems that were largely extensive or semi-intensive in the past (grassland-based or mixed crop-livestock, with rain-fed or irrigated mixed farming), which were sustained with locally available resources, have become constrained due to many factors. Competition for land from the increasing human population that demands space for habitation, crop production and other economic activities have dwindled grazing lands. Mechanization of agricultural operations and commercial market forces have also made such systems less competitive. Thus some enterprising farmers have moved

Isolation and genetic diversity of endangered grey nurse shark (Carcharias taurus) populations.

Science.gov (United States)

Stow, Adam; Zenger, Kyall; Briscoe, David; Gillings, Michael; Peddemors, Victor; Otway, Nicholas; Harcourt, Robert

2006-06-22

Anthropogenic impacts are believed to be the primary threats to the eastern Australian population of grey nurse sharks (Carcharias taurus), which is listed as critically endangered, and the most threatened population globally. Analyses of 235 polymorphic amplified fragment length polymorphisms (AFLP) loci and 700 base pairs of mitochondrial DNA control region provide the first account of genetic variation and geographical partitioning (east and west coasts of Australia, South Africa) in C. taurus. Assignment tests, analysis of relatedness and Fst values all indicate that the Australian populations are isolated from South Africa, with negligible migration between the east and west Australian coasts. There are significant differences in levels of genetic variation among regions. Australian C. taurus, particularly the eastern population, has significantly less AFLP variation than the other sampling localities. Further, the eastern Australian sharks possess only a single mitochondrial haplotype, also suggesting a small number of founding individuals. Therefore, historical, rather than anthropogenic processes most likely account for their depauperate genetic variation. These findings have implications for the viability of the eastern Australian population of grey nurse sharks.

Circumstellar disks around binary stars in Taurus

Energy Technology Data Exchange (ETDEWEB)

Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

2014-03-20

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Partial characterization of three β-defensin gene transcripts in river ...

African Journals Online (AJOL)

In this study, the tracheal tissues from Egyptian river buffalo and cattle were screened for the presence of three bovine β-defensin gene transcripts. Three primer pairs were designed on the basis of published Bos taurus sequences for partial amplification of β-defensin 4, β-defensin 10 and β-defensin 11 complementary DNA ...

Dicty_cDB: VHC115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -13 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 62 6e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...2 |pid:none) Synthetic construct Homo sapiens c... 60 3e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli

Dicty_cDB: VHM609 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...m Patent EP10746... 76 7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13

Dicty_cDB: VHB165 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |p...id:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHG519 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available L1... 69 8e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 69 8e-11 CR457155_1( CR...4593 |pid:none) Homo sapiens L-pipecolic acid oxid... 69 8e-11 protein update 2009. 7.12 PSORT psg: 0.67 gvh

Dicty_cDB: VHE245 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

Dicty_cDB: VHI596 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a

Dicty_cDB: Contig-U06144-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Homo sapiens infertility-related s... 54 9e-06 AK057482_1( AK057482 |pid:none) Homo sapiens cDNA F... 7e-06 BC149464_1( BC149464 |pid:none) Bos taurus FK506 binding protein l... 54 7e-06 AF311312_1( AF311312 |

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

International Nuclear Information System (INIS)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

2016-01-01

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when not used in accordance with the use of the in-house Bos

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

Energy Technology Data Exchange (ETDEWEB)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

2016-06-15

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

Effect of refrigeration systems upon frozen bull sperm viability assessed by computer-assisted sperm analysis and fluorescent probesEfeito de sistemas de refrigeração sobre a viabilidade do sêmen bovino congelado analisado por meio de sistema computadorizado e sondas fluorescentes

Directory of Open Access Journals (Sweden)

Frederico Ozanam Papa

2012-10-01

Full Text Available Sperm cryopreservation success depends upon the maintenance of spermatozoa fertility potential. Sperm cells must preserve both integrity and functionality of several cell structures. The stabilization phase must allow the exit of water from the sperm cells via osmosis. This study aimed to compare the effect of refrigeration in the commercial refrigerator (CR and the transport/refrigeration box (TRB upon the viability of frozen bull sperm diluted in three different extenders (A, B and C. Ten Nellore bulls, Bos taurus indicus maintained in Artificial Insemination Center were used and the spermatozoa samples was assessed for Plasma Membrane Integrity and CASA evaluation. The stabilization phase (5°C/4 hours was performed in the CR as well as in the TRB, and then samples were exposed to nitrogen vapor during 20 minutes and then plunged into nitrogen. The statistical analysis was done using the variance analysis and the significance level was set at 5%. In the CR the post-thawing parameters for PM and ALH were higher (p O sucesso da criopreservação do sêmen depende da manutenção do potencial de fertilidade dos espermatozoides. Nos espermatozoides deve haver a preservação da integridade e funcionalidade de várias das suas estruturas. A fase de estabilização permite a saída de água dos espermatozoides por osmose. Este estudo tem o objetivo de comparar o efeito da refrigeração em refrigerador comercial (RC e em caixa de transporte refrigerada (CTR na viabilidade do sêmen congelado bovino diluído em três diferentes meios (A, B e C. Dez touros Nelore, Bos taurus indicus mantidos em central de inseminação artificial foram utilizados e as amostras de sêmen analisadas para checar a integridade das membranas plasmáticas e por meio da análise computadorizada (CASA. A fase de estabilização (5°C/4 horas foi realizada em RC e em CTR, sendo as amostras expostas ao vapor de nitrogênio durante 20 minutos e após mergulhadas no nitrog

Far-infrared investigation of the Taurus star-forming region using the IRAS database

International Nuclear Information System (INIS)

Hughes, J.D.

1986-01-01

The Taurus-Auriga complex was selected as the first molecular cloud to be investigated in this study. The Taurus clouds were defined as lying between 04h and 05h in R.A. and +16 to +31 degrees in Dec., then the IRAS point-source catalogue was searched for sources with good or moderate quality fluxes in all three of the shortest IRAS bands. The sources selected were then classified into subgroups according to their IRAS colors. Taurus is generally believed to be an area of low-mass star formation, having no luminous O-B associations within or near to the cloud complex. Once field stars, galaxies and planetary nebulae had been removed from the sample only the molecular cloud cores, T Tauri stars and a few emission-line A and B stars remained. The great majority of these objects are pre-main sequence in nature and, as stated by Chester (1985), main sequence stars without excess far-infrared emission would only be seen in Taurus if their spectral types were earlier than about A5 and then not 25 microns. By choosing our sample in this way we are naturally selecting the hotter and thus more evolved sources. To counteract this, the molecular cloud core-criterion was applied to soruces with good or moderate quality flux at 25, 60 and 100 microns, increasing the core sample by about one third. The candidate protostar B335 is only detected by IRAS at 60 and 100 microns while Taurus is heavily contaminated by cirrus at 100 microns. This means that detection at 25 microns is also required with those at 60 and 100 microns to avoid confusing a ridge of cirrus with a genuine protostar. The far-infrared luminosity function of these sources is then calculated and converted to the visual band by a standard method to compare with the field star luminosity function of Miller and Scalo

In silico study of protein to protein interaction analysis of AMP-activated protein kinase and mitochondrial activity in three different farm animal species

Science.gov (United States)

Prastowo, S.; Widyas, N.

2018-03-01

AMP-activated protein kinase (AMPK) is cellular energy censor which works based on ATP and AMP concentration. This protein interacts with mitochondria in determine its activity to generate energy for cell metabolism purposes. For that, this paper aims to compare the protein to protein interaction of AMPK and mitochondrial activity genes in the metabolism of known animal farm (domesticated) that are cattle (Bos taurus), pig (Sus scrofa) and chicken (Gallus gallus). In silico study was done using STRING V.10 as prominent protein interaction database, followed with biological function comparison in KEGG PATHWAY database. Set of genes (12 in total) were used as input analysis that are PRKAA1, PRKAA2, PRKAB1, PRKAB2, PRKAG1, PRKAG2, PRKAG3, PPARGC1, ACC, CPT1B, NRF2 and SOD. The first 7 genes belong to gene in AMPK family, while the last 5 belong to mitochondrial activity genes. The protein interaction result shows 11, 8 and 5 metabolism pathways in Bos taurus, Sus scrofa and Gallus gallus, respectively. The top pathway in Bos taurus is AMPK signaling pathway (10 genes), Sus scrofa is Adipocytokine signaling pathway (8 genes) and Gallus gallus is FoxO signaling pathway (5 genes). Moreover, the common pathways found in those 3 species are Adipocytokine signaling pathway, Insulin signaling pathway and FoxO signaling pathway. Genes clustered in Adipocytokine and Insulin signaling pathway are PRKAA2, PPARGC1A, PRKAB1 and PRKAG2. While, in FoxO signaling pathway are PRKAA2, PRKAB1, PRKAG2. According to that, we found PRKAA2, PRKAB1 and PRKAG2 are the common genes. Based on the bioinformatics analysis, we can demonstrate that protein to protein interaction shows distinct different of metabolism in different species. However, further validation is needed to give a clear explanation.

Cattle grazing in semiarid forestlands: Habitat selection during periods of drought

Science.gov (United States)

C. L. Roever; T. DelCurto; M. Rowland; M. Vavra; M. Wisdom

2015-01-01

Climate change models are predicting increased frequency and severity of droughts in arid and semiarid environments, and these areas are responsible for much of the world’s livestock production. Because cattle (Bos Taurus) grazing can impact the abundance, distribution, and ecological function of native plant and animal communities, it is important...

Sire breed and breed genotype of dam effects in crossbreeding beef ...

African Journals Online (AJOL)

Cows bred to Afrikaner bulls were less (P < 0.05) productive than cows bred to other Bos taurus sires. An increase in proportion Afrikaner breeding in dam resulted in longer calving intervals and a decline in cow productivity, but these differences were not always significant. A breeding strategy for the retainment of superior ...

Dicty_cDB: SHD834 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available reading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX88...2278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHN139 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX8822...78_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHP888 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ng fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1...( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Flares of Orion population variables in the association Taurus T3

International Nuclear Information System (INIS)

Khodzhaev, A.S.; AN Armyanskoj SSR, Byurakan. Astrofizicheskaya Observatoriya)

1987-01-01

Thirteen new flare stars, proved to be irregular variables of Orion Population, were discovered from a study of the Taurus Dark Cloud region by the homogeneous photographic multipose method on the wide angle Schmidt telescopes of the Byurakan Astorphysical Observatory. Seventeen flares on these stars were detected for about 750 hours of the effective observing time. The analysis of the complicated light curves of these flares shows a great variety and multiplicity of this phenomenon and various dynamics of flare energy release processes. The existence of flare stars with some properties typical for both of the T Tauri and UV Ceti stars simulteneously indicates nonstable stars. The population of flare stars in the Taurus Dark Cloud region is apparently as young as in Orion and Monoceros

The Taurus Boundary of Stellar/Substellar (TBOSS) Survey. II. Disk Masses from ALMA Continuum Observations

Science.gov (United States)

Ward-Duong, K.; Patience, J.; Bulger, J.; van der Plas, G.; Ménard, F.; Pinte, C.; Jackson, A. P.; Bryden, G.; Turner, N. J.; Harvey, P.; Hales, A.; De Rosa, R. J.

2018-02-01

We report 885 μm ALMA continuum flux densities for 24 Taurus members spanning the stellar/substellar boundary with spectral types from M4 to M7.75. Of the 24 systems, 22 are detected at levels ranging from 1.0 to 55.7 mJy. The two nondetections are transition disks, though other transition disks in the sample are detected. Converting ALMA continuum measurements to masses using standard scaling laws and radiative transfer modeling yields dust mass estimates ranging from ∼0.3 to 20 M ⊕. The dust mass shows a declining trend with central object mass when combined with results from submillimeter surveys of more massive Taurus members. The substellar disks appear as part of a continuous sequence and not a distinct population. Compared to older Upper Sco members with similar masses across the substellar limit, the Taurus disks are brighter and more massive. Both Taurus and Upper Sco populations are consistent with an approximately linear relationship in M dust to M star, although derived power-law slopes depend strongly upon choices of stellar evolutionary model and dust temperature relation. The median disk around early-M stars in Taurus contains a comparable amount of mass in small solids as the average amount of heavy elements in Kepler planetary systems on short-period orbits around M-dwarf stars, with an order of magnitude spread in disk dust mass about the median value. Assuming a gas-to-dust ratio of 100:1, only a small number of low-mass stars and brown dwarfs have a total disk mass amenable to giant planet formation, consistent with the low frequency of giant planets orbiting M dwarfs.

THE MAGNETIC FIELD IN TAURUS PROBED BY INFRARED POLARIZATION

International Nuclear Information System (INIS)

Chapman, Nicholas L.; Goldsmith, Paul F.; Pineda, Jorge L.; Li Di; Clemens, D. P.; Krco, Marko

2011-01-01

We present maps of the plane-of-sky magnetic field within two regions of the Taurus molecular cloud: one in the dense core L1495/B213 filament and the other in a diffuse region to the west. The field is measured from the polarization of background starlight seen through the cloud. In total, we measured 287 high-quality near-infrared polarization vectors in these regions. In L1495/B213, the percent polarization increases with column density up to A V ∼ 9 mag, the limits of our data. The radiative torques model for grain alignment can explain this behavior, but models that invoke turbulence are inconsistent with the data. We also combine our data with published optical and near-infrared polarization measurements in Taurus. Using this large sample, we estimate the strength of the plane-of-sky component of the magnetic field in nine subregions. This estimation is done with two different techniques that use the observed dispersion in polarization angles. Our values range from 5 to 82 μG and tend to be higher in denser regions. In all subregions, the critical index of the mass-to-magnetic flux ratio is sub-unity, implying that Taurus is magnetically supported on large scales (∼2 pc). Within the region observed, the B213 filament takes a sharp turn to the north and the direction of the magnetic field also takes a sharp turn, switching from being perpendicular to the filament to becoming parallel. This behavior can be understood if we are observing the rim of a bubble. We argue that it has resulted from a supernova remnant associated with a recently discovered nearby gamma-ray pulsar.

Serological evidence for brucellosis in Bos indicus in Nigeria

NARCIS (Netherlands)

Bertu, Wilson J.; Gusi, Amahyel M.; Hassan, Moses; Mwankon, Esther; Ocholi, Reuben A.; Ior, Daniel D.; Husseini, Bakari A.; Ibrahim, Gideon; Abdoel, Theresia H.; Smits, Henk L.

2012-01-01

Purpose Nigeria is the largest cattle-rearing nation in Africa with most animals kept under traditional husbandry practices. While bovine brucellosis does not receive much attention, a relatively high seroprevalence is found in samples submitted for laboratory testing. The aim of the study was to

Progesterone production in superovulated holstein heifers and in crossbred recipient of embryo supplemented with betacarotene and tocopherol Produção de progesterona em novilhas Holandesas superovuladas e receptoras de embrião mestiças suplementadas com betacaroteno e tocoferol

Directory of Open Access Journals (Sweden)

José Nélio de Sousa Sales

2011-08-01

Full Text Available Two experiments were conducted to evaluate the effect of the intramuscular injection of betacarotene associated to tocopherol on the plasma concentration progesterone of superovulated Holstein heifers (experiment 1 and in crossbred (Bos taurus x Bos indicus heifers submitted to fixed-time embryo transfer (FTET, experiment 2. In experiment 1, after estrus synchronization and superovulation animals were inseminated 12 and 24 hours after estrus onset and embryos flushed 7 days later. Heifers were allocated randomly to one of three treatments: Control; T800 (800 mg of betacarotene plus 500 mg of tocopherol and T1200 (1,200 mg of betacarotene plus 750 mg of tocopherol. The treatments were given on the day of ear implant placement and repeated on the first day of superovulation. Blood samples were collected on D0, D5, D9, D12 and D16. In experiment 2, treatments were imposed at intravaginal device insertion (D0. The same experimental design, as in experiment 1, was used. Blood samples were collected on D17 (embryos implanted for progesterone determination by radioimmunoassay. In experiment 1, average plasma progesterone concentrations after corpora lutea formation (D12 plus D16 means were 13.7±1.8 ng/ml, 14.5±2.3 ng/ml and 10.8±2.3 ng/ml for control, T800 and T1200, respectively, and did not differ (P=0.44. In experiment 2, progesterone concentrations on D17 in Control (8.88±0.57 ng/ml, T800 (7.48±0.64 ng/ml and T1200 (5.90±1.33 ng/ml groups were similar (P=0.11. Results indicate that the supplemental betacarotene and tocopherol injections did not influence peripheral progesterone concentrations in superovulated Holstein donors and crossbreed recipients heifers.Dois experimentos foram conduzidos para avaliar o efeito da injeção intramuscular de betacaroteno associada ao tocoferol, na concentração plasmática de progesterona de novilhas Holandesas superovuladas (Experimento 1 e em novilhas cruzadas (Bos taurus x Bos indicus submetidas �

Arabidopsis CDS blastp result: AK104406 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 7e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Arabidopsis CDS blastp result: AK106125 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Arabidopsis CDS blastp result: AK067330 [KOME

Lifescience Database Archive (English)

Full Text Available eductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mort...ality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ...

Arabidopsis CDS blastp result: AK068639 [KOME

Lifescience Database Archive (English)

Full Text Available eductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mort...ality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 1e-17 ...

Arabidopsis CDS blastp result: AK104937 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Arabidopsis CDS blastp result: AK104294 [KOME

Lifescience Database Archive (English)

Full Text Available tality 19 protein) (GRIM-19) (Cell death-regulatory protein GRIM-19) (Swiss-Prot:Q95KV7) [Bos taurus] 9e-16 ... ...reductase B16.6 subunit (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic-interferon-induced mor

Dicty_cDB: VFI871 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available m... 477 e-133 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia, adrenoco...7671 |pid:none) Danio rerio achalasia, adrenocorti... 82 4e-14 BC120418_1( BC120418 |pid:none) Bos taurus achalasia...e-13 AK222509_1( AK222509 |pid:none) Homo sapiens mRNA for achalasia, a... 79 3e-

The influence of loss and gain of body mass on ovarian activity in ...

African Journals Online (AJOL)

Ovarian activity was studied in 36 dry, Bos taurus cows fed to achieve different rates of body mass loss and gain in a 2 x 2 factorial experiment. Cows were fed hay to supply either 70% (Treatments 1, 2) or 40% (Treatments. 3,4) of their ME requirements for maintenance until they became anoestrus. Following a 90-day ...

Dicty_cDB: VHH128 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pen reading fra... 76 5e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 A...X882278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHN847 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 72 1e-11 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 72 2e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecol..._1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 71 3e-11 AX882278_1( AX882278 |pid:none) Seque

Hair shedding score may affect body temperature more than hair coat color during heat stress in weaned beef heifers.

Science.gov (United States)

The objective of this study was to evaluate the effect of hair shedding score and hair coat color on the vaginal temperature (VT) of calves during heat stress. Weaned Bos taurus beef heifers (n = 32; BW = 282 ± 6.4 kg) were assigned to a hair coat color class (BLACK; RED; or LIGHT, where LIGHT = yel...

SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

International Nuclear Information System (INIS)

Daemgen, Sebastian; Bonavita, Mariangela; Jayawardhana, Ray; Lafrenière, David; Janson, Markus

2015-01-01

We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M ☉ and low-mass stars at ∼0.2 M ☉ . We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M Jup . The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3 −4.9 +6.6 %. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M ☉ appear to be multiple. Higher order multiples were found in 1.8 −1.5 +4.2 % of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively

SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

Energy Technology Data Exchange (ETDEWEB)

Daemgen, Sebastian [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5H 3H4 (Canada); Bonavita, Mariangela [The University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Jayawardhana, Ray [Physics and Astronomy, York University, Toronto, Ontario L3T 3R1 (Canada); Lafrenière, David [Department of Physics, University of Montréal, Montréal, QC (Canada); Janson, Markus, E-mail: daemgen@astro.utoronto.ca [Department of Astronomy, Stockholm University, Stockholm (Sweden)

2015-02-01

We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M {sub ☉} and low-mass stars at ∼0.2 M {sub ☉}. We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M {sub Jup}. The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3{sub −4.9}{sup +6.6}%. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M {sub ☉} appear to be multiple. Higher order multiples were found in 1.8{sub −1.5}{sup +4.2}% of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively.

Spatial distribution of Brucella antibodies with reference to indigenous cattle populations among contrasting agro-ecological zones of Uganda.

Science.gov (United States)

Kabi, Fredrick; Muwanika, Vincent; Masembe, Charles

2015-09-01

Indigenous cattle populations exhibit various degrees of agro-ecological fitness and provide desirable opportunities for investments to improve sustainable production for better rural small-scale farmers' incomes globally. However, they could be a source of infection to their attendants and other susceptible livestock if their brucellosis status remains unknown. This study investigated the spatial distribution of Brucella antibodies among indigenous cattle populations in Uganda. Sera from a total of 925 indigenous cattle (410 Ankole Bos taurus indicus, 50 Nganda and 465 East African Shorthorn Zebu (EASZ) - B. indicus) obtained randomly from 209 herds spread throughout Uganda were sequentially analysed for Brucella antibodies using the indirect (I) and competitive (C) enzyme linked Immuno-sorbent assays (ELISA). Recent incidences of abortion within the previous 12 months and routine hygienic practices during parturition were explored for public health risks. Brucella antibodies occurred in approximately 8.64% (80/925) and 28.70% (95% CI: 22.52, 34.89) of the sampled individual cattle and herds, respectively. Findings have shown that Ankole and EASZ cattle had similar seroprevalences. Indigenous cattle from the different study agro-ecological zones (AEZs) exhibited varying seroprevalences ranging from approximately 1.78% (95% CI: 0, 5.29) to 19.67% (95% CI: 8.99, 30.35) in the Lake Victoria Crescent (LVC) and North Eastern Drylands (NED) respectively. Significantly higher odds for Brucella antibodies occurred in the NED (OR: 3.40, 95% CI: 1.34, 8.57, p=0.01) inhabited by EASZ cattle compared to the KP (reference category) AEZ. Recent incidences of abortions within the previous 12 months were significantly (p<0.001) associated with seropositive herds. These findings add critical evidence to existing information on the widespread occurrence of brucellosis among indigenous cattle populations in Uganda and could guide allocation of meagre resources for awareness creation

Recent TAURUS results on Hα velocities in M83

International Nuclear Information System (INIS)

Allen, R.J.; Atherton, P.D.; Oosterloo, T.A.

1983-01-01

Preliminary Hα observations with the TAURUS imaging spectrometer confirm a pattern of systematic radial motions in a section of spiral arm in M83. The velocity gradients are not consistent with those predicted for the neutral gas. Non-circular motions have also been discovered in the central regions of the galaxy. (Auth.)

Mosquitocidal and water purification properties of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus leaf extracts against the mosquito vectors.

Science.gov (United States)

Arjunan, Nareshkumar; Murugan, Kadarkarai; Madhiyazhagan, Pari; Kovendan, Kalimuthu; Prasannakumar, Kanagarajan; Thangamani, Sundaram; Barnard, Donald R

2012-04-01

Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for their toxicity effect on the third-instar larvae of Anopheles stephensi, Culex quinquefasciatus and Aedes aegypti. The leaves of C. dactylon, A. vera, H. indicus and C. amboinicus were collected from natural habitats (forests) in Western Ghats, Tamil Nadu, India. A total of 250 g of fresh, mature leaves were rinsed with distilled water and dried in shade. The dried leaves were put in Soxhlet apparatus and extract prepared using 100% ethanol for 72 h at 30-40°C. Dried residues were obtained from 100 g of extract evaporated to dryness in rotary vacuum evaporator. Larvicidal properties of ethanolic leaf extracts showed that the extracts are effective as mosquito control agents. The larval mortality was observed after 24 h exposure. No mortality was observed in the control. The median lethal concentration (LC(50)) values observed for the larvicidal activities are 0.44%, 0.51%, 0.59% and 0.68% for extracts of C. dactylon, A. vera, H. indicus and C. amboinicus, respectively. The observed mortality were statistically significant at P < 0.05 level. C. dactylon showed the highest mortality rate against the three species of mosquito larvae in laboratory and field. The selected plants were shown to exhibit water purification properties. Water quality parameters such as turbidity, pH and water clarity were analyzed in the water samples (pre-treatment and post-treatment of plant extracts) taken from the different breeding sites of mosquitoes. Water colour, turbidity and pH were reduced significantly after treatment with C. dactylon (13 HU, 31.5 mg/l and 6.9), H. indicus (13.8 HU, 33 mg/l and 7.1), A. vera (16 HU, 33.8 mg/l and 7.4) and C. amboinicus (21 HU, 35 mg/l and 7.5) extracts. The study proved that the extracts of C. dactylon, A. vera, H. indicus and C. amboinicus have both mosquitocidal and water sedimentation properties.

Ford Taurus Ethanol-Fueled Sedan

International Nuclear Information System (INIS)

Eudy, Leslie

1999-01-01

The U.S. Department of Energy (DOE) is encouraging the use of alternative fuels and alternative fuel vehicles (AFVs). To support this activity, DOE has directed the National Renewable Energy Laboratory (NREL) to conduct projects to evaluate the performance and acceptability of light-duty AFVs. In this study, we tested a pair of 1998 Ford Tauruses: one E85 (85% gasoline/15% ethanol) model (which was tested on both E85 and gasoline) and a gasoline model as closely matched as possible. Each vehicle was run through a series of tests to evaluate acceleration, fuel economy, braking, and cold-start capabilities, as well as more subjective performance indicators such as handling, climate control, and noise

Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with Ca II emission

Science.gov (United States)

Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

1987-01-01

Radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren 'HVR', (1986) are reported. Most of the velocities are determined to better than 2 km/s precision. The kinematic properties of the Ca II emission stars with strong Li are found to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. It is suggested following Jones and Herbig (1979), that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with CA II emission

Science.gov (United States)

Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

1987-04-01

The authors report radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren (HVR). Most of the velocities are determined to better than 2 km s-1 precision. The authors find the kinematic properties of the Ca II emission stars with strong Li to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. The authors suggest, following Jones and Herbig, that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

Avaliação comparativa da ultraestrutura e propriedades físicas do esmalte bovino, bubalino e humano

Directory of Open Access Journals (Sweden)

Bárbara C.L. Nogueira

2014-05-01

Full Text Available Este estudo teve como finalidade comparar a morfologia e propriedades físicas da estrutura do esmalte dos dentes bovinos, bubalinos e humanos. A análise deste tecido foi realizada por meio de microscopia eletrônica de varredura, composição mineral, microdureza e rugosidade superficial do esmalte em 41 incisivos bubalinos (Bos taurus indicus, 41 incisivos bovinos (Pelorovis antiques e 30 incisivos permanentes de humanos. Os resultados mostraram que a ultraestrutura do esmalte revela uma significativa similaridade das espécies estudadas com a encontrada em amostras humanas. No esmalte bovino e bubalino os elementos químicos que apresentaram maior concentração foram: O, Ca e P, justamente os que formam os cristais de hidroxiapatita - Ca10(PO46(OH2. Na microdureza Knoop não houve diferença estatisticamente significante entre as três espécies. Porém, a rugosidade superficial do esmalte bubalino (2,16µm ±0,23 foi significativamente maior quando comparada aos dentes humano (0,36µm ±0,05 e bovino (0,41µm ±0,07. Conclui-se que as características e propriedades do esmalte bovino e bubalino, por meio de análises e testes, apresentou uma morfologia semelhante à de humanos, arquitetura ultraestrutural similar, microdureza e composição mineral equivalente ao tecido dental humano, tornando-se modelos de referência para pesquisas.

Infrared spectroscopy of dust in the Taurus dark clouds: solid carbon monoxide

International Nuclear Information System (INIS)

Whittet, D.C.B.; McFadzean, A.D.

1989-01-01

Spectra centred on the spectral feature of solid CO at 4.67 μm wavelength are presented for eight stars in or behind the quiescent dark cloud complex in Taurus. The solid CO profile is dominated by a sharp component centred at 4.673 μm (2140 cm -1 ). As in previous observations of the feature, asymmetry in the profile is consistent with the presence of a weaker, somewhat broader, overlapping component centred at ∼ 4.682 μm (2136 cm -1 ). New and previously published data for Taurus stars are combined to study the correlation of the peak optical depth in the CO feature with visual extinction and with the depth of the water-ice feature at 3.0 μm. (author)

Successful treatment of oral squamous cell carcinoma with intralesional fluorouracil in a Malayan tapir (Tapirus indicus).

Science.gov (United States)

Miller, C L; Templeton, R S; Karpinski, L

2000-06-01

An oral mass was observed in a Malayan tapir (Tapirus indicus). Squamous cell carcinoma was diagnosed by histologic examination of a biopsy specimen. A series of intralesional injections using fluorouracil resulted in complete regression of the neoplasm with no recognized adverse effects.

QTL-Kartierung und funktionelle Kandidatengenanalyse für das Merkmal Totgeburt in einer fortgeschrittenen Fleckvieh- x Red-Holstein-Rückkreuzungspopulation

OpenAIRE

Gomeringer, Verena

2007-01-01

Das Ziel dieser Arbeit war die Kartierung eines QTL mit Effekt auf paternalen Kalbeverlauf und paternale Totgeburt auf Bos Taurus Autosom 9 (BTA09) in einer fortgeschrittenen Fleckvieh x Red-Holstein Rückkreuzungspopulation mit positioneller und funktioneller Kandidatengenanalyse. Dazu wurden Untersuchungen mit verschiedenen Kartierungsdesigns in Granddaughter und Daughter Designs durchgeführt. Intervallkartierung und Linkage / Linkage-Disequilibrium-Kartierung wurden verwendet um den QTL ...

Glomerular filtration rate and renal recovery of [14C]-allantoin in Bali and Zebu cattle of Indonesia

International Nuclear Information System (INIS)

Prasitkusol, P.; Chen, X.B.; Orskov, E.R.; Kyle, D.J.; Yusiati, L.M.

2004-01-01

The urinary recovery of [ 14 C]-allantoin injected into the blood of Bali Cattle (Bos banteng) and Zebu cattle (Bos indicus), and the glomerular filtration rate (GFR) of these animals, were determined. The cattle were fed with king grass at 95% of ad libitum intake. The recovery of [ 14 C]-allantoin in the urine was significantly higher for Bali (83 ± SE 0.94 %) than for Zebu Cattle (74 ± SE 0.79 %). There were no significant differences in GFR between Bali and Zebu cattle (302 ± SE23.8 and 285 ± SE18.7 L/d). Within each species, there was no significant effect of GFR on the [ 14 C]-allantoin recovery. It remains to be investigated whether the differences in [ 14 C]-allantoin recovery between species is affected by GFR. (author)

Using binary statistics in Taurus-Auriga to distinguish between brown dwarf formation processes

Science.gov (United States)

Marks, M.; Martín, E. L.; Béjar, V. J. S.; Lodieu, N.; Kroupa, P.; Manjavacas, E.; Thies, I.; Rebolo López, R.; Velasco, S.

2017-08-01

Context. One of the key questions of the star formation problem is whether brown dwarfs (BDs) form in the manner of stars directly from the gravitational collapse of a molecular cloud core (star-like) or whether BDs and some very low-mass stars (VLMSs) constitute a separate population that forms alongside stars comparable to the population of planets, for example through circumstellar disk (peripheral) fragmentation. Aims: For young stars in Taurus-Auriga the binary fraction has been shown to be large with little dependence on primary mass above ≈ 0.2 M⊙, while for BDs the binary fraction is computations. A small amount of dynamical processing of the stellar component was accounted for as appropriate for the low-density Taurus-Auriga embedded clusters. Results: The binary fraction declines strongly in the transition region between star-like and peripheral formation, exhibiting characteristic features. The location of these features and the steepness of this trend depend on the mass limits for star-like and peripheral formation. Such a trend might be unique to low density regions, such as Taurus, which host binary populations that are largely unprocessed dynamically in which the binary fraction is large for stars down to M-dwarfs and small for BDs. Conclusions: The existence of a strong decline in the binary fraction - primary mass diagram will become verifiable in future surveys on BD and VLMS binarity in the Taurus-Auriga star-forming region. The binary fraction - primary mass diagram is a diagnostic of the (non-)continuity of star formation along the mass scale, the separateness of the stellar and BD populations, and the dominant formation channel for BDs and BD binaries in regions of low stellar density hosting dynamically unprocessed populations.

THE USE OF DIETARY FATS AND CONCENTRATES TO ALLEVIATE THE NEGATIVE ENERGY BALANCE IN CROSSBRED COWS IN EARLY LACTATION

Directory of Open Access Journals (Sweden)

Carlos F. Aguilar-Pérez

2014-08-01

Full Text Available Energy balance (EB is defined as the difference between energy intake and energy expenditure. Fertility in the high-merit cow has been adversely associated with high milk production, low intake of energy and mobilisation of body reserves in early lactation, which combine in the term negative energy balance (NEB.  The timing of insemination usually coincides with peak milk yield, when dairy cows are often in NEB. Crossbred cows (Bos taurus x Bos indicus in the tropics have comparatively lower nutrient requirements and different partition of nutrients than high merit dairy cows. Thus, it would be expected that both the magnitude and length of negative energy balance were different in a crossbred cow. Because of marked differences compared with high-merit cows, crossbred cows in the tropics would be expected to show greater response to additional energy in early lactation improving their energy status and hence reproductive performance. Knowing the influence of nutrition on reproduction, many methods have been proposed for manipulating the diet to avoid or to alleviate negative energy balance. The use of fats is one alternative, which has been extensively studied in dairy and beef cows but with inconclusive results. Another alternative is to use starch-based concentrates, taking into account level of inclusion and quality and availability of pasture, in order to avoid substitution effects and to get maximum profits. Two experiments were carried out in Yucatan Mexico, in order to evaluate the use of bypass fats (calcium soaps of long-chain fatty acids, CAFA or a starch-based concentrate to alleviate the NEB in grazing crossbred cows in early lactation. The NEB in early lactation was successfully avoided by the use of the starch-based concentrate but not by the use of bypass fats, this due to a reduction in the grass DM intake. It was concluded that crossbred cows in the tropics may experience a period of NEB postpartum, which can be avoided if

Growth curves of crossbred cows sired by Hereford, Angus, Belgian Blue, Brahman, Boran, and Tuli bulls, and the fraction of mature body weight and height at puberty.

Science.gov (United States)

Freetly, H C; Kuehn, L A; Cundiff, L V

2011-08-01

The objective of this study was to evaluate the growth curves of females to determine if mature size and relative rates of maturation among breeds differed. Body weight and hip height data were fitted to the nonlinear function BW = f(age) = A - Be(k×age), where A is an estimate of mature BW and k determines the rate that BW or height moves from B to A. Cows represented progeny from 28 Hereford, 38 Angus, 25 Belgian Blue, 34 Brahman, 8 Boran, and 9 Tuli sires. Bulls from these breeds were mated by AI to Angus, Hereford, and MARC III composite (1/4 Angus, 1/4 Hereford, 1/4 Red Poll, and 1/4 Pinzgauer) cows to produce calves in 1992, 1993, and 1994. These matings resulted in 516 mature cows whose growth curves were subsequently evaluated. Hereford-sired cows tended to have heavier mature BW, as estimated by parameter A, than Angus- (P=0.09) and Brahman-sired cows (P=0.06), and were heavier than the other breeds (P Angus-sired cows were heavier than Boran- (P Angus-sired cows did not differ from Brahman-sired cows (P=0.94). Brahman-sired cows had a heavier mature BW than Boran- (P Angus-sired cows matured faster (k) than cows sired by Hereford (P=0.03), Brahman (P Angus-sired cows (P=0.09), and had reached a greater proportion of their mature BW at puberty than had Hereford- (P < 0.001), Tuli- (P < 0.001), and Belgian Blue-sired cows (P < 0.001). Within species of cattle, the relative range in proportion of mature BW at puberty (Bos taurus 0.56 through 0.58, and Bos indicus 0.60) was highly conserved, suggesting that proportion of mature BW is a more robust predictor of age at puberty across breeds than is absolute weight or age. © 2011 American Society of Animal Science. All rights reserved.

MODELO MATEMÁTICO APLICADO A LA CURVA DE LACTANCIA EN GANADO VACUNO DOBLE PROPÓSITO

Directory of Open Access Journals (Sweden)

Luz Botero

2006-05-01

Full Text Available hembras vacunas. Materiales y métodos. Durante 11 meses, se estudió la producción de leche en 500novillas doble propósito Bos taurus x Bos indicus, de las sabanas del trópico bajo colombiano. Laproducción se cuantificó en kilogramos. Se incluyeron los datos de la producción de leche en época(seca-lluviosa y número de lactancias (primera; segunda y tercera y, más de tres. Los datos hacen partedel archivo de la Ganadería XB, ubicada en las sabanas de Bolívar, Colombia, recopilados desde el año1990 hasta el 2000. A estos datos se le aplicó los modelos lineal simple, cuadrático, lineal logarítmico,cuadrático logarítmico, gamma incompleto, lineal hiperbólico y polinomial inverso. Los parámetros paralos modelos gamma incompleto y polinomial inverso fueron estimados, a partir del método de “Gauss-Newton”, para la regresión no lineal; los demás modelos fueron ajustados por regresión lineal de lasproducciones, en función de los meses en lactancia, por el método de los cuadrados mínimos. Resultados.En los modelos propuestos, se observó que el modelo polinomial inverso es el que mejor caracteriza lacurva de lactancia por presentar los mayores valores para el estadístico Durbin-Watson y coeficiente dedeterminación (R2 y sobre dicho modelo existe información necesaria para obtener parámetros prácticoscalculados a partir de la ecuación de la curva de lactancia. Conclusión. El modelo matemático polinomialinverso se constituye en una excelente herramienta para aplicar en la administración y toma de decisionesen el manejo de hatos del sistema de doble propósito

Gamete therapeutics: recombinant protein adsorption by sperm for increasing fertility via artificial insemination.

Science.gov (United States)

Alvarez-Gallardo, Horacio; Kjelland, Michael E; Moreno, Juan F; Welsh, Thomas H; Randel, Ronald D; Lammoglia, Miguel A; Pérez-Martínez, Mario; Lara-Sagahón, Alma V; Esperón-Sumano, A Enrique; Romo, Salvador

2013-01-01

A decrease in fertility can have a negative economic impact, both locally and over a broader geographical scope, and this is especially the case with regard to the cattle industry. Therefore, much interest exists in evaluating proteins that might be able to increase the fertility of sperm. Heparin binding proteins (HBPs), specifically the fertility associated antigen (FAA) and the Type-2 tissue inhibitor of metalloproteinase (TIMP-2), act to favor the capacitation and acrosome reaction and perhaps even modulate the immune system's response toward the sperm. The objective of this research was to determine the effect on fertility of adding recombinant FAA (rFAA) and recombinant TIMP-2 (rTIMP-2) to bovine semen before cryopreservation for use in an artificial insemination (AI) program in a tropical environment. For this experiment, 100 crossbred (Bos taurus x Bos indicus) heifers were selected based on their estrus cycle, body condition score (BCS), of 4 to 6 on a scale of 1 to 9, and adequate anatomical conformation evaluated by pelvic and genital (normal) measurements. Heifers were synchronized using estradiol benzoate (EB), Celosil® (PGF2α) (Shering-Plough) and a controlled internal drug release (CIDR) device was inserted that contained progesterone. Inseminations were performed in two groups at random, 50 animals per group. The control group was inseminated with conventional semen. The treatment group was inseminated with semen containing rFAA (25 µg/mL) and rTIMP-2 (25 µg/mL). In the control group a 16% pregnancy rate was obtained versus a 40% pregnancy rate for the HBP treatment group, resulting in a significant difference (P = 0.0037). Given the results herein, one may conclude that the HBPs can increase fertility and could be an option for cattle in tropical conditions; however, one needs to consider the environment, nutrition, and the genetic interaction affecting the final result in whatever reproductive program that is implemented.

Gamete therapeutics: recombinant protein adsorption by sperm for increasing fertility via artificial insemination.

Directory of Open Access Journals (Sweden)

Horacio Alvarez-Gallardo

Full Text Available A decrease in fertility can have a negative economic impact, both locally and over a broader geographical scope, and this is especially the case with regard to the cattle industry. Therefore, much interest exists in evaluating proteins that might be able to increase the fertility of sperm. Heparin binding proteins (HBPs, specifically the fertility associated antigen (FAA and the Type-2 tissue inhibitor of metalloproteinase (TIMP-2, act to favor the capacitation and acrosome reaction and perhaps even modulate the immune system's response toward the sperm. The objective of this research was to determine the effect on fertility of adding recombinant FAA (rFAA and recombinant TIMP-2 (rTIMP-2 to bovine semen before cryopreservation for use in an artificial insemination (AI program in a tropical environment. For this experiment, 100 crossbred (Bos taurus x Bos indicus heifers were selected based on their estrus cycle, body condition score (BCS, of 4 to 6 on a scale of 1 to 9, and adequate anatomical conformation evaluated by pelvic and genital (normal measurements. Heifers were synchronized using estradiol benzoate (EB, Celosil® (PGF2α (Shering-Plough and a controlled internal drug release (CIDR device was inserted that contained progesterone. Inseminations were performed in two groups at random, 50 animals per group. The control group was inseminated with conventional semen. The treatment group was inseminated with semen containing rFAA (25 µg/mL and rTIMP-2 (25 µg/mL. In the control group a 16% pregnancy rate was obtained versus a 40% pregnancy rate for the HBP treatment group, resulting in a significant difference (P = 0.0037. Given the results herein, one may conclude that the HBPs can increase fertility and could be an option for cattle in tropical conditions; however, one needs to consider the environment, nutrition, and the genetic interaction affecting the final result in whatever reproductive program that is implemented.

Social behaviour of cattle in tropical silvopastoral and monoculture systems.

Science.gov (United States)

Améndola, L; Solorio, F J; Ku-Vera, J C; Améndola-Massiotti, R D; Zarza, H; Galindo, F

2016-05-01

Silvopastoral systems can be a good alternative for sustainable livestock production because they can provide ecosystem services and improve animal welfare. Most farm animals live in groups and the social organization and interactions between individuals have an impact on their welfare. Therefore, the objective of this study was to describe and compare the social behaviour of cattle (Bos indicus×Bos taurus) in a silvopastoral system based on a high density of leucaena (Leucaena leucocephala) combined with guinea grass (Megathyrsus maximus), star grass (Cynodon nlemfuensis) and some trees; with a monoculture system with C. nlemfuensis, in the region of Merida, Yucatán. Eight heifers in each system were observed from 0730 to 1530 h each day for 12 consecutive days during the dry season and 12 consecutive days during the rainy season. The animals followed a rotation between three paddocks, remaining 4 days in each paddock. The vegetation was characterized in the paddocks of the silvopastoral system to estimate the average percentage of shade provided. To make a comparison between systems, we used a t test with group dispersion, and Mann-Whitney tests with the frequency of affiliative and agonistic behaviours. We assessed differences in linearity and stability of dominance hierarchies using Landau's index and Dietz R-test, respectively. The distance of cows with respect to the centroid of the group was shorter, and non-agonistic behaviours were 62% more frequent in the intensive silvopastoral system than in the monoculture one. Heifers in the silvopastoral system had a more linear and non-random dominance hierarchy in both seasons (dry season: h'=0.964; rainy season: h'=0.988), than heifers in the monoculture system (dry season: h'=0.571, rainy season: h'=0.536). The dominance hierarchy in the silvopastoral system was more stable between seasons (R-test=0.779) than in the monoculture system (R-test=0.224). Our results provide the first evidence that heifers in the

Ratio of total-to-selective extinction in the Taurus dark cloud complex

International Nuclear Information System (INIS)

Vrba, F.J.; Rydgren, A.E.; Space Telescope Science Institute, Baltimore, MD)

1985-01-01

UBVRI and JHK photometry, as well as spectral classifications are presented for seven reddened early-type field stars that are observed through the Taurus dark cloud complex. The ratio of total-to-selective extinction is derived for each star by the color-difference method. For six stars with absolute magnitudes in violet of more than 1.7 and less than 3.2 mag, a normal ratio R of total-to-selective extinction of about 3.1 is found. The mildly anomalous R value of about 3.5 for the well-studied star HD 29647 was also confirmed. The results provide further evidence that the interstellar extinction law in the Taurus dark cloud complex is basically normal for lines of sight with absolute magnitudes in violet of less than 3 mag. 24 references

Comparative "in vitro" evaluation of the antiresorptive activity residing in four Ayurvedic medicinal plants. Hemidesmus indicus emerges for its potential in the treatment of bone loss diseases.

Science.gov (United States)

Di Pompo, Gemma; Poli, Ferruccio; Mandrone, Manuela; Lorenzi, Beatrice; Roncuzzi, Laura; Baldini, Nicola; Granchi, Donatella

2014-06-11

Four Indian plants, traditionally used in Ayurvedic medicine: Asparagus racemosus Willd., Emblica officinalis Gaertn., Hemidesmus indicus R. Br., and Rubia cordifolia L. were selected on the basis of their ethnobotanical use and of scientific evidence that suggests a potential efficacy in the treatment of bone-loss diseases. The antiresorptive properties of the four plants have been investigated. The aim was to provide adequate evidence for the exploitation of natural compounds as alternative therapeutics for the treatment of diseases caused by increased osteoclast activity. Decoctions were prepared from dried plant material according to the traditional procedure and standardization by HPLC was performed using marker compounds for each species. Total polyphenols, flavonoids and radical scavenging activity of the decoctions were also determined. The bioactivity of the plant decoctions was evaluated in subsequent phases. (1) A cytotoxicity screening was performed on the mouse monocytic RAW 264.7 cell line to define the concentrations that could be utilized in the following step. (2) The antiresorptive properties of plant decoctions were compared with that of a "gold standard" drug (alendronate) by measuring osteoclastogenesis inhibition and osteoclast apoptosis. (3) The toxic effect on bone forming cells was excluded by evaluating the impact on the proliferation of osteogenic precursors (mesenchymal stem cells, MSC). All the decoctions inhibited osteoclastogenesis similarly to alendronate at the highest doses, but Hemidesmus indicus and Rubia cordifolia were also effective at lower concentrations. Apoptosis increased significantly when cells were exposed to the highest concentration of Emblica officinalis, Hemidesmus indicus, and Rubia cordifolia. All concentrations of Emblica officinalis tested inhibited the proliferation of osteogenic precursors, while only the highest doses of Asparagus racemosus and Rubia cordifolia were toxic. On the contrary, Hemidesmus indicus

The infestation by an exotic ambrosia beetle, Euplatypus parallelus (F. (Coleoptera: Curculionidae: Platypodinae of Angsana trees (Pterocarpus indicus Willd. in southern Thailand

Directory of Open Access Journals (Sweden)

Sara Bumrungsri

2008-07-01

Full Text Available An exotic ambrosia beetle, Euplatypus parallelus (F. was collected from infested Pterocarpus indicus Willd. trees in Prince of Songkla University. Larvae and eggs were found in simple galleries with a single branch. Either a single male or a male and a female were found in each gallery. Half of these infested trees were previously attacked by long-horned beetles probably Aristobia horridula (Hope (Coleoptera: Cerambycidae, while some of them appeared to be healthy. Fusarium oxysporum Schlecht.:Fr. was isolated from frass, sapwood samples and insect larvae, and might be a cause of death of P.indicus.

Studies on the growth of penaeid prawns: 2. Growth of @iPenaeus indicus@@ under different levels of feeding

Digital Repository Service at National Institute of Oceanography (India)

Nair, S.R.S.; Iyer, H.K.; Balasubramanian, T.; Kutty, M.K.

@iPenaeus indicus@@ was subjected to four different levels of feeding with live earthworm. The growth increments irrespective of the feeding levels did not show any decreasing trend throughout the experimental period. This is probably because...

Hubungan Kekerabatan Sapi Aceh dengan Menggunakan Daerah Displacement-loop

Directory of Open Access Journals (Sweden)

Mohd. Agus Nashri Abdullah

2008-10-01

Full Text Available Relationship of aceh cattle using displacement-loop region ABSTRACT. The aims of this study were to describe relationship of D-loop of mtDNA Aceh cattle which is useful database for conducting conservation programme. The whole blood samples were collected (8 samples for D-loop analysis from four locations which were Aceh Besar, Pidie, North Aceh regencies and Banda Aceh city. Out group whole blood samples were collected from two samples from Bali cattles (Bali Island, Madura cattle (Madura Island, Pesisir cattle (West Sumatera respectively and one sample from PO cattle (West Java. Amplification of D-loop sequences of mtDNA with BIDLF and BIDLR primary have PCR product 980 bp. The Data were analyzed using Squint 1.02 and MEGA 4.0 programme. Result of analysis indicate that Aceh cattle have nearer relationship with zebu and there is items inset of genetik Bali cattle (Bos javanicus at the end sequences start ke-354 situs up to 483, so that the origin Aceh cattle was from Bos indicus which have hybridization with Bos javanicus.

Implementasi Kebijakan Pembiayaan Pendidikan pada Era Otonomi Daerah (Studi Kasus Implementasi Dana BOS dan BKM Pada Sekolah yang Terpilih di Kabupaten Kebumen

Directory of Open Access Journals (Sweden)

Panuntun Nur Karomah

2017-08-01

Full Text Available Tujuan Penelitian ini untuk mengetahui implementasi kebijakan pembiayaan pendidikan pada era otonomi daerah studi di Kabupaten Kebumen dilihat dari aspek pelaksanaan, sumber-sumber dan alokasi anggaran pendidikan. Teknik pengumpulan data yaitu observasi, wawancara, dan dokumentasi. Uji keabsahan data adalah triangulasi. Hasil penelitian ini adalah pelaksanaan BOS diimplementasikan berdasarkan RAKS dan RAPBS, dan BKM berdasarkan penjaringan dari pihak sekolah. Dana BOS bersumber dari APBN (pemerintah pusat, BKM bersumber dari APBD Kabupaten (pemerintah daerah dan sumbangan sukarela bersumber dari masyarakat. Alokasi dana BOS setiap sekolah berbeda-beda, yang mempengaruhi hal itu adalah perbedaan jenjang sekolah, banyaknya jumlah siswa yang ada di sekolah, perbedaan letak sekolah. Hal ini, karena setiap sekolah mempunyai perbedaan kebutuhan operasional sekolah dan kegiatan-kegiatan yang dilakukan sekolah. Sumbangan sukarela untuk memenuhi kekurangan biaya yang diperlukan sekolah. Alokasi dana BKM tepat sasaran, namun waktu alokasi pencairannya kurang efektif .  This research aims to determine the education funding policy implementation at the regional autonomy in Kebumen, seen from the aspect implementation, resources and the education budget allocation for education. Data collection techniques are observation, interviews, and documentation. Test the validity of the data is triangulation. The results of this study are the implementation of BOS based RAKS and RAPBS, and BKM based networking from the school. BOS funds from the state budget (central government, BKM sourced from district budget (local government and voluntary contributions provided by the community. BOS funding is in each school different, the casue of difference in levels of schooling, the amount of students in the school, the school location. This is because each school has different operational needs and the activities. Voluntary donations for meet defiency from BOS. Allocation of

Seroprevalence of antibodies to Neospora caninum in Bos javanicus ('Bali cattle') from Indonesia.

Science.gov (United States)

Damriyasa, I Made; Schares, Gereon; Bauer, Christian

2010-01-01

A cross-sectional survey was performed to obtain first information on the presence of Neospora caninum infection in Bos javanicus ('Bali cattle'), the predominant beef cattle in the Eastern Islands of Indonesia. Serum samples were collected from 438 Bali cattle of two age classes (2 years) and both genders at three slaughterhouses in the Bali island, and examined for N. caninum-specific antibodies using native NcSRS2 (p38 antigen) as an ELISA antigen. The estimated overall seroprevalence of antibodies was 5.5% (95% CI: 3.5-8.0%). The seroprevalence was not significantly associated with age class or gender of the animals. The results give first serological evidence for the presence of natural N. caninum infection in Bos javanicus and indicate its occurrence in Indonesia.

Pesquisa de anticorpos contra Leptospira spp. em animais silvestres e em estado feral da região de Nhecolândia, Mato Grosso do Sul, Brasil: utilização da técnica de imuno-histoquímica para detecção do agente Investigation of antibodies to Leptospira spp. in wild and feral animals from the region of Nhecolândia, Mato Grosso do Sul, Brazil: use of the immunohistochemistry technique for the agent detection

Directory of Open Access Journals (Sweden)

Raul José Silva Girio

2004-02-01

Full Text Available Foram examinadas 315 amostras de soros sangüíneos de diversas espécies de animais que vivem em estado feral ou silvestre na região de Nhecolândia, Corumbá, MS, por meio da prova de soroaglutinação microscópica para leptospirose. Dessas amostras, 67 foram de bois baguás (Bos taurus indicus, 39 de porcos-monteiros (Sus scrofa, 39 de búfalos (Bubalus bubalis, nove de quatis (Nasua nasua, 41 de veados-campeiros (Ozotoceros bezoarticus, 10 de veados-mateiros (Mazama americana e 110 amostras de ovinos (Ovis aries. Em 12 animais que vieram a óbito, seis porcos-monteiros, quatro veados-campeiros e dois ovinos, foram realizadas tentativas de isolamento de Leptospira do fígado e dos rins por cultura em meio semi-sólido. Fragmentos desses órgãos foram submetidos a exame histopatológico e também a exame para detecção das Leptospiras pela técnica de imuno-histoquímica. Os resultados dos exames sorológicos mostraram que 64 (20,3% das amostras foram reagentes para, pelo menos, um sorovar de Leptospira patogênica; foram reagentes 41,0% das amostras de búfalos, 40,3% das de bois baguás, 17,9% das de porcos-monteiros, 9% das de ovinos e 9,7% das amostras de veados-campeiros; nenhuma das amostras de veados-mateiros e de quatis foi reagente. Os sorovares mais freqüentes foram: pomona, para búfalos e ovinos; icterohaemorrhagiae, para ovinos, veados-campeiros e suínos; e copenhageni, para veados-campeiros e suínos. As tentativas de isolamento dos rins e fígados foram todas negativas, e pela técnica da imuno-histoquímica foi detectada Leptospira no fígado de um porco-monteiro. As principais alterações estruturais, encontradas nos rins de dois veados-campeiros e de um porco-monteiro, foram infiltrado inflamatório intersticial com congestão associada a hemorragias.Three hundred and fifteen serum samples of several animal species living in wild or in feral state in the area of Nhecolândia, Corumbá, MS, Brazil, were examined by the

Length-weight relation and condition factor of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@ in the Cochin Backwater

Digital Repository Service at National Institute of Oceanography (India)

Devi, C.B.L.; Nair, K.K.C.; Balasubramanian, T.; Gopalakrishnan, T.C.; Aravindakshan, P.N.; Kutty, M.K.

Length-weight relation and condition factor of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@ were estimated using samples from Cochin backwater. Statistical tests support the view that the length-weight exponent of these species may be species...

The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation

Science.gov (United States)

Plesniak, A.; Garboushian, V.

2012-10-01

In 2011, the Amonix Advanced Technology Group was awarded DOE SunShot funding in the amount of 4.5M to design a new Balance of System (BOS) architecture utilizing Amonix MegaModules™ focused on reaching the SunShot goal of 0.06-$0.08/kWhr LCOE. The project proposal presented a comprehensive re-evaluation of the cost components of a utility scale CPV plant and identified critical areas of focus where innovation is needed to achieve cost reduction. As the world's premier manufacturer and most experienced installer of CPV power plants, Amonix is uniquely qualified to lead a rethinking of BOS architecture for CPV. The presentation will focus on the structure of the BOS-X approach, which looks for the next wave of cost reduction in CPV through evaluation of non-module subsystems and the interaction between subsystems during the lifecycle of a solar power plant. Innovation around nonmodule components is minimal to date because CPV companies are just now getting enough practice through completion of large projects to create ideas and tests on how to improve baseline designs and processes. As CPV companies increase their installed capacity, they can utilize an approach similar to the methodology of BOS-X to increase the competitiveness of their product. Through partnership with DOE, this holistic approach is expected to define a path for CPV well aligned with the goals of the SunShot Initiative.

Genetic variation in the β-lactoglobulin of Chinese yak ( Bos ...

Indian Academy of Sciences (India)

Yak (Bos grunniens) is distributed in the area of Central. Asian highlands, it thrives in conditions of extreme harsh- ness with severely cold winters, short growing seasons for herbage and no absolutely frost-free periods (Wiener et al. 2003). The total population of yak is estimated to be 14 mil- lion, about 90% of the domestic ...

The temporal behaviour of Taurus X-1 (the Crab Nebula)

International Nuclear Information System (INIS)

Davison, P.J.N.

1975-01-01

Copernicus data on Taurus X-1 and the Crab pulsar extending over a 2 1/2-yr period indicate that under normal conditions the source has a flux that is constant to within 2.5 per cent at the 90 per cent confidence level. The pulsed/total flux ratio also shows no significant changes during the same time. (author)

Mosquitocidal and water purification properties of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus leaf extracts.

Science.gov (United States)

Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for toxicity to 3rd instar Anopheles stephensi, Culex quinquefasciatus, and Aedes aegypti. Median lethal concentrations (LC50) were, respectively, 0.44%, 0.51%, 0.59% and 0.68%. Cynodon dactylon...

Studies on the growth of penaeid prawns. 3. Growth pattern of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@

Digital Repository Service at National Institute of Oceanography (India)

Nair, S.R; Nair, K.K.C.; Gopalakrishnan, T.C.; Kutty, M.K.

Experimental studies on the growth of @iPenaeus indicus@@ and @iMetapenaeus dobsoni@@ for three and a half months under different levels of feeding gave a growth pattern different from that of von Bertalanffy. The two distinct growth patterns...

Characterization of the bovine type I IFN locus: rearrangements, expansions, and novel subfamilies

Directory of Open Access Journals (Sweden)

Walker Angela M

2009-04-01

Full Text Available Abstract Background The Type I interferons (IFN have major roles in the innate immune response to viruses, a function that is believed to have led to expansion in the number and complexity of their genes, although these genes have remained confined to single chromosomal region in all mammals so far examined. IFNB and IFNE define the limits of the locus, with all other Type I IFN genes except IFNK distributed between these boundaries, strongly suggesting that the locus has broadened as IFN genes duplicated and then evolved into a series of distinct families. Results The Type I IFN locus in Bos taurus has undergone significant rearrangement and expansion compared to mouse and human, however, with the constituent genes separated into two sub-loci separated by >700 kb. The IFNW family is greatly expanded, comprising 24 potentially functional genes and at least 8 pseudogenes. The IFNB (n = 6, represented in human and mouse by one copy, are also present as multiple copies in Bos taurus. The IFNT, which encode a non-virally inducible, ruminant-specific IFN secreted by the pre-implantation conceptus, are represented by three genes and two pseudogenes. The latter have sequences intermediate between IFNT and IFNW. A new Type I IFN family (IFNX of four members, one of which is a pseudogene, appears to have diverged from the IFNA lineage at least 83 million years ago, but is absent in all other sequenced genomes with the possible exception of the horse, a non-ruminant herbivore. Conclusion In summary, we have provided the first comprehensive annotation of the Type I IFN locus in Bos taurus, thereby providing an insight into the functional evolution of the Type I IFN in ruminants. The diversity and global spread of the ruminant species may have required an expansion of the Type I IFN locus and its constituent genes to provide broad anti-viral protection required for foraging and foregut fermentation.

Detection of warm water vapour in Taurus protoplanetary discs by Herschel

NARCIS (Netherlands)

Riviere-Marichalar, P.; Menard, F.; Thi, W. F.; Kamp, I.; Montesinos, B.; Meeus, G.; Woitke, P.; Howard, C.; Sandell, G.; Podio, L.; Dent, W. R. F.; Mendigutia, I.; Pinte, C.; White, G. J.; Barrado, D.

Line spectra of 68 Taurus T Tauri stars were obtained with the Herschel-PACS (Photodetector Array Camera and Spectrometer) instrument as part of the GASPS (GAS evolution in Protoplanetary Systems) survey of protoplanetary discs. A careful examination of the linescans centred on the [OI] 63.18 mu m

THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

Energy Technology Data Exchange (ETDEWEB)

Dzib, Sergio A. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México Apartado Postal 3-72, 58090 Morelia, Michoacán (Mexico); Mioduszewski, Amy J. [National Radio Astronomy Observatory, Domenici Science Operations Center, 1003 Lopezville Road, Socorro, NM 87801 (United States); Kounkel, Marina A.; Hartmann, Lee [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48105 (United States); Torres, Rosa M. [Instituto de Astronomía y Meteorología, Universidad de Guadalajara, Avenida Vallarta No. 2602, Col. Arcos Vallarta, CP 44130 Guadalajara, Jalisco, México (Mexico); Boden, Andrew F. [Division of Physics, Math, and Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Evans II, Neal J. [Department of Astronomy, The University of Texas at Austin, 1 University Station, C1400, Austin, TX 78712 (United States); Briceño, Cesar [Cerro Tololo Interamerican Observatory, Casilla 603, La Serena (Chile); Tobin, John, E-mail: sdzib@mpifr-bonn.mpg.de [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands)

2015-03-10

We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature.

THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

International Nuclear Information System (INIS)

Dzib, Sergio A.; Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L.; Mioduszewski, Amy J.; Kounkel, Marina A.; Hartmann, Lee; Torres, Rosa M.; Boden, Andrew F.; Evans II, Neal J.; Briceño, Cesar; Tobin, John

2015-01-01

We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature

Absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at seven wavelengths in the 1.8-4.2 cm band

International Nuclear Information System (INIS)

Dmitrenko, L.V.; Snegireva, V.V.; Turchin, V.I.; Tsejtlin, N.M.; Voronkov, L.A.; Dmitrenko, D.A.; Kuznetsova, N.A.; Kholodilov, N.N.

1981-01-01

Results of absolute measurements of fluxes from Cassiopeia A, Cygnus A, Taurus A, Virgo A at 1.8-4.17 cm wavelengths are presented. Spectra are built in the wave range of 1.8-100 cm with the use of results obtained earlier. Variability has been detected in radiation of Taurus A as well as ''steps'' in the spectrum of Taurus A with the spectral index α=0 in the region of 2 cm and 3-4 cm [ru

cDNA cloning, characterization and expression analysis of a novel antimicrobial peptide gene penaeidin-3 (Fi-Pen3) from the haemocytes of Indian white shrimp Fenneropenaeus indicus.

Science.gov (United States)

Shanthi, S; Vaseeharan, B

2012-03-20

A new member of antimicrobial peptide genes of the penaeidin family, penaeidin 3, was cloned from the haemocytes of Indian white shrimp Fenneropeneaus indicus (F. indicus), by reverse transcription PCR (RT-PCR) and rapid amplification of cDNA end (RACE-PCR) methods. The complete nucleotide sequence of cDNA clone of Indian white shrimp F. indicus Penaeidin 3 (Fi-Pen3) was 243bp long and has an open reading frame which encodes 80 amino acid peptide. The homology analysis of Fi-Pen3 sequence with other Penaeidins 3 shows higher similarity with Penaeus monodon (92%). The theoretical 3D structure generated through ab initio modelling indicated the presence of two-disulphide bridges in the alpha-helix. The signal peptide sequence of Fi-Pen3 is almost entirely homologous to that of other Penaeidin 3 of crustaceans, while differing relatively in the N-terminal domain of the mature peptide. The mature peptide has a predicted molecular weight of 84.9kDa, and a theoretical pI of 9.38. Phylogenetic analysis of Fi-Pen3 shows high resemblance with other Pen-3 from P. monodon, Litopenaeus stylirostris, Litopenaeus vannamei and Litopenaeus setiferus. Fi-Pen3 found to be expressed in haemocytes, heart, hepatopancreas, muscles, gills, intestine, and eyestalk with higher expression in haemocytes. Microbial challenge resulted in mRNA up-regulation, up to 6h post injection of Vibrio parahemolyticus. The Fi-Pen3 mRNA expression of F. indicus in the premolt stage (D(01) and D(02)) was significantly up-regulated than the postmolt (A and B) and intermolt stages (C). The findings of the present paper underline the involvement of Fi-Pen3 in innate immune system of F. indicus. Copyright © 2011 Elsevier GmbH. All rights reserved.

A breeding site record of Long-billed Vulture Gyps indicus (Aves: Accipitriformes: Accipitridae from Bejjur Reserve Forest, Telangana, India

Directory of Open Access Journals (Sweden)

Swetha Stotrabhashyam

2015-01-01

Full Text Available The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India.  We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.

Development of Uncertainty Quantification Method for MIR-PIV Measurement using BOS Technique

International Nuclear Information System (INIS)

Seong, Jee Hyun; Song, Min Seop; Kim, Eung Soo

2014-01-01

Matching Index of Refraction (MIR) is frequently used for obtaining high quality PIV measurement data. ven small distortion by unmatched refraction index of test section can result in uncertainty problems. In this context, it is desirable to construct new concept for checking errors of MIR and following uncertainty of PIV measurement. This paper proposes a couple of experimental concept and relative results. This study developed an MIR uncertainty quantification method for PIV measurement using SBOS technique. From the reference data of the BOS, the reliable SBOS experiment procedure was constructed. Then with the combination of SBOS technique with MIR-PIV technique, velocity vector and refraction displacement vector field was measured simultaneously. MIR errors are calculated through mathematical equation, in which PIV and SBOS data are put. These errors are also verified by another BOS experiment. Finally, with the applying of calculated MIR-PIV uncertainty, correct velocity vector field can be obtained regardless of MIR errors

Mitochondrial haplotypes influence metabolic traits across bovine inter- and intra-species cybrids

OpenAIRE

Wang, Jikun; Xiang, Hai; Liu, Langqing; Kong, Minghua; Yin, Tao; Zhao, Xingbo

2017-01-01

In bovine species, mitochondrial DNA polymorphisms and their correlation to productive or reproductive performances have been widely reported across breeds and individuals. However, experimental evidence of this correlation has never been provided. In order to identify differences among bovine mtDNA haplotypes, transmitochondrial cybrids were generated, with the nucleus from MAC-T cell line, derived from a Holstein dairy cow (Bos taurus) and mitochondria from either primary cell line derived ...

Dicty_cDB: VHI692 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) Pongo abelii mRNA; cDNA DKFZp469L1... 53 4e-06 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid... oxidas... 53 4e-06 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic acid o... AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 53 4e-06 AX882278_1( AX882278 |pid:none) Sequence

Dicty_cDB: VHN758 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available t EP10746... 76 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid... CR457155_1( CR457155 |pid:none) Homo sapiens full open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipeco...lic acid oxid... 76 1e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from Paten

A CENSUS OF ROTATION AND VARIABILITY IN L1495: A UNIFORM ANALYSIS OF TRANS-ATLANTIC EXOPLANET SURVEY LIGHT CURVES FOR PRE-MAIN-SEQUENCE STARS IN TAURUS

International Nuclear Information System (INIS)

Xiao Hongyu; Covey, Kevin R.; Lloyd, James P.; Rebull, Luisa; Charbonneau, David; Mandushev, Georgi; O'Donovan, Francis; Slesnick, Catherine

2012-01-01

We analyze light curves obtained by the Trans-atlantic Exoplanet Survey (TrES) for a field centered on the L1495 dark cloud in Taurus. The Spitzer Taurus Legacy Survey catalog identifies 179 bona fide Taurus members within the TrES field; 48 of the known Taurus members are detected by TrES, as well as 26 candidate members identified by the Spitzer Legacy team. We quantify the variability of each star in our sample using the ratio of the standard deviation of the original light curve (σ orig. ) to the standard deviation of a light curve that has been smoothed by 9 or 1001 epochs (σ 9 and σ 1001 , respectively). Known Taurus members typically demonstrate (σ orig. /σ 9 ) orig. /σ 1001 ) orig. /σ 9 ) ∼ 3.0 and (σ orig. /σ 1001 ) ∼ 10, as expected for light curves dominated by unstructured white noise. Of the 74 Taurus members/candidates with TrES light curves, we detect significant variability in 49 sources. Adapting a quantitative metric originally developed to assess the reliability of transit detections, we measure the amount of red and white noise in each light curve and identify 18 known or candidate Taurus members with highly significant period measurements. These appear to be the first periods measured for four of these sources (HD 282276, CX Tau, FP Tau, TrES J042423+265008), and in two other cases, the first non-aliased periods (LkCa 21 and DK Tau AB). For the remainder, the TrES measurements typically agree very well (δP < 1%) with previously reported values. Including periods measured at lower confidence for 15 additional sources, we report periods for 11 objects where no previous periods were found, including 8 confirmed Taurus members. We also identify 10 of the 26 candidate Taurus members that demonstrate variability levels consistent with being bona fide T Tauri stars. A Kolomgorov-Smirnov (K-S) test confirms that these new periods confirm the distinction between the rotation period distributions of stars with and without circumstellar

Interstellar extinction in the Taurus dark clouds

International Nuclear Information System (INIS)

Meistas, E.; Straizys, V.

1981-01-01

The results of photoelectric photometry of 89 stars in the Vilnius seven-color system in the area of the Taurus dark clouds with corrdinates (1950) 4sup(h)16sup(m)-4sup(h)33sup(m), +16 0 -+20 0 are presented. Photometric spectral types, absolute magnitude, color excesses, interstellar extinctions and distances of the stars are determined. The distance of the dark nebula is found to be 140 pc and is in a good agreement with the distance determined for the dark nebula Khavtassi 286, 278. The average extinction Asub(v) in the investigated area is of the order of 1.4. (author)

Anomalous strength of the 2200 Angstroem feature in Cassiopeia-Taurus association

International Nuclear Information System (INIS)

Morales, C.; Ruiz del Arbol, J.A.; Llorente de Andres, F.

1980-01-01

From a large sample of reddened stars we computed the individual extinction curves which agree with that calculated by Nandy et al. (1976), except for four stars which show that the extinction at the 2200 Angstroem feature is greater than that deduced for the rest of stars. These four stars belong to the Cassiopeia-Taurus association. (orig.)

Effects of energy supplementation on productivity of dual-purpose cows grazing in a silvopastoral system in the tropics.

Science.gov (United States)

Tinoco-Magaña, Juan Carlos; Aguilar-Pérez, Carlos Fernando; Delgado-León, Roger; Magaña-Monforte, Juan Gabriel; Ku-Vera, Juan Carlos; Herrera-Camacho, Jose

2012-06-01

The aim of the present work was to evaluate milk yield, postpartum (pp) ovarian activity and pregnancy rate in dual-purpose cows grazing Cynodon nlemfuensis and browsing L. leucocephala, with or without energy supplementation. Twenty-four Bos taurus × B. indicus cows were divided in two groups from calving to 70 days post-calving: supplemented group (SG) with ground sorghum grain offered at 0.4% of live weight at calving and control group (CG) without supplement. There was a trend for milk yield (kg day(-1)) to be greater (p = 0.08) for SG (10.55 ± 0.51) compared to CG (9.53 ± 0.61), although without differences in fat (0.42 ± 0.02 vs. 0.38 ± 0.03 kg day(-1)), protein (0.29 ± 0.02 vs. 0.29 ± 0.02 kg day(-1)) or lactose (0.49 ± 0.02 vs. 0.49 ± 0.03 kg day(-1)) concentration. Populations of large, medium and small follicles were similar between treatments. Percentage of cows which showed corpus luteum tended to be greater in SG (50%), compared to CG (33%). Supplemented cows tended to have a shorter calving-first corpus luteum interval (40 ± 10 vs. 51 ± 10 days) and had a significantly higher (χ (2) = 0.03) pregnancy rate (42% vs. 0%). It is concluded that energy supplementation helped to improve ovarian activity and pregnancy rate. Since supplementation did not avoid loss of body condition, the higher pregnancy rate in SG suggests beneficial effects of supplementation probably mediated by metabolic hormones.

THE RELATION BETWEEN GAS AND DUST IN THE TAURUS MOLECULAR CLOUD

International Nuclear Information System (INIS)

Pineda, Jorge L.; Goldsmith, Paul F.; Chapman, Nicholas; Li Di; Snell, Ronald L.; Cambresy, Laurent; Brunt, Chris

2010-01-01

We report a study of the relation between dust and gas over a 100 deg 2 area in the Taurus molecular cloud. We compare the H 2 column density derived from dust extinction with the CO column density derived from the 12 CO and 13 CO J = 1 → 0 lines. We derive the visual extinction from reddening determined from 2MASS data. The comparison is done at an angular size of 200'' corresponding to 0.14 pc at a distance of 140 pc. We find that the relation between visual extinction A V and N(CO) is linear between A V ≅ 3 and 10 mag in the region associated with the B213-L1495 filament. In other regions, the linear relation is flattened for A V ∼> 4 mag. We find that the presence of temperature gradients in the molecular gas affects the determination of N(CO) by ∼30%-70% with the largest difference occurring at large column densities. Adding a correction for this effect and accounting for the observed relation between the column density of CO and CO 2 ices and A V , we find a linear relationship between the column of carbon monoxide and dust for observed visual extinctions up to the maximum value in our data ≅23 mag. We have used these data to study a sample of dense cores in Taurus. Fitting an analytical column density profile to these cores we derive an average volume density of about 1.4 x 10 4 cm -3 and a CO depletion age of about 4.2 x 10 5 yr. At visual extinctions smaller than ∼3 mag, we find that the CO fractional abundance is reduced by up to two orders of magnitude. The data show a large scatter suggesting a range of physical conditions of the gas. We estimate the H 2 mass of Taurus to be about 1.5 x 10 4 M sun , independently derived from the A V and N(CO) maps. We derive a CO integrated intensity to H 2 conversion factor of about 2.1 x 10 20 cm -2 (K km s -1 ) -1 , which applies even in the region where the [CO]/[H 2 ] ratio is reduced by up to two orders of magnitude. The distribution of column densities in our Taurus maps resembles a log

The use of hormonal treatments to improve reproductive performance of anestrous beef cattle in tropical climates.

Science.gov (United States)

Baruselli, P S; Reis, E L; Marques, M O; Nasser, L F; Bó, G A

2004-07-01

Most of the world's bovine herd is found in tropical regions. Bos indicus predominates, due to their adaptation to the climate and management conditions. Anestrous is the main factor that negatively affects reproductive performance of animals bred in these regions of the globe. Several factors affect postpartum anestrous, including suckling and maternal-offspring bond, and pre- and postpartum nutritional status. The short duration of estrus and the tendency to show estrus during the night, greatly affect the efficiency of artificial insemination (AI) programs in B. indicus cattle managed in tropical areas. Several restricted suckling or weaning procedures (temporary or permanent), and hormonal treatments have been used to induce ovulation and cyclicity in postpartum cows. Most hormonal treatments are based on progesterone/progestogen (P4) releasing devices associated with estradiol benzoate (EB), or a combination of GnRH/PGF(2alpha)/GnRH (Ovsynch). Treatments with GnRH/PGF(2alpha)/GnRH has presented inconsistent results, probably due to the variable number of cows in anestrous. Treatments using P4 devices and EB have resulted in apparently more consistent results than Ovsynch programs in B. indicus cattle; however, pregnancy rates are low in herds presenting high anestrous rates and moderate to low body condition. The addition of an eCG treatment at the time of device removal, which increased plasma progesterone concentrations and pregnancy rates in anestrous postpartum suckled B. indicus cows, may be useful to improve reproductive performance of beef cattle in tropical climates.

Influence of Type of Electric Bright Light on the Attraction of the African Giant Water Bug, Lethocerus indicus (Hemiptera: Belostomatidae

Directory of Open Access Journals (Sweden)

Luke Chinaru Nwosu

2012-01-01

Full Text Available This study investigated the influence of type of electric bright light (produced by fluorescent light tube and incandescent light bulb on the attraction of the African giant water bug, Lethocerus indicus (Hemiptera: Belostomatidae. Four fluorescent light tubes of 15 watts each, producing white-coloured light and four incandescent light bulbs of 60 watts each, producing yellow-coloured light, but both producing the same amount of light, were varied and used for the experiments. Collections of bugs at experimental house were done at night between the hours of 8.30 pm and 12 mid-night on daily basis for a period of four months per experiment in the years 2008 and 2009. Lethocerus indicus whose presence in any environment has certain implications was the predominant belostomatid bug in the area. Use of incandescent light bulbs in 2009 significantly attracted more Lethocerus indicus 103 (74.6% than use of fluorescent light tubes 35 (25.41% in 2008 [4.92=0.0001]. However, bug’s attraction to light source was not found sex dependent [>0.05; (>0.18=0.4286 and >0.28=0.3897]. Therefore, this study recommends the use of fluorescent light by households, campgrounds, and other recreational centres that are potentially exposed to the nuisance of the giant water bugs. Otherwise, incandescent light bulbs should be used when it is desired to attract the presence of these aquatic bugs either for food or scientific studies.

The Pan-STARRS1 Proper-motion Survey for Young Brown Dwarfs in Nearby Star-forming Regions. I. Taurus Discoveries and a Reddening-free Classification Method for Ultracool Dwarfs

Science.gov (United States)

Zhang, Zhoujian; Liu, Michael C.; Best, William M. J.; Magnier, Eugene A.; Aller, Kimberly M.; Chambers, K. C.; Draper, P. W.; Flewelling, H.; Hodapp, K. W.; Kaiser, N.; Kudritzki, R.-P.; Metcalfe, N.; Wainscoat, R. J.; Waters, C.

2018-05-01

We are conducting a proper-motion survey for young brown dwarfs in the Taurus-Auriga molecular cloud based on the Pan-STARRS1 3π Survey. Our search uses multi-band photometry and astrometry to select candidates, and is wider (370 deg2) and deeper (down to ≈3 M Jup) than previous searches. We present here our search methods and spectroscopic follow-up of our high-priority candidates. Since extinction complicates spectral classification, we have developed a new approach using low-resolution (R ≈ 100) near-infrared spectra to quantify reddening-free spectral types, extinctions, and gravity classifications for mid-M to late-L ultracool dwarfs (≲100–3 M Jup in Taurus). We have discovered 25 low-gravity (VL-G) and the first 11 intermediate-gravity (INT-G) substellar (M6–L1) members of Taurus, constituting the largest single increase of Taurus brown dwarfs to date. We have also discovered 1 new Pleiades member and 13 new members of the Perseus OB2 association, including a candidate very wide separation (58 kau) binary. We homogeneously reclassify the spectral types and extinctions of all previously known Taurus brown dwarfs. Altogether our discoveries have thus far increased the substellar census in Taurus by ≈40% and added three more L-type members (≲5–10 M Jup). Most notably, our discoveries reveal an older (>10 Myr) low-mass population in Taurus, in accord with recent studies of the higher-mass stellar members. The mass function appears to differ between the younger and older Taurus populations, possibly due to incompleteness of the older stellar members or different star formation processes.

EFEITO DO PROBIÓTICO PROENZIME® NO PESO DE BOVINOS DA RAÇA NELORE CRIADOS EM REGIME DE PASTO

Directory of Open Access Journals (Sweden)

Felipe Mandelli Terrassi

2010-12-01

Full Text Available This study evaluated the effect of probiotic Proenzime ®, added to the mineral salt, the weight of cattle kept on pasture. We used 30 animals, males Nelore (Bos indicus at approximately 10 months of age in Panicum maximum supplemented with mineral salt (CG, n = 15 animals and mineral salt added probiotic (GT = 4 g probiotic / day, n = 15 animals. The animals of the TG were linear and significant increase (P <0.01 in weight over the GC. Therefore, adding probiotic, mineral salt increases the weight in Nelore cattle raised on pasture.

(Re)Considering cattle farming in Southern Africa under a changing climate

CSIR Research Space (South Africa)

Archer van Garderen, ERM

2011-10-01

Full Text Available .g., in Dikmen et al. (2008), with their analysis of the role of the slick hair gene in thermoregulatory capacity in Holstein cows, as well as Olson et al. (2002), with their analysis of the impact of hair coat differences on heat stress tolerance]. As dis...) Comfort threshold for high-producing dairy cows (Herna?ndez et al. 2002); higher for Bos indicus breeds (which are highly adapted to heat stress) 278C Upper limit of comfort zone for maximum milk production in India, which is 28C higher than...

Comparison of nitrogen utilization and urea kinetics between yaks (Bos grunniens) and indigenous cattle (Bos taurus).

Science.gov (United States)

Zhou, J W; Zhong, C L; Liu, H; Degen, A A; Titgemeyer, E C; Ding, L M; Shang, Z H; Guo, X S; Qiu, Q; Li, Z P; Yang, G; Long, R J

2017-10-01

Under traditional management on the Qinghai-Tibetan Plateau, yaks () graze only on natural pasture without supplements and are forced to cope with sparse forage of low N content, especially in winter. In contrast, indigenous Tibetan yellow cattle () require supplements during the cold season. We hypothesized that, in response to harsh conditions, yaks cope with low N intakes better than cattle. To test this hypothesis, a study of whole-body N retention and urea kinetics was conducted in 2 concurrent 4 × 4 Latin squares, with 1 square using yaks and 1 square using cattle. Four isocaloric forage-concentrate diets differing in N concentrations (10.3, 19.5, 28.5, and 37.6 g N/kg DM) were formulated, and by design, DMI were similar between species and across diets. Urea kinetics were determined with continuous intravenous infusion of NN urea for 104 h, and total urine and feces were concomitantly collected. Urea production, urea recycling to the gut, and ruminal microbial protein synthesis all linearly increased ( Urea production was greater in yaks than in cattle at the 3 lowest N diets but greater in cattle than in yaks at the highest N diet (species × diet, Urea N recycled to the gut ( urea N captured by ruminal bacteria ( urea recycling was through saliva, with no difference between species ( = 0.61). Glomerular filtration rate was lower ( = 0.05) in yaks than in cattle. The higher urea recycling and greater capture of recycled urea by ruminal microbes in yaks than in cattle suggest that yaks use mechanisms to utilize dietary N more efficiently than cattle, which may partially explain the better survival of yaks than cattle when fed low-N diets.

BIOACTIVE PEPTIDES OF THE COW MILK WHEY PROTEINS (Bos taurus

Directory of Open Access Journals (Sweden)

A. V. Iukalo

2013-10-01

Full Text Available Data on the biological functions of milk whey proteins, which are implemented at the level of their proteolytic degradation products — bioactive peptides have been reviewed. The main functions of these proteins is to provide the amino acid nutrition of mammals in the early stages of development, as well as the transport of fatty acids, retinol, involved in the synthesis of lactose, ions of calcium and iron, immune protection, antimicrobial action, etc. However, in recent years, it has been found that milk proteins like casein are precursors of biologically active peptides. Аngiotensin — converting enzyme, opioid peptides which are opiate receptor agonists, anti–microbial peptides, peptides with immunomodulatory and hypocholesterolemic action, and peptides affecting motility have been found among the products of proteolytic degradation of ?-lactoglobulin, ?-laktoalbumin, lactoferrin and milk whey albumin. Also data on the possible participation of peptides from milk whey proteins in the implementation of the biological functions of both the assimilation of calcium, antioxidant effect, the regulation of appetite, anticarcinogenic are provided. The authors assume that the phenomenon of bioactive peptides formation could be considered as an additional function of natural food proteins, which gives advantages to the mammals and has a positive effect on their development in the postnatal period. Ways of bioactive peptides formation, their resistance to action of proteolytic enzymes, the ability to cross into the bloodstream and have biological effects have been also discussed. Up to date, only a few products with bioactive peptides from milk whey proteins are obtained. Further studies of their structure, mechanism of action, ways of formation and methods of isolation are required for their wider use. Formation of functional products based on bioactive peptides from milk whey proteins will allow efficient use of milk whey, which is often a byproduct of the dairy industry.

'Candidatus Mycoplasma haemobos': Transplacental transmission in dairy cows (Bos taurus).

Science.gov (United States)

Girotto-Soares, Aline; Soares, João Fabio; Bogado, Alexey Leon Gomel; de Macedo, César Augusto Barbosa; Sandeski, Lígia Mara; Garcia, João Luis; Vidotto, Odilon

2016-11-15

'Candidatus Mycoplasma haemobos' is a haemotropic mycoplasma that can produce various clinical signs in cattle, but abortive potential of the parasite is unknown, as well as the frequency of transplacental transmission in cattle. Thus, the objective of this work was to evaluate the frequency of detection of 'C. M. haemobos' in aborted fetuses and the blood of dairy cows. Blood samples of 22 dairy cows that aborted and pool tissues (brain, lung, heart and liver) of their respective aborted fetuses were tested by conventional PCR. The occurrence of 'C. M. haemobos' DNA in adult animals was 40.9% (9/22) and in the fetuses was 18.2% (4/22). Two fetuses that contained 'C. M. haemobos' DNA were derived from cows which were PCR negative. When stratifying by breed, it was observed that Jersey cows had a higher proportion of positive animals (8/11; 72.7%) as compared to Holstein (1/9; 11.1% P<0.01). The results of this study suggest that this parasite can be transferred via the placenta, but it is not certain if the abortions were due to 'C. M. haemobos'. Copyright © 2016 Elsevier B.V. All rights reserved.

Dicty_cDB: SSK827 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |pid:none) Xenopus laevis achalasia, adrenoco... 80 8e-14 BC067671_1( BC067671 |pid:none) Danio rerio achalasia...222509_1( AK222509 |pid:none) Homo sapiens mRNA for achalasia, a... 65 2e-09 (Q9NRG9) RecName: Full=Aladin; ... cl... 65 3e-09 BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 63 7e-09 AK087134_1( A

Dicty_cDB: VHQ356 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Streptomyces tendae strain Tue901, nik... 72 3e-11 BC158505_1( BC158505 |pid:none) Xenopus tropicalis pipecoli...5 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 56 2e-06 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic acid oxidas... 55 3e-06 protein update 2009. 7.22 PSO

Dicty_cDB: VHJ851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 67 3e-10 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 67 3e-10 CT978603_2294( CT97...|pid:none) Synthetic construct Homo sapiens c... 63 3e-09 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli...AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 63 3e-09 AX882278_1( AX882278 |pid:non

Dicty_cDB: VHL817 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eading fra... 75 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 75 2e-12 AX8822...k... 108 1e-22 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 75 1e-12 BC114006_1( BC114006 |pid...:none) Bos taurus L-pipecolic acid oxidas... 75 1e-12 AY892312_1( AY892312 |pid:n

Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

NARCIS (Netherlands)

Kotterman, M.

1998-01-01

Outline of this thesis
In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

A Survey For Planetary-mass Brown Dwarfs in the Taurus and Perseus Star-forming Regions

Energy Technology Data Exchange (ETDEWEB)

Esplin, T. L.; Luhman, K. L., E-mail: taran.esplin@psu.edu [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)

2017-10-01

We present the initial results from a survey for planetary-mass brown dwarfs in the Taurus star-forming region. We have identified brown dwarf candidates in Taurus using proper motions and photometry from several ground- and space-based facilities. Through spectroscopy of some of the more promising candidates, we have found 18 new members of Taurus. They have spectral types ranging from mid-M to early-L, and they include the four faintest known members in extinction-corrected K{sub s}, which should have masses as low as ∼4–5 M {sub Jup} according to evolutionary models. Two of the coolest new members (M9.25, M9.5) have mid-IR excesses that indicate the presence of disks. Two fainter objects with types of M9–L2 and M9–L3 also have red mid-IR colors relative to photospheres at ≤L0, but since the photospheric colors are poorly defined at >L0, it is unclear whether they have excesses from disks. We also have obtained spectra of candidate members of the IC 348 and NGC 1333 clusters in Perseus that were identified by Luhman et al. Eight candidates are found to be probable members, three of which are among the faintest and least-massive known members of the clusters (∼5 M{sub Jup}).

A Survey For Planetary-mass Brown Dwarfs in the Taurus and Perseus Star-forming Regions

International Nuclear Information System (INIS)

Esplin, T. L.; Luhman, K. L.

2017-01-01

We present the initial results from a survey for planetary-mass brown dwarfs in the Taurus star-forming region. We have identified brown dwarf candidates in Taurus using proper motions and photometry from several ground- and space-based facilities. Through spectroscopy of some of the more promising candidates, we have found 18 new members of Taurus. They have spectral types ranging from mid-M to early-L, and they include the four faintest known members in extinction-corrected K s , which should have masses as low as ∼4–5 M Jup according to evolutionary models. Two of the coolest new members (M9.25, M9.5) have mid-IR excesses that indicate the presence of disks. Two fainter objects with types of M9–L2 and M9–L3 also have red mid-IR colors relative to photospheres at ≤L0, but since the photospheric colors are poorly defined at >L0, it is unclear whether they have excesses from disks. We also have obtained spectra of candidate members of the IC 348 and NGC 1333 clusters in Perseus that were identified by Luhman et al. Eight candidates are found to be probable members, three of which are among the faintest and least-massive known members of the clusters (∼5 M Jup ).

A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

International Nuclear Information System (INIS)

Todorov, K. O.; Luhman, K. L.; Konopacky, Q. M.; McLeod, K. K.; Apai, D.; Pascucci, I.; Ghez, A. M.; Robberto, M.

2014-01-01

We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M ☉ ). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15 −0.03 +0.05 for M4-M6 (M ∼ 0.1-0.3 M ☉ ) and 4/108 = 0.04 −0.01 +0.03 for >M6 (M ≲ 0.1 M ☉ ) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

Energy Technology Data Exchange (ETDEWEB)

Todorov, K. O.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Konopacky, Q. M. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); McLeod, K. K. [Whitin Observatory, Wellesley College, Wellesley, MA 02481 (United States); Apai, D.; Pascucci, I. [Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Ghez, A. M. [Division of Astronomy and Astrophysics, University of California, Los Angeles, CA 90095 (United States); Robberto, M., E-mail: todorovk@phys.ethz.ch [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

2014-06-10

We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M {sub ☉}). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15{sub −0.03}{sup +0.05} for M4-M6 (M ∼ 0.1-0.3 M {sub ☉}) and 4/108 = 0.04{sub −0.01}{sup +0.03} for >M6 (M ≲ 0.1 M {sub ☉}) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

Successful treatment of a necrotizing fasciitis patient caused by Mucor indicus with amphotericin B and skin grafting.

Science.gov (United States)

Luo, Yijin; Zeng, Fanqin; Huang, Xiaowen; Li, Qun; Tan, Guozhen; Xi, Liyan; Lu, Changming; Guo, Qing

2014-04-01

Cutaneous mucormycosis, an uncommon disease caused by Mucorales, predominantly occurs in immunocompromised host. The present case is a primary cutaneous mucormycosis due to Mucor indicus in an immunocompetent individual. It is with the features of necrotizing fasciitis over the right pretibial area. We are presenting this case owing to its rarity and the successful treatment with amphotericin B and skin grafting.

Full-length cloning and phylogenetic analyses of translationally controlled tumour protein and ferritin genes from the Indian white prawn, Fenneropenaeus indicus (H. Milne Edwards)

Digital Repository Service at National Institute of Oceanography (India)

Nayak, S.; Ramaiah, N.; Meena, R.M.; Sreepada, R.A.

-length sequences of these immune-relevant genes, this study highlighted their conserved natures, which perhaps make them important defence-related proteins in the innate immune system of F. indicus....

Transcriptomic response of goat mammary epithelial cells to Mycoplasma agalactiae challenge – a preliminary study

DEFF Research Database (Denmark)

Ogorevc, Jernej; Mihevc, Sonja Prpar; Hedegaard, Jakob

2015-01-01

Mycoplasma agalactiae (Ma) is one of the main aetiological agents of intramammary infections in small ruminants, causing contagious agalactia. To better understand the underlying disease patterns a primary goat mammary epithelial cell (pgMEC) culture was established from the mammary tissue and ch....... Additionally, the results represent comprehensive goat mammary transcriptome information and demonstrate the applicability of the comparative genomics approach for annotation of goat data, using transcriptome information of a closely related species (Bos taurus) as a reference....

Dicty_cDB: CFG838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available iscoideum chromosom... 390 e-107 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia..., adrenoco... 81 9e-14 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti... 68 6e-1...e) Homo sapiens mRNA for achalasia, a... 62 3e-08 (Q9NRG9) RecName: Full=Aladin; AltName: Full=Adracalin; &A... BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 60 1e-07 AK087134_1( A

Dicty_cDB: VHO576 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mal sarcosine oxidase; S... 48 1e-04 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 4...8 1e-04 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecolic acid o... 48 2e-04 AY892312_1( AY892312 ...id:none) Pongo abelii mRNA; cDNA DKFZp469L1... 48 2e-04 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli

Molecular analysis of clinical isolates previously diagnosed as Mycobacterium intracellulare reveals incidental findings of "Mycobacterium indicus pranii" genotypes in human lung infection.

Science.gov (United States)

Kim, Su-Young; Park, Hye Yun; Jeong, Byeong-Ho; Jeon, Kyeongman; Huh, Hee Jae; Ki, Chang-Seok; Lee, Nam Yong; Han, Seung-Jung; Shin, Sung Jae; Koh, Won-Jung

2015-09-30

Mycobacterium intracellulare is a major cause of Mycobacterium avium complex lung disease in many countries. Molecular studies have revealed several new Mycobacteria species that are closely related to M. intracellulare. The aim of this study was to re-identify and characterize clinical isolates from patients previously diagnosed with M. intracellulare lung disease at the molecular level. Mycobacterial isolates from 77 patients, initially diagnosed with M. intracellulare lung disease were re-analyzed by multi-locus sequencing and pattern of insertion sequences. Among the 77 isolates, 74 (96 %) isolates were designated as M. intracellulare based on multigene sequence-based analysis. Interestingly, the three remaining strains (4 %) were re-identified as "Mycobacterium indicus pranii" according to distinct molecular phylogenetic positions in rpoB and hsp65 sequence-based typing. In hsp65 sequevar analysis, code 13 was found in the majority of cases and three unreported codes were identified. In 16S-23S rRNA internal transcribed spacer (ITS) sequevar analysis, all isolates of both species were classified within the Min-A ITS sequevar. Interestingly, four of the M. intracellulare isolates harbored IS1311, a M. avium-specific element. Two of three patients infected with "M. indicus pranii" had persistent positive sputum cultures after antibiotic therapy, indicating the clinical relevance of this study. This analysis highlights the importance of precise identification of clinical isolates genetically close to Mycobacterium species, and suggests that greater attention should be paid to nontuberculous mycobacteria lung disease caused by "M. indicus pranii".

Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

NARCIS (Netherlands)

Upadhyay, M R; Chen, W; Lenstra, J A; Goderie, C R J; MacHugh, D E; Park, S D E; Magee, D A; Matassino, D; Ciani, F; Megens, H-J; van Arendonk, J A M; Groenen, M A M; Marsan, P A; Balteanu, V; Dunner, S; Garcia, J F; Ginja, C; Kantanen, J

2017-01-01

The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

COMBINED ANALYSIS OF IMAGES AND SPECTRAL ENERGY DISTRIBUTIONS OF TAURUS PROTOSTARS

International Nuclear Information System (INIS)

Gramajo, Luciana V.; Gomez, Mercedes; Whitney, Barbara A.; Robitaille, Thomas P.

2010-01-01

We present an analysis of spectral energy distributions (SEDs), near- and mid-infrared images, and Spitzer spectra of eight embedded Class I/II objects in the Taurus-Auriga molecular cloud. The initial model for each source was chosen using the grid of young stellar objects (YSOs) and SED fitting tool of Robitaille et al. Then the models were refined using the radiative transfer code of Whitney et al. to fit both the spectra and the infrared images of these objects. In general, our models agree with previous published analyses. However, our combined models should provide more reliable determinations of the physical and geometrical parameters since they are derived from SEDs, including the Spitzer spectra, covering the complete spectral range; and high-resolution near-infrared and Spitzer IRAC images. The combination of SED and image modeling better constrains the different components (central source, disk, envelope) of the YSOs. Our derived luminosities are higher, on average, than previous estimates because we account for the viewing angles (usually nearly edge-on) of most of the sources. Our analysis suggests that the standard rotating collapsing protostar model with disks and bipolar cavities works well for the analyzed sample of objects in the Taurus molecular cloud.

Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

NARCIS (Netherlands)

Upadhyay, M.R.; Chen, W.; Lenstra, J.A.; Goderie, C.R.J.; MacHugh, D.E.; Park, S.D.E.; Magee, D.A.; Matassino, D.; Ciani, F.; Megens, H.J.; Arendonk, van J.A.M.; Groenen, M.A.M.

2017-01-01

The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

The phylogenomic position of the grey nurse shark Carcharias taurus Rafinesque, 1810 (Lamniformes, Odontaspididae) inferred from the mitochondrial genome.

Science.gov (United States)

Bowden, Deborah L; Vargas-Caro, Carolina; Ovenden, Jennifer R; Bennett, Michael B; Bustamante, Carlos

2016-11-01

The complete mitochondrial genome of the grey nurse shark Carcharias taurus is described from 25 963 828 sequences obtained using Illumina NGS technology. Total length of the mitogenome is 16 715 bp, consisting of 2 rRNAs, 13 protein-coding regions, 22 tRNA and 2 non-coding regions thus updating the previously published mitogenome for this species. The phylogenomic reconstruction inferred from the mitogenome of 15 species of Lamniform and Carcharhiniform sharks supports the inclusion of C. taurus in a clade with the Lamnidae and Cetorhinidae. This complete mitogenome contributes to ongoing investigation into the monophyly of the Family Odontaspididae.

Discordance between in silico & in vitro analyses of ACE inhibitory & antioxidative peptides from mixed milk tryptic whey protein hydrolysate.

Science.gov (United States)

Chatterjee, Alok; Kanawjia, S K; Khetra, Yogesh; Saini, Prerna

2015-09-01

ACE inhibitory and antioxidative peptides identified by LCMS/MS, from mixed milk (Bubalus bubalis and Bos taurus) tryptic whey protein hydrolysate, were compared with the in silico predictions. α la and ß lg sequences, both from Bubalus bubalis and Bos taurus, were used for in silico study. SWISS-PROT and BIOPEP protein libraries were accessed for prediction of peptide generation. Study observed gaps in the prediction versus actual results, which remain unaddressed in the literature. Many peptides obtained in vitro, were not reflected in in silico predictions. Differences in identified peptides in separate libraries were observed too. In in silico prediction, peptides with known biological activities were also not reflected. Predictions, towards generation of bioactive peptides, based upon in silico release of proteins and amino acid sequences from different sources and thereupon validation in relation to actual results has often been reported in research literature. Given that computer aided simulation for prediction purposes is an effective research direction, regular updating of protein libraries and an effectual integration, for more precise results, is critical. The gaps addressed between these two techniques of research, have not found any address in literature. Inclusion of more flexibility with the variables, within the tools being used for prediction, and a hierarchy based database with search options for various peptides, will further enhance the scope and strength of research.

Molecular Characterization and Expression Analysis of Insulin-like Growth Factor-1 and Insulin-like Growth Factor Binding Protein-1 Genes in Qinghai-Tibet Plateau and Lowland

Directory of Open Access Journals (Sweden)

Ya-bing Chen

2015-01-01

Full Text Available Insulin-like growth factor-1 (IGF-1 and insulin-like growth factor binding protein-1 (IGFBP-1 play a pivotal role in regulating cellular hypoxic response. In this study, we cloned and characterized the genes encoding IGF-1 and IGFBP-1 to improve the current knowledge on their roles in highland Bos grunniens (Yak. We also compared their expression levels in the liver and kidney tissues between yaks and lowland cattle. We obtained full-length 465 bp IGF-1 and 792 bp IGFBP-1, encoding 154 amino acids (AA IGF-1, and 263 AA IGFBP-1 protein, respectively using reverse transcriptase-polyerase chain reaction (RT-PCR technology. Analysis of their corresponding amino acid sequences showed a high identity between B. grunniens and lowland mammals. Moreover, the two genes were proved to be widely distributed in the examined tissues through expression pattern analysis. Real-time PCR results revealed that IGF-1 expression was higher in the liver and kidney tissues in B. grunniens than in Bos taurus (p<0.05. The IGFBP-1 gene was expressed at a higher level in the liver (p<0.05 of B. taurus than B. grunniens, but it has a similar expression level in the kidneys of the two species. These results indicated that upregulated IGF-1 and downregulated IGFBP-1 are associated with hypoxia adaptive response in B. grunniens.

The capybara (Hydrochoerus hydrochaeris) as a reservoir host for Trypanosoma evansi.

Science.gov (United States)

Morales, G A; Wells, E A; Angel, D

1976-10-01

Discovery of two ill horses and three dogs naturally infected with Trypanosoma evansi near an experimental station in the Eastern Plains of Colombia led to a search for reservoir hosts of the parasite. Infection was detected in 8/33 healthy capybaras (Hydrochoerus hydrochaeris), none of the remaining 14 horses, and none of 32 Zebu cattle (Bos indicus), 18 paca (Cuniculus paca) and 20 spiny rats (Proechimys sp.). Contrary to common opinion, the results indicated a carrier state in the capybara. Diagnosis was based on morphology, behaviour in albino rats, and pathogenicity and host range in domestic animals.

Breeding Biology of Critically Endangered Long-billed Vulture (Gyps indicus at a Unique Site in Telangana State, India

Directory of Open Access Journals (Sweden)

Ravikanth Manchiryala

2016-04-01

Full Text Available Out of nine species of vultures, the population of three Gyps species, White-backed Vulture (Gyps bengalensis, Slender-billed Vulture (Gyps tenuirostris and Long-billed Vulture (Gyps indicus has declined drastically by 99% over the past decade (Prakash, 1999. The Gyps vultures' population declined in India by 97% and by 92% in Pakistan (Virani, 2006, Prakash et al., 2012. Possibly the widespread usage of Diclofenac drug in the animal led to the rapid population decline for these Vultures (Green et al., 2004. The Long-billed Vulture G. indicus is a bald headed vulture with very broad wings and short tail feathers, having no sexual dimorphism. In Malabar hills region of India the breeding season of Long-billed Vultures was noted to be November to May where it breed mainly on cliffs (Edward, 1915. Presently, it is in the most critical category of endangerment, listed in Schedule-I of the Indian Wildlife Protection Act-1972 followed by IUCN, 2015 (http://www.iucnredlist.org/details/22729731/0. The Andhra Pradesh State Biodiversity Board, Hyderabad announced that vultures are already 'Extinct' in the state (Medicheti, 2013.

VLBA DETERMINATION OF THE DISTANCE TO NEARBY STAR-FORMING REGIONS. III. HP TAU/G2 AND THE THREE-DIMENSIONAL STRUCTURE OF TAURUS

International Nuclear Information System (INIS)

Torres, Rosa M.; Loinard, Laurent; Rodriguez, Luis F.; Mioduszewski, Amy J.

2009-01-01

Using multiepoch Very Long Baseline Array (VLBA) observations, we have measured the trigonometric parallax of the weak-line T Tauri star HP Tau/G2 in Taurus. The best fit yields a distance of 161.2 ± 0.9 pc, suggesting that the eastern portion of Taurus (where HP Tau/G2 is located) corresponds to the far side of the complex. Previous VLBA observations have shown that T Tau, to the south of the complex, is at an intermediate distance of about 147 pc, whereas the region around L1495 corresponds to the near side at roughly 130 pc. Our observations of only four sources are still too coarse to enable a reliable determination of the three-dimensional structure of the entire Taurus star-forming complex. They do demonstrate, however, that VLBA observations of multiple sources in a given star-forming region have the potential not only to provide a very accurate estimate of its mean distance, but also to reveal its internal structure. The proper motion measurements obtained simultaneously with the parallax allowed us to study the kinematics of the young stars in Taurus. Combining the four observations available so far, we estimate the peculiar velocity of Taurus to be about 10.6 km s -1 almost completely in a direction parallel to the Galactic plane. Using our improved distance measurement, we have refined the determination of the position on the H-R diagram of HP Tau/G2, and of two other members of the HP Tau group (HP Tau itself and HP Tau/G3). Most pre-main-sequence evolutionary models predict significantly discrepant ages (by 5 Myr) for those three stars-expected to be coeval. Only in the models of Palla and Stahler do they fall on a single isochrone (at 3 Myr).

Salida de campo a Santo Domingo de Silos, en Burgos, el 14 de septiembre de 1953

OpenAIRE

Valverde Gómez, José Antonio, 1926-2003

2008-01-01

Salida de campo a Santo Domingo de Silos, en Burgos, el 14 de septiembre de 1953, de la que se anotaron observaciones sobre cangrejos, los siguientes peces: "Foxinellus sp." y Trucha (Salmo trutta o Oncorhynchus mykiss), los siguientes mamíferos: Bos taurus (Vaca), Capra aegagrus hircus (Cabra doméstica) y Galemys pyrenaicus (Desmán pirenaico), y las siguientes aves: Aquila sp. (Águila), Carduelis cannabina (Pardillo común, llamada Colorín y Acanthis cannabina por el autor), Carduelis carduel...

The Psychology of Cows

OpenAIRE

Lori Marino; Kristin Allen

2017-01-01

Domestic cows (Bos taurus) are consumed worldwide as beef and veal, kept as dairy product producers, employed as draft animals in labor, and are used for a long list of other products, including leather and manure. But despite global reliance on cows for thousands of years, most people’s perception of them is as plodding herd animals with little individual personality and very simple social relationships or preferences. Yet, a review of the scientific literature on cow behavior points to more...

AcEST: DK954898 [AcEST

Lifescience Database Archive (English)

Full Text Available d A4FV84 Definition sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus Align length 160 Scor...t alignments: (bits) Value sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taur... 153 6e-37 sp|...Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 152 8e-37 sp|Q9UKD2|MRT4_HUMAN mRNA turno...ver protein 4 homolog OS=Homo sap... 151 2e-36 sp|Q86HD3|MRT4_DICDI mRNA turnover p...rotein 4 homolog OS=Dictyost... 140 5e-33 sp|Q7S302|MRT4_NEUCR mRNA turnover protein 4 homolog OS=Neurospo..

Morfologia e biometria do ligamento apical do pênis de touros da raça Girolando Morphology and biometry of the apical ligament of the penis of Girolando race bulls

Directory of Open Access Journals (Sweden)

Júlio Roquete Cardoso

2010-08-01

Full Text Available Objetivou-se descrever a morfologia e biometria do ligamento apical do pênis de 32 touros da raça Girolando (Bos taurus indicus X Bos taurus taurus, Linnaeus - 1758, com idade de 36 a 48 meses e pesando de 480 a 540kg. As peças anatômicas foram obtidas em frigorífico e mantidas congeladas até dissecação. O ligamento originou-se a 15,1±2,9cm distalmente à curvatura caudal da flexura sigmoide e inseriu-se a 1,4±0,7cm proximalmente ao colo da glande, medindo 18,9±2,6cm de comprimento. Apresentou largura de 1,9±0,6mm na sua origem, 2,2±0,8mm na inserção e 35,2±10mm na altura da inserção da lâmina interna do prepúcio. A espessura média ao longo de sua extensão variou de 0,7 a 1,9mm. Próximo à coroa da glande, o ligamento apical se posiciona principalmente na superfície dorsolateral esquerda desse órgão, e a característica da sua fixação na albugínea apresentou variações ao longo de sua extensão. Em sua origem e inserção e na face esquerda do pênis, o ligamento apical é firmemente aderido à túnica albugínea, mas na face dorsal e direita do pênis essa união é realizada por meio de tecido conjuntivo frouxo. Verificou-se correlação média entre o comprimento e a circunferência do pênis com o comprimento do ligamento apical, mas a correlação entre essas variáveis do pênis e a largura do ligamento apical foi baixa.The aim of this study was to describe the morphology and biometry of the apical ligament of the penis of Girolando bulls. For this purpose, it was dissected 32 penis of Girolando bulls obtained from slaughterhouses and kept frozen until their dissection. The animals were 36 to 48 month old and weighted between 480 and 540kg. The origin of the apical ligament occurred at 15.1±2.9cm distally to the caudal loop of the sigmoid flexure and its insertion occurred at 1.4±0.7cm proximally to the neck of the glans. The length of the apical ligament was 19.9±2.6cm. The width was 1.9±0.6mm at its

The complete mitochondrial genome of the Asian tapirs (Tapirus indicus): the only extant Tapiridae species in the old world.

Science.gov (United States)

Muangkram, Yuttamol; Wajjwalku, Worawidh; Kaolim, Nongnid; Buddhakosai, Waradee; Kamolnorranath, Sumate; Siriaroonrat, Boripat; Tipkantha, Wanlaya; Dongsaard, Khwanruean; Maikaew, Umaporn; Sanannu, Saowaphang

2016-01-01

Asian tapir (Tapirus indicus) is categorized as Endangered on the 2008 IUCN red list. The first full-length mitochondrial DNA (mtDNA) sequence of Asian tapir is 16,717 bp in length. Base composition shows 34.6% A, 27.2% T, 25.8% C and 12.3% G. Highest polymorphic site is on the control region as typical for many species.

Possible maternal offloading of metals in the plasma, uterine and capsule fluid of pregnant ragged-tooth sharks (Carcharias taurus) on the east coast of South Africa.

Science.gov (United States)

Naidoo, Kristina; Chuturgoon, Anil; Cliff, Geremy; Singh, Sanil; Ellis, Megan; Otway, Nicholas; Vosloo, Andre; Gregory, Michael

2017-07-01

We studied the possible metal offloading onto the progeny of three pregnant female ragged-tooth sharks (Carcharias taurus) (C. taurus). The presences of five metals, i.e. aluminium (Al), arsenic (As), cadmium (Cd), lead (Pb) and selenium (Se) were validated by mass spectrometry in the maternal plasma as well as the intracapsular and uterine fluids (UF) in which embryos develop. Metals were ranked in a decreasing concentration as follows: Plasma: As > Al > Se > Pb > Cd; ICF: As > Se > Al > Cd > Pb and UF: As > Se > Al > Cd > Pb. As was present in the highest concentration in all three sharks. Al, Pb and Cd were found to be the highest within the plasma, while concentrations of Se were similar in all three fluids. These results indicate that C. taurus embryos are exposed to metals during early development, but the impact of this exposure remains unknown. To the best of our knowledge, this is the first investigation to confirm the presence of metals in the fluids that surround the developing C. taurus embryos, a species that is already listed as vulnerable.

Global mapping of miRNA-target interactions in cattle (Bos taurus)

DEFF Research Database (Denmark)

Scheel, Troels K H; Moore, Michael J; Luna, Joseph M

2017-01-01

With roles in development, cell proliferation and disease, micro-RNA (miRNA) biology is of great importance and a potential therapeutic target. Here we used cross-linking immunoprecipitation (CLIP) and ligation of miRNA-target chimeras on the Argonaute (AGO) protein to globally map miRNA interact...

16S partial gene mitochondrial DNA and internal transcribed spacers ribosomal DNA as differential markers of Trichuris discolor populations.

Science.gov (United States)

Callejón, R; Halajian, A; de Rojas, M; Marrugal, A; Guevara, D; Cutillas, C

2012-05-25

Comparative morphological, biometrical and molecular studies of Trichuris discolor isolated from Bos taurus from Spain and Iran was carried out. Furthermore, Trichuris ovis isolated from B. taurus and Capra hircus from Spain has been, molecularly, analyzed. Morphological studies revealed clear differences between T. ovis and T. discolor isolated from B. taurus but differences were not observed between populations of T. discolor isolated from different geographical regions. Nevertheless, the molecular studies based on the amplification and sequencing of the internal transcribed spacers 1 and 2 ribosomal DNA and 16S partial gene mitochondrial DNA showed clear differences between both populations of T. discolor from Spain and Iran suggesting two cryptic species. Phylogenetic studies corroborated these data. Thus, phylogenetic trees based on ITS1, ITS2 and 16S partial gene sequences showed that individuals of T. discolor from B. taurus from Iran clustered together and separated, with high bootstrap values, of T. discolor isolated from B. taurus from Spain, while populations of T. ovis from B. taurus and C. hircus from Spain clustered together but separated with high bootstrap values of both populations of T. discolor. Furthermore, a comparative phylogenetic study has been carried out with the ITS1and ITS2 sequences of Trichuris species from different hosts. Three clades were observed: the first clustered all the species of Trichuris parasitizing herbivores (T. discolor, T. ovis, Trichuris leporis and Trichuris skrjabini), the second clustered all the species of Trichuris parasitizing omnivores (Trichuris trichiura and Trichuris suis) and finally, the third clustered species of Trichuris parasitizing carnivores (Trichuris muris, Trichuris arvicolae and Trichuris vulpis). Copyright © 2011 Elsevier B.V. All rights reserved.

Individual taper models for natural cedar and Taurus fir mixed stands of Bucak Region, Turkey

Directory of Open Access Journals (Sweden)

Ramazan Özçelik

2017-11-01

Full Text Available In this study, we assessed the performance of different types of taper equations for predicting tree diameters at specific heights and total stem volumes for mixed stands of Taurus cedar (Cedrus libani A. Rich. and Taurus fir (Abies cilicica Carr.. We used data from mixed stands containing a total of 131 cedar and 124 Taurus fir trees. We evaluated six commonly used and well-known forestry taper functions developed by a variety of researchers (Biging (1984, Zakrzewski (1999, Muhairwe (1999, Fang et al. (2000, Kozak (2004, and Sharma and Zhang (2004. To address problems related to autocorrelation and multicollinearity in the hierarchical data associated with the construction of taper models, we used appropriate statistical procedures for the model fitting. We compared model performances based on the analysis of three goodness-of-fit statistics and found the compatible segmented model of Fang et al. (2000 to be superior in describing the stem profile and stem volume of both tree species in mixed stands. The equation used by Zakrzewski (1999 exhibited the poorest fitting results of the three taper equations. In general, we found segmented taper equations to provide more accurate predictions than variable-form models for both tree species. Results from the non-linear extra sum of squares method indicate that stem tapers differ among tree species in mixed stands. Therefore, a different taper function should be used for each tree species in mixed stands in the Bucak district. Using individual-specific taper equations yields more robust estimations and, therefore, will enhance the prediction accuracy of diameters at different heights and volumes in mixed stands.

TAURUS observations of the emission-line velocity field of Centaurus A (NGC 5128)

International Nuclear Information System (INIS)

Taylor, K.; Atherton, P.D.

1983-01-01

Using TAURUS - an Imaging Fabry Perot system in conjunction with the IPCS on the AAT, the authors have studied the velocity field of the Hα emission line at a spatial resolution of 1.7'' over the dark lane structure of Centaurus A. The derived velocity field is quite symmetrical and strongly suggests that the emission line material is orbiting the elliptical component, as a warped disc. (orig.)

Taurus Hill Observatory Scientific Observations for Pulkova Observatory during the 2016-2017 Season

Science.gov (United States)

Hentunen, V.-P.; Haukka, H.; Heikkinen, E.; Salmi, T.; Juutilainen, J.

2017-09-01

Taurus Hill Observatory (THO), observatory code A95, is an amateur observatory located in Varkaus, Finland. The observatory is maintained by the local astronomical association Warkauden Kassiopeia. THO research team has observed and measured various stellar objects and phenomena. Observatory has mainly focused on exoplanet light curve measurements, observing the gamma rays burst, supernova discoveries and monitoring. We also do long term monitoring projects.

Electrocardiogram of Clinically Healthy Mithun (Bos frontalis): Variation among Strains

Science.gov (United States)

Sanyal, Sagar; Das, Pradip Kumar; Ghosh, Probal Ranjan; Das, Kinsuk; Vupru, Kezha V.; Rajkhowa, Chandan; Mondal, Mohan

2010-01-01

A study was conducted to establish the normal electrocardiogram in four different genetic strains of mithun (Bos frontalis). Electrocardiography, cardiac electrical axis, heart rate, rectal temperature and respiration rate were recorded in a total of 32 adult male mithun of four strains (n = 8 each). It was found that the respiration and heart rates were higher (P electrocardiogram of mithun revealed that the amplitude and duration of P wave, QRS complex and T wave were different among four different genetic strains of mithun and the electrical axis of QRS complex for Nagamese and Mizoram mithuns are dissimilar to bovine species. PMID:20886013

Developmental changes in concentrations of vitellin, vitellogenin, and lipids in hemolymph, hepatopancreas, and ovaries from different ovarian stages of Indian white prawn Fenneropenaeus indicus

DEFF Research Database (Denmark)

Boucard, C.G.V.; Levy, P.; Ceccaldi, H.J.

2002-01-01

The objective of the present study was to characterize the relationship between vitellogenin (Vtg) and vitellin (Vt) concentration profiles during the reproductive cycle of the penaeid prawn Fenneropenaeus indicus. Vt was purified from ovaries of vitellogenic females by gradient ultracentrifugati...

Correlations between the stellar and disc properties of Taurus PMS stars in the GASPS sample

NARCIS (Netherlands)

Alonso-Martínez, Miguel; Riviere-Marichalar, Pablo; Pascual, Natalia; Montesinos, Benjamín; Howard, Christian D.; Sandell, Göran; Meeus, Gwendolyn; Eiroa, Carlos; Dent, Bill

The Herschel Open Time Key Programme GASPS (P.I. B. Dent) has observed a large number of pre-main sequence TTauri stars in Taurus with PACS (photometry and spectroscopy). In addition, we have also carried out new ground-based optical and near-IR observations (photometry and spectroscopy) of most of

Comparison of milk fatty acid profiles measured on Kouri cows near Lake Chad and on dairy cattle as reported by meta-analytical data.

Science.gov (United States)

Bada Algom, O; Fabry, C; Leroy, P L; Hornick, J-L

2017-06-01

Kouri (Bos taurus) is a breed aboriginal from Lake Chad and threatened with extinction. This study aimed to compare milk fatty acid profiles measured on Kouri cows and on high-yielding dairy cattle in Europe and elsewhere as reported by meta-analytical data (22 experimentations). Milk samples were collected from 14 Kouri dairy cows in dry season (March to June) and fatty acids (FA) were determined by gas chromatography. Overall, 32 FA have been identified. Kouri showed lower values (P pastures by Kouri cows.

Dicty_cDB: AFH742 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AC115581 |pid:none) Dictyostelium discoideum chromosom... 477 e-133 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia...lus 2 days neonate thymus... 84 3e-17 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti... ... |pid:none) Homo sapiens mRNA for achalasia, a... 79 4e-16 (Q9NRG9) RecName: Full...0826 fis, cl... 79 5e-16 BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 80 6e-16 EF14

Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

Directory of Open Access Journals (Sweden)

Luchman Hakim

2015-09-01

Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

Dietary Administration of Yeast β 1,3 1,6 Glucan on Immunity and Survival Rate of White Indian Shrimp, Fennerpenaeus indicus Challenged with White Spot Syndrome Disease

Directory of Open Access Journals (Sweden)

Babak Ghaednia

2012-01-01

Full Text Available The potency of dietary β 1,3 1,6 glucan (BG, derived from Saccharomyces cerevisiae, in stimulating the non-specific immunity of white Indian shrimp, Fennerpenaeus indicus (Milne-Edwards, 1837 and improving its resistance to white spot syndrome disease were investigated. F. indicus (11.32±1.20 g were fed for 20 days on a series of treatment diets containing graded levels of BG (blank control, 0 as control, 2, 10, 20 g kg-1 feed and were then challenged by injection of WSSV virus. Total haemocyte count (THC, total plasma protein (TPP, phagocytic activity (PA and Bacterial Clearance activity (BC were measured at days 0, 7, 14, 21 after BG feeding, and shrimp survival rate was also recorded daily after challenge. THC, TPP, PA and BC of the 10 and 20 g kg-1 BG treatments were significantly higher (P<0.05 by day 14 than control and 2 g kg-1 treatment shrimp. Survival rate of shrimp fed with the diet containing 10 and 20 g kg-1 BG after 21 days, were 53.32±5.77 and 48.32±5.77%, respectively. Accordingly, oral administration of BG at an optimal level of 10 g kg-1 diet for 20 days efficaciously stimulate the immune defense and improve the survival rate of WSV-infected F. indicus.

Comparison of methanogen diversity of yak (Bos grunniens) and cattle (Bos taurus) from the Qinghai-Tibetan plateau, China

Science.gov (United States)

2012-01-01

Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak) and normal animal (cattle) in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones) and four cattle (205 clones) from the Qinghai-Tibetan Plateau area (QTP). Overall, a total of 414 clones (i.e. sequences) were examined and assigned to 95 operational taxonomic units (OTUs) using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC) were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110) was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle. PMID:23078429

Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

Directory of Open Access Journals (Sweden)

Huang Xiao

2012-10-01

Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

A Novel Bromophenol Derivative BOS-102 Induces Cell Cycle Arrest and Apoptosis in Human A549 Lung Cancer Cells via ROS-Mediated PI3K/Akt and the MAPK Signaling Pathway

Directory of Open Access Journals (Sweden)

Chuan-Long Guo

2018-01-01

Full Text Available Bromophenol is a type of natural marine product. It has excellent biological activities, especially anticancer activities. In our study of searching for potent anticancer drugs, a novel bromophenol derivative containing indolin-2-one moiety, 3-(4-(3-([1,4′-bipiperidin]-1′-ylpropoxy-3-bromo-5-methoxybenzylidene-N-(4-bromophenyl-2-oxoindoline-5-sulfonamide (BOS-102 was synthesized, which showed excellent anticancer activities on human lung cancer cell lines. A study of the mechanisms indicated that BOS-102 could significantly block cell proliferation in human A549 lung cancer cells and effectively induce G0/G1 cell cycle arrest via targeting cyclin D1 and cyclin-dependent kinase 4 (CDK4. BOS-102 could also induce apoptosis, including activating caspase-3 and poly (ADP-ribose polymerase (PARP, increasing the Bax/Bcl-2 ratio, enhancing reactive oxygen species (ROS generation, decreasing mitochondrial membrane potential (MMP, ΔΨm, and leading cytochrome c release from mitochondria. Further research revealed that BOS-102 deactivated the PI3K/Akt pathway and activated the mitogen-activated protein kinase (MAPK signaling pathway resulting in apoptosis and cell cycle arrest, which indicated that BOS-102 has the potential to develop into an anticancer drug.

Morfometría ovárica de hembras Cebú (Bos Indicus

Directory of Open Access Journals (Sweden)

Ana Sánchez

2007-10-01

Full Text Available El estudio de la morfometría ovárica está directamente relacionado con sus aplicaciones para analizar e interpretar los hallazgos, en los exámenes ginecológicos de las vacas. Para este trabajo se recolectaron 114 pares de ovarios en frigorífico, clasificados a partir del ancho, grueso, largo, volumen, diámetro del folículo, diámetro y área del cuerpo lúteo. Fue observada una diferencia significativa en el ancho (1,95cm y 1,83cm y el volumen (7,26 mL y 6,23 mL de los ovarios izquierdos y derechos, respectivamente. En cuanto al tamaño y el volumen de los folículos, el diámetro y el área de los cuerpos lúteos, no hubo diferencia relevante. En los lados hubo correlación positiva (p<0,01 entre el volumen del ovario izquierdo y el área del cuerpo lúteo. La presencia de folículos con diámetro igual o superior a 9mm, el cuerpo lúteo de tipo macizo y protruso presente en 43,39% de los 53 ovarios, predominó con relación al tipo cóncavo. De los 84 ovarios con cuerpos lúteos, el 26,20% eran de tipo extrapolado. Se concluye, que la presencia de cuerpo lúteo incluso, en vacas cebú, puede resultar en fallas diagnósticas durante el examen de palpación rectal para estimar la actividad ovárica.