Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI05 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

40 CFR Appendix C to Part 97 - Final Section 126 Rule: Trading Budget

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Final Section 126 Rule: Trading Budget... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Pt. 97, App. C Appendix C to Part 97—Final Section 126 Rule: Trading Budget ST F126-EGU F126-NEGU Total DC 207 26...

Dicty_cDB: FC-BS11 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS11 (Link to dictyBase) - - - Contig-U16517-1 FC-BS11Z (Li...nk to Original site) - - FC-BS11Z 683 - - - - Show FC-BS11 Library FC (Link to library) Clone ID FC-BS11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS11Q.Seq.d/ Representative seq. ID FC-BS...11Z (Link to Original site) Representative DNA sequence >FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS11Q.Seq....s producing significant alignments: (bits) Value FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

Dicty_cDB: FC-BS14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS14 (Link to dictyBase) - - - Contig-U16399-1 FC-BS14E (Li...nk to Original site) - - - - - - FC-BS14E 534 Show FC-BS14 Library FC (Link to library) Clone ID FC-BS14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS14Q.Seq.d/ Representative seq. ID FC-BS...14E (Link to Original site) Representative DNA sequence >FC-BS14 (FC-BS14Q) /CSM/FC/FC-BS/FC-BS14Q.Seq.... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS14 (FC-BS

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

Dicty_cDB: FC-BS10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS...10Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/

Dicty_cDB: FC-BS21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS21 (Link to dictyBase) - - - Contig-U15764-1 FC-BS21Z (Li...nk to Original site) - - FC-BS21Z 723 - - - - Show FC-BS21 Library FC (Link to library) Clone ID FC-BS21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS21Q.Seq.d/ Representative seq. ID FC-BS...21Z (Link to Original site) Representative DNA sequence >FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.Seq.... Score E Sequences producing significant alignments: (bits) Value FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.

Dicty_cDB: FC-BS19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI03 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

Dicty_cDB: FC-BS09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS09 (Link to dictyBase) - - - Contig-U16215-1 FC-BS09Z (Li...nk to Original site) - - FC-BS09Z 626 - - - - Show FC-BS09 Library FC (Link to library) Clone ID FC-BS09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS09Q.Seq.d/ Representative seq. ID FC-BS...09Z (Link to Original site) Representative DNA sequence >FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS09Q.Seq....ignments: (bits) Value SSF360 (SSF360Q) /CSM/SS/SSF3-C/SSF360Q.Seq.d/ 854 0.0 FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

Dicty_cDB: FC-BR23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

Biodesulfurization of refractory organic sulfur compounds in fossil fuels.

Science.gov (United States)

Soleimani, Mehran; Bassi, Amarjeet; Margaritis, Argyrios

2007-01-01

The stringent new regulations to lower sulfur content in fossil fuels require new economic and efficient methods for desulfurization of recalcitrant organic sulfur. Hydrodesulfurization of such compounds is very costly and requires high operating temperature and pressure. Biodesulfurization is a non-invasive approach that can specifically remove sulfur from refractory hydrocarbons under mild conditions and it can be potentially used in industrial desulfurization. Intensive research has been conducted in microbiology and molecular biology of the competent strains to increase their desulfurization activity; however, even the highest activity obtained is still insufficient to fulfill the industrial requirements. To improve the biodesulfurization efficiency, more work is needed in areas such as increasing specific desulfurization activity, hydrocarbon phase tolerance, sulfur removal at higher temperature, and isolating new strains for desulfurizing a broader range of sulfur compounds. This article comprehensively reviews and discusses key issues, advances and challenges for a competitive biodesulfurization process.

NERI FINAL TECHNICAL REPORT, DE-FC07-O5ID14647. OPTIMIZATION OF OXIDE COMPOUNDS FOR ADVANCED INERT MATRIX MATERIALS

International Nuclear Information System (INIS)

Nino, Juan C.

2009-01-01

In order to reduce the current excesses of plutonium (both weapon grade and reactor grade) and other transuranium elements, a concept of inert matrix fuel (IMF) has been proposed for an uranium free transmutation of fissile actinides which excludes continuous uranium-plutonium conversion in thermal reactors and advanced systems. Magnesium oxide (MgO) is a promising candidate for inert matrix (IM) materials due to its high melting point (2827 C), high thermal conductivity (13 W/K · m at 1000 C), good neutronic properties, and irradiation stability However, MgO reacts with water and hydrates easily, which prevents it from being used in light water reactors (LWRs) as an IM. To improve the hydration resistance of MgO-based inert matrix materials, Medvedev and coworkers have recently investigated the introduction of a secondary phase that acts as a hydration barrier. An MgO-ZrO 2 composite was specifically studied and the results showed that the composite exhibited improved hydration resistance than pure MgO. However, ZrO 2 is insoluble in most acids except HF, which is undesirable for fuel reprocessing. Moreover, the thermal conductivity of ZrO 2 is low and typically less than 3 W · m -1 · K -1 at 1000 C. In search for an alternative composite strategy, Nd 2 Zr 2 O 7 , an oxide compound with pyrochlore structure, has been proposed recently as a corrosion resistant phase, and MgO-Nd 2 Zr 2 O 7 composites have been investigated as potential IM materials. An adequate thermal conductivity of 6 W · m - 1 · K -1 at 1000 C for the MgO-Nd 2 Zr 2 O 7 composite with 90 vol% MgO was recently calculated and reported. Other simulations proposed that the MgO-pyrochlore composites could exhibit higher radiation stability than previously reported. Final optimization of the composite microstructure was performed on the 70 vol% MgO-Nd 2 Zr 2 O 7 composite that burnup calculations had shown to have the closest profile to that of MOX fuel. Theoretical calculations also indicated that

NERI FINAL TECHNICAL REPORT, DE-FC07-O5ID14647, OPTIMIZATION OF OXIDE COMPOUNDS FOR ADVANCED INERT MATRIX MATERIALS

Energy Technology Data Exchange (ETDEWEB)

PI: JUAN C. NINO, ASSOCIATE PROFESSOR

2009-01-11

In order to reduce the current excesses of plutonium (both weapon grade and reactor grade) and other transuranium elements, a concept of inert matrix fuel (IMF) has been proposed for an uranium free transmutation of fissile actinides which excludes continuous uranium-plutonium conversion in thermal reactors and advanced systems. Magnesium oxide (MgO) is a promising candidate for inert matrix (IM) materials due to its high melting point (2827 C), high thermal conductivity (13 W/K {center_dot} m at 1000 C), good neutronic properties, and irradiation stability However, MgO reacts with water and hydrates easily, which prevents it from being used in light water reactors (LWRs) as an IM. To improve the hydration resistance of MgO-based inert matrix materials, Medvedev and coworkers have recently investigated the introduction of a secondary phase that acts as a hydration barrier. An MgO-ZrO{sub 2} composite was specifically studied and the results showed that the composite exhibited improved hydration resistance than pure MgO. However, ZrO{sub 2} is insoluble in most acids except HF, which is undesirable for fuel reprocessing. Moreover, the thermal conductivity of ZrO{sub 2} is low and typically less than 3 W {center_dot} m{sup -1} {center_dot} K{sup -1} at 1000 C. In search for an alternative composite strategy, Nd{sub 2}Zr{sub 2}O{sub 7}, an oxide compound with pyrochlore structure, has been proposed recently as a corrosion resistant phase, and MgO-Nd{sub 2}Zr{sub 2}O{sub 7} composites have been investigated as potential IM materials. An adequate thermal conductivity of 6 W {center_dot} m{sup -} 1 {center_dot} K{sup -1} at 1000 C for the MgO-Nd{sub 2}Zr{sub 2}O{sub 7} composite with 90 vol% MgO was recently calculated and reported. Other simulations proposed that the MgO-pyrochlore composites could exhibit higher radiation stability than previously reported. Final optimization of the composite microstructure was performed on the 70 vol% MgO-Nd{sub 2}Zr{sub 2}O{sub 7

Biodesulfurization of vanadium-bearing titanomagnetite concentrates and pH control of bioleaching solution

Science.gov (United States)

Liu, Xiao-rong; Jiang, Sheng-cai; Liu, Yan-jun; Li, Hui; Wang, Hua-jun

2013-10-01

Vanadium-bearing titanomagnetite concentrates were desulfurized with Acidithiobacillus ferrooxidans ( A. ferrooxidans). The sulfur content of the concentrates was reduced from 0.69wt% to 0.14wt% after bioleaching for 15 d with a 10% pulp density at 30°C. Maintaining a stable pH value during biodesulfurization was critical because of high acid consumption, resulting from a combination of nonoxidative and oxidative dissolution of pyrrhotite in acid solution. It is discovered that the citric acid-disodium hydrogen phosphate buffer of pH 2.0 can control the solution pH value smoothly in the optimal range of 2.0-3.0 for A. ferrooxidans growth. Using the buffer in the volume fraction range of 5.0%-15.0% stimulates A. ferrooxidans growth and improves the biodesulfurization efficiency. Compared with the buffer-free control case, the maximum increase of biodesulfurization rate is 29.7% using a 10.0vol% buffer. Bioleaching provides an alternative process for desulfurization of vanadium-bearing titanomagnetite ores.

Advanced power conversion based on the Aerocapacitor{trademark}. Final report

Energy Technology Data Exchange (ETDEWEB)

Roark, D.

1997-03-05

This report summarizes work performed under contract No. DE-FC07-94ID13283, {open_quotes}Advanced Power Conversion Based on the Aerocapacitors{trademark}.{close_quotes} Under this contract high power density, high energy density, organic electrolyte Aerocapacitors{trademark} were developed and characterized for power conversion applications. Pilot facilities for manufacturing prototype AA-size Aerocapacitors{trademark} were put in place. The low ESR and good frequency response of these devices show that they are ideal components for high discharge rate and low to moderate frequency (< 10 kHz) applications such as power conversion.

Esta palavra socialismo... Idéias socialistas no Brasil no final do século XIX

OpenAIRE

LEONIDIO, ADALMIR

2012-01-01

Por meio de uma análise do sentido variado que a palavra socialismo assumiu no Brasil no final do século XLX, este artigo busca ressaltar o estatuto das idéias socialistas no período: um misto de progressismo liberal, socialismo utópico e positivismo. Para tanto, baseia-se em artigos de importantes jornais, como Echo Popular, Gaveta Operária, Vo^do Povo, entre outros.

Dicty_cDB: FC-AA02 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285

Microbial hydrogenogenic CO conversions: applications in synthesis gas purification and biodesulfurization

NARCIS (Netherlands)

Sipma, J.

2006-01-01

Hydrogen gas attracts great interest as a potential clean future fuel and it is an excellent electron donor in biotechnological reductive processes, e.g. in biodesulfurization. Bulk production of H ₂ relies on the conversion of organic matter into synthesis gas, a mixture of H

Biodesulfurization and the upgrading of petroleum distillates.

Science.gov (United States)

Monticello, D J

2000-12-01

Biotechnology offers an alternative way to process fossil fuels. There have been several important advances in the elucidation of the mechanisms of biodesulfurization and the development of a biocatalytic desulfurization process. These include a detailed analysis of the rate and extent of desulfurization of real target molecules in a diesel matrix, the directed evolution of rate- and extent-limiting enzymes for better performance and the expression of the genes in alternative hosts. Process innovations include new reactor designs, separations and recovery strategies and the production of value-added byproducts during desulfurization.

The Role of Bullfighting and FC Barcelona in the Emancipation of Catalonia from Spain (El papel de la corrida de toros y FC Barcelona en la emancipación de Cataluña de España

Directory of Open Access Journals (Sweden)

John A. TKac

2015-06-01

Full Text Available Abstract: This paper looks at the role that bullfighting and FC Barcelona have played in the growing independence movement in Catalonia. This article will discuss nations, the importance of bullfighting and soccer to Iberian cultures, Catalan political parties and their role in the nationalist movement, the vote to prohibit bullfighting and FC Barcelona´s increasing political conscious. I conclude that bullfighting and soccer have been used by political parties and those associated with the nationalist movement to foster feelings of difference with Spain. These feelings have been passed from the top down to the Catalan people and risk alienating those who are not in agreement with the nationalist movement.Resumen: Este trabajo examina el papel que la corrida de toros y el equipo de fútbol FC Barcelona han hecho en el movimiento continuo hacia la independencia en Cataluña. Discute el concepto de la nación, la importancia de las corridas y el fútbol en culturas ibéricas, partidos políticos catalanes y su rol en el voto a favor de la prohibición de las corridas en Cataluña y la evolución de la conciencia política cada vez más evidente de FC Barcelona. Concluyo que los partidos políticos y otros asociados con el movimiento hacia la independencia se han aprovechado de las corridas y el fútbol para destacar diferencias culturales con España. Esta actitud de diferencia se ha trasladado de arriba-abajo al pueblo catalán y el movimiento nacionalista corre el riesgo de alienar a los que no comparten sus creencias.

Análisis de la colaboración entre las empresas biotecnológicas españolas con actividades de I+D y el sistema público de I+D

Directory of Open Access Journals (Sweden)

García-Carpintero, Esther

2014-06-01

Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.

PROYECTOS DE I+D, CARACTERIZACIÓN DEL TIPO DE INVESTIGACIÓN Y EL ROL DE GERENTE DE PROYECTOS

Directory of Open Access Journals (Sweden)

Aníbal N. Cassanelli

2014-12-01

Full Text Available En este artículo se pone de manifiesto la importancia del sector de la I+D y su organización fuertemente proyectizada que la convierte en un área clave para la aplicación de metodologías de gestión de proyectos. Se analizan los modelos de procesos de la I+D para proponer un esquema basado en dominios interrelacionados que permite dar pie a la identificación y caracterización de la investigación básica, aplicada, desarrollo e innovación. A partir de ahí, se comparan las competencias entre el gestor de proyectos general y los investigadores principales (gestores de proyectos de I+D de facto. Se concluye que existe una gran diferencia entre conocimientos y competencias requeridos para la gestión. Se muestran las dos tendencias que existen en el sector de I+D y la propuesta de separación del roles y la creación de una nueva figura distintiva del investigador principal que se ocupe de la gestión de proyectos.

Final PHP bench-scale report for the DOE-ID/SAIC sole source contract

International Nuclear Information System (INIS)

1997-04-01

The Plasma Hearth Process (PHP) Technology Development Project was established to develop, test, and evaluate a new concept for treating mixed waste. The new concept uses direct current (dc) transferred-arc plasma torch technology to process mixed waste into a glass-like end-product. Under the cognizance of the US Department of Energy (DOE) Office of Technology Development (OTD) Mixed Waste Focus Area (MWFA), the technology is being explored for its potential to treat mixed waste. Because it is a mature technology, well-understood and commercially available, it is expected to develop rapidly in this new application. This report summarizes the radioactive bench-scale system activities funded under PHP Sole Source Contract DE-AC07-94ID13266 through the end of the contract

40 CFR Table 25 to Subpart G of... - Effective Column Diameter (Fc)

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Effective Column Diameter (Fc) 25 Table..., Table 25 Table 25 to Subpart G of Part 63—Effective Column Diameter (Fc) Column type Fc (feet) 9-inch by 7-inch built-up columns 1.1 8-inch-diameter pipe columns 0.7 No construction details known 1.0 ...

Le traitement de l’idéologie dans la sociologie de Luc Boltanski

Directory of Open Access Journals (Sweden)

David Vrydaghs

2006-10-01

Full Text Available IntroductionLe concept d’idéologie apparaît dans la sociologie de Luc Boltanski à partir du Nouvel Esprit du capitalisme, publié en 1999. L’auteur y revient dans La Condition fœtale, paru en 2004. On aurait donc pu se contenter de ces ouvrages pour examiner le traitement réservé à l’idéologie dans la sociologie de Luc Boltanski. On préférera pourtant revenir aux travaux antérieurs du sociologue, et ce pour deux raisons.D’abord parce que le concept d’idéologie tel qu’il est employé dans Le Nou...

Comparison Analysis of Coal Biodesulfurization and Coal's Pyrite Bioleaching with Acidithiobacillus ferrooxidans

Science.gov (United States)

Hong, Fen-Fen; He, Huan; Liu, Jin-Yan; Tao, Xiu-Xiang; Zheng, Lei; Zhao, Yi-Dong

2013-01-01

Acidithiobacillus ferrooxidans (A. ferrooxidans) was applied in coal biodesulfurization and coal's pyrite bioleaching. The result showed that A. ferrooxidans had significantly promoted the biodesulfurization of coal and bioleaching of coal's pyrite. After 16 days of processing, the total sulfur removal rate of coal was 50.6%, and among them the removal of pyritic sulfur was up to 69.9%. On the contrary, after 12 days of processing, the coal's pyrite bioleaching rate was 72.0%. SEM micrographs showed that the major pyrite forms in coal were massive and veinlets. It seems that the bacteria took priority to remove the massive pyrite. The sulfur relative contents analysis from XANES showed that the elemental sulfur (28.32%) and jarosite (18.99%) were accumulated in the biotreated residual coal. However, XRD and XANES spectra of residual pyrite indicated that the sulfur components were mainly composed of pyrite (49.34%) and elemental sulfur (50.72%) but no other sulfur contents were detected. Based on the present results, we speculated that the pyrite forms in coal might affect sulfur biooxidation process. PMID:24288464

Le point de vue de la philosophie: L'entreprise idéologique

OpenAIRE

Pesqueux , Yvon

2004-01-01

Parler de l'entreprise conduit à questionner ce qui fonde le discours – scientifique ou médiatique – qui permette d'en parler. Et c'est bien en cela qu'il est nécessaire d'approfondir l'univers de l'idéologie et de la croyance qui est celui dans lequel modèle, image, métaphore et figure de l'entreprise plongent leurs racines dans la mesure où l'usage de ces notions, quand on les applique à l'entreprise, conduit à créer un monde qui soit cohérent avec ce qu'ils portent en eux. L'idéologie comm...

Comparison Analysis of Coal Biodesulfurization and Coal’s Pyrite Bioleaching with Acidithiobacillus ferrooxidans

Directory of Open Access Journals (Sweden)

Fen-Fen Hong

2013-01-01

Full Text Available Acidithiobacillus ferrooxidans (A. ferrooxidans was applied in coal biodesulfurization and coal’s pyrite bioleaching. The result showed that A. ferrooxidans had significantly promoted the biodesulfurization of coal and bioleaching of coal’s pyrite. After 16 days of processing, the total sulfur removal rate of coal was 50.6%, and among them the removal of pyritic sulfur was up to 69.9%. On the contrary, after 12 days of processing, the coal’s pyrite bioleaching rate was 72.0%. SEM micrographs showed that the major pyrite forms in coal were massive and veinlets. It seems that the bacteria took priority to remove the massive pyrite. The sulfur relative contents analysis from XANES showed that the elemental sulfur (28.32% and jarosite (18.99% were accumulated in the biotreated residual coal. However, XRD and XANES spectra of residual pyrite indicated that the sulfur components were mainly composed of pyrite (49.34% and elemental sulfur (50.72% but no other sulfur contents were detected. Based on the present results, we speculated that the pyrite forms in coal might affect sulfur biooxidation process.

Biodesulfurization of Petroleum Distillates—Current Status, Opportunities and Future Challenges

Directory of Open Access Journals (Sweden)

Olawumi O. Sadare

2017-11-01

Full Text Available Sulfur oxide (SO2 and hydrogen sulfide (H2S are considered as one of the major air pollutants in the world today. In addition, high sulfur levels in petroleum distillates can promote the deactivation of catalysts through poisoning in fluidized catalytic cracking (FCC during hydrocracking of the heavy distillates to lighter ones. The presence of high sulfur-containing compounds in the process streams could cause corrosion of piping and fittings and equipment, thereby damaging the pipelines and leading to air emissions of sulfur-containing compounds, which are undesirable for mankind and his environment. In many cases, a large quantity of SOx is released into the atmosphere when petroleum distillates that contain substantial amount of sulphur-containing compounds are used as fuel and combust. In this article, a short overview of different desulfurization methods that are employed to remove sulfur from petroleum distillates is provided. In particular, the review concentrates on biodesulfurization technique. In addition, this article intends to provide its readers current status of biodesulfurization (BDS. It critically analyses the trend in the development of the technology to showcase its strength and weakness that could pave a way for future opportunities. Approaches that are suitable to remediate sulfur-contaminated environment are discussed as well. Lastly, speculations on future directions or opportunities that require exploration are provided as a way of provoking the thoughts of researchers in this field.

Final Report - Advanced Cathode Catalysts and Supports for PEM Fuel Cells

Energy Technology Data Exchange (ETDEWEB)

Debe, Mark

2012-09-28

The principal objectives of the program were development of a durable, low cost, high performance cathode electrode (catalyst and support), that is fully integrated into a fuel cell membrane electrode assembly with gas diffusion media, fabricated by high volume capable processes, and is able to meet or exceed the 2015 DOE targets. Work completed in this contract was an extension of the developments under three preceding cooperative agreements/grants Nos. DE-FC-02-97EE50473, DE-FC-99EE50582 and DE-FC36- 02AL67621 which investigated catalyzed membrane electrode assemblies for PEM fuel cells based on a fundamentally new, nanostructured thin film catalyst and support system, and demonstrated the feasibility for high volume manufacturability.

ID.alistic: identificatie met een touch voor de patiënt

NARCIS (Netherlands)

M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben

2017-01-01

ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door

Substratos renováveis na produção de mudas de Ficus enormis proveniente de jardim clonal

Directory of Open Access Journals (Sweden)

Rosimeri de Oliveira Fragoso

2017-01-01

Full Text Available Objetivou-se avaliar substratos renováveis à base de casca de arroz carbonizada (CAC e fibra de coco (FC sobre o enraizamento e qualidade final de mudas de Ficus enormis Mart. ex Miq. via estaquia caulinar de plantas provenientes de jardim clonal. Foram avaliados seis substratos: comercial (controle, composto por casca de arroz carbonizada (CAC, fibra de coco (FC e vermiculita (S1; 100% FC (S2; 100% CAC (S3; 50% FC e 50% CAC (S4; 30% (FC e 70% CAC (S5; 70% FC e 30% CAC (S6. O substrato comercial (S1 e as composições com maior proporção de FC apresentam qualificação superior para a produção de mudas de F. enormis.

Generation and Characterization of an IgG4 Monomeric Fc Platform.

Directory of Open Access Journals (Sweden)

Lu Shan

Full Text Available The immunoglobulin Fc region is a homodimer consisted of two sets of CH2 and CH3 domains and has been exploited to generate two-arm protein fusions with high expression yields, simplified purification processes and extended serum half-life. However, attempts to generate one-arm fusion proteins with monomeric Fc, with one set of CH2 and CH3 domains, are often plagued with challenges such as weakened binding to FcRn or partial monomer formation. Here, we demonstrate the generation of a stable IgG4 Fc monomer with a unique combination of mutations at the CH3-CH3 interface using rational design combined with in vitro evolution methodologies. In addition to size-exclusion chromatography and analytical ultracentrifugation, we used multi-angle light scattering (MALS to show that the engineered Fc monomer exhibits excellent monodispersity. Furthermore, crystal structure analysis (PDB ID: 5HVW reveals monomeric properties supported by disrupted interactions at the CH3-CH3 interface. Monomeric Fc fusions with Fab or scFv achieved FcRn binding and serum half-life comparable to wildtype IgG. These results demonstrate that this monomeric IgG4 Fc is a promising therapeutic platform to extend the serum half-life of proteins in a monovalent format.

Molecular biological enhancement of coal biodesulfurization. [Rhodococcus rhodochrous

Energy Technology Data Exchange (ETDEWEB)

Kilbane, J.J.; Bielaga, B.A.

1990-07-01

The overall objective of this project is to sue molecular genetics to develop strains of bacteria with enhanced ability to remove sulfur from coal and to obtain data that will allow the performance and economics of a coal biodesulfurization process to be predicted. The work planned for the current quarter (May 1990 to July 1990) includes the following activities: (1) Construct a cloning vector that can be used in Rhodococcus rhodochrous IGTS8 from the small cryptic plasmid found in Rhodococcus rhodochrous ATCC 190607; (2) Develop techniques for the genetic analysis of IGTS8; (3) Continue biochemical experiments, particularly those that may allow the identification of desulfurization-related enzymes; (4) Continue experiments with coal to determine the kinetics of organic sulfur removal.

Théorie de la justice et idéologie : Hume et Rawls

Directory of Open Access Journals (Sweden)

Eléonore Le Jallé

2008-04-01

Full Text Available Les points d’accord entre Rawls et Hume vont au-delà du seul repérage des « circonstances de la justice ». Même si Hume se trouve attaché à la théorie utilitariste de l’impartialité que Rawls rejette, Hume n’est pas, selon Rawls, « à proprement parler » utilitariste : il a su reconnaître l’idée selon laquelle les institutions doivent fonctionner dans l’intérêt de chacun. L’idée d’une coopération sociale en vue de l’avantage mutuel est donc commune à ces deux auteurs. Ils partagent, en outre, une attitude similaire face au « problème de la confiance » en lien avec la stabilité de la justice : l’un et l’autre ajoutent ainsi à la solution extérieure qu’est l’institution étatique, un facteur intrinsèque de stabilité, à savoir, le sens de la justice. L’idée de « justice procédurale » et le rejet, corrélatif, d’un critère indépendant du juste, les relie également ; d’où, enfin, une certaine analogie des critiques respectivement adressées à ces deux auteurs.The specification of the “circumstances of justice” is not the only point on which Rawls agrees with Hume. If Rawls rejects the utilitarian theory of impartiality which is “reminiscent of Hume”, he does not consider him as “strictly speaking utilitarian”. Indeed, Rawls thinks that Hume has well understood that institutions have to be to the advantage of everyone. Besides, Hume and Rawls agree in thinking that the stability of justice involves a public sense of justice. Finally, the idea of “pure procedural justice” is shared by these authors: both have rejected any independent criterion for the right result, so that the ways they were criticized are rather similar.

El rendimiento en el fútbol. Una modelización de las variables determinantes para el F.C. Barcelona

Directory of Open Access Journals (Sweden)

Carlos Lago Peñas

2007-12-01

Full Text Available El objetivo del presente trabajo es explicar las variables que determinan el rendimiento que alcanza el F.C. Barcelona a lo largo de un partido de fútbol. Para ello se han analizado los 38 partidos disputados por el F.C. Barcelona en la Primera División de la Liga Española de Fútbol de la temporada 2004-2005. La variable que mide el rendimiento es la diferencia entre los lanzamientos a favor y los lanzamientos en contra en cada partido. Las variables explicativas que se manejan son: jugar en casa o fuera, posesión del balón, llegadas al área y equipo rival como determinantes del rendimiento. Los resultados de los análisis de regresión lineal permiten explicar el 68 % de la varianza del rendimiento. El segundo objetivo es valorar la homogeneidad del modelo anterior dependiendo del Episodio de Juego que caracteriza al partido en cada momento, esto es, si el F.C. Barcelona tiene la iniciativa o está a la expectativa en el juego. Los resultados indican que cuando el F.C. Barcelona tiene la iniciativa en el partido tiene un rendimiento mejor que cuando se encuentra a la expectativa y que las variables explicativas analizadas tienen diferente importancia bajo estos escenarios de competición.

Influencia de la concentración de hierro y pH iniciales en un proceso de biodesulfurización de carbón – ensayos a nivel de laboratorio

Directory of Open Access Journals (Sweden)

Gerardo Andrés Caicedo Pineda

2011-07-01

Full Text Available Título en ingles: Particle size, iron concentration and pH influence in biodesulfurization process of coal – laboratory tests   Resumen   A un carbón proveniente del municipio de Puerto Libertador, Córdoba-Colombia (2.34% de azufre total, con 1.34% pirítico, 0.90% orgánico y 0.10% de sulfatos, se le aplicó un cultivo mixto de Acidithiobacillus ferrooxidans y Acidithiobacillus thiooxidans, con el fin de evaluar procesos de biodesulfurización en suspensión, a partir de variables que influyen en el proceso: concentración inicial de hierro y pH de la solución lixiviante, bajo dos configuraciones de tamaño de partícula: pasante malla 8 (-malla 8 y pasante malla 60 (-malla 60, acorde con la serie Tyler de tamices. Los procesos de biodesulfurización se evaluaron cada dos días, mediante mediciones de la concentración de hierro, pH, potencial de óxido-reducción y crecimiento celular, en la solución. A partir de los ensayos realizados, se alcanzaron oxidaciones de azufre pirítico por encima del 50%, después de 12 días de proceso. Se pudo constatar que tanto el tipo de carbón tratado, como de las condiciones evaluadas, inciden en el grado de lixiviación alcanzado. La mejor eficiencia del proceso se observó al utilizar concentraciones de hierro iniciales menores a 1200 ppm y un pH inicial entre 1.5 y 1.3.   Palabras clave: Acidithiobacillus, biodesulfurización, carbón, hierro removido, pirita.   Abstract   Biodesulfurization process for Colombian coal (2.34% total sulfur: 1.34% as pyritic, 0.90% as organic and 0.10% from sulfates from municipality of Puerto Libertador (Córdoba, Colombia was carried out. A mixed culture of A. ferrooxidans and A. thiooxidans was used. The study was mainly focused on the influence of pH, and iron concentration in coal leaching process. Two mineral particle sizes were evaluated: less 8 mesh (-malla 8 and less 60 mesh (-malla 60, Tyler series. Biodesulfurization processes were determined by

Production and characterization of Talf1 yeast invertases and further application to biodesulfurization

OpenAIRE

Arez, B. F.; Alves, Luís Manuel; Paixão, Susana M.

2013-01-01

Combustion of fossil fuels generates emissions of numerous toxic gases which in later years have become a major concern internationally. One of the most concerning problems is sulfur and sulfur dioxide, and maximum levels have been established through the years. Biodesulfurization (BDS) could be a complementary technology to the commonly used physico-chemical process. BDS is based on the use of microorganisms for the removal of sulfur even from the most recalcitrant compounds at atmospher...

10 CFR 51.97 - Final environmental impact statement-materials license.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Final environmental impact statement-materials license. 51...-Regulations Implementing Section 102(2) Final Environmental Impact Statements-Materials Licenses § 51.97 Final environmental impact statement—materials license. (a) Independent spent fuel storage installation (ISFSI...

DIFERENTES MODELOS DE REGRESIÓN PARA DESCRIBIR LA RELACIÓN V.O2-FC Y PARA ESTIMAR EL V.O2 A DIFERENTES INTENSIDADES DE ESFUERZO

Directory of Open Access Journals (Sweden)

Nuria Garatachea Vallejo

2005-01-01

Full Text Available Muchos son los estudios que demuestran el potencial de la frecuencia cardiaca (FC para estimar el coste energético de una actividad física, ya que se relaciona directamente con el consumo de oxígeno (V. O2. La mayoría de estudios describen la relación V. O2- FC como lineal para un amplio rango de esfuerzo, exceptuando los valores de reposo aunque se han propuesto diferentes funciones matemáticas continuas no lineales sin existir todavía un acuerdo en la ecuación más apropiada. También existen estudios que apuntan un cambio en la relación V. O2-FC en función de la intensidad del esfuerzo. Nuestro objetivo fue determinar cuál es la mejor función matemática que describe la relación entre la FC y el V. O2 y decidir cuál es la mejor función matemática para estimar el V. O2 a diferentes intensidades de esfuerzo. Participaron 14 sujetos que realizaron una prueba de esfuerzo máxima sobre cicloergómetro y una prueba que consistía en pedalear a 5 intensidades de esfuerzo (40, 50, 60, 70 y 80% del V. O2max durante 3 minutos. Durante ambas pruebas se midió V. O2 y frecuencia cardiaca. El modelo lineal y potencial fueron los modelos matemáticos más exactos para describir la relación V. O2-FC. El mayor error de estimación se produjo a bajas intensidades de esfuerzo. En conclusión, la elección de un tipo u otro de regresión influye en la exactitud del método de monitorización de la frecuencia cardiaca.

Final Report

Energy Technology Data Exchange (ETDEWEB)

DeTar, Carleton [P.I.

2012-12-10

This document constitutes the Final Report for award DE-FC02-06ER41446 as required by the Office of Science. It summarizes accomplishments and provides copies of scientific publications with significant contribution from this award.

Trasplante renal con HLA idéntico de donante vivo y cadavérico: experiencia de la Fundación Valle de Lili, Cali, Colombia

OpenAIRE

Caicedo, Luis Armando; Gómez-Vega, Juan Carlos; Duque, Mauricio Francisco; Serrano, Óscar Javier; Manzi, Eliana; Arrunátegui, Ana María; Posada, Juan Guillermo; Mesa, Liliana; Schweineberg, Johanna; Durán, Carlos Eduardo; Villegas, Jorge Iván; Dávalos, Diana María; Echeverri, Gabriel Jaime

2016-01-01

Introducción: En el trasplante renal con HLA idéntico los episodios de rechazo agudo son menores y tienen mejores tasas de supervivencia del injerto, comparado con los receptores con HLA no idéntico; a pesar de esto, persiste el dilema en cuanto al retiro o la disminución de la dosis de inmunosupresión. El objetivo de este trabajo es describir la experiencia de los trasplantes renales con HLA idéntico de donante vivo y cadavérico que se han realizado en la Fundación Valle del Lili desde 1995 ...

Apuntes sobre el tesoro del bronce final llamado de Valdeobispo

Directory of Open Access Journals (Sweden)

Enríquez Navascues, Juan Javier

1991-12-01

Full Text Available The Valdeobispo hoard (Cáceres, Extremadura consists of one necklace and four sol id gold-bracclcts, whose typology is rclatcd to thc final Bronze Age goldwork characterizcd by the influence of Atlantic metallurgy. The most intcresting piece is the necklace, which is very similar to the ones from the Berzocana and Baiocs' hoards.

El tesorillo que se ha denominado de Valdeobispo (Cáceres, Extremadura está constituido por un collar y cuatro brazaletes de oro macizo, cuya tipología lo relaciona con la orfebrería del Bronce final caracterizada por el influjo de las corrientes metalúrgicas atlánticas. La pieza más interesante es el collar, muy parecido a los de los tesoros de Berzocana y Baioes.

Final Scientific/Technical Report for award DE-FC--07-00AL67053

International Nuclear Information System (INIS)

Dixon, Cathy

2005-01-01

The project ''Creating an Educational Consortium to Support the Recruitment and Retention of Expertise for the Nuclear Weapons Complex'' was also known as the Advanced Fuel Cycle Initiative (AFCI) University Fellowship Program. Since its inception, the Advanced Fuel Cycle Initiative program and its predecessor, the Advanced Accelerator Applications (AAA) program, have engaged university researchers and students in the sciences necessary to answer technical questions related to reducing high-level waste volumes, optimizing the economics and performance of Yucca Mountain, reducing the technical need for a second repository, reducing the long-term inventories of plutonium in spent fuel, and enabling the proliferation-resistant recovery of the energy contained in spent fuel. The Advanced Fuel Cycle University Fellowship Program is intended to support top students across the nation in a variety of disciplines that will be required to support transmutation research and technology development in the coming decades

SISTEMA DE MEMORIA ORGANIZACIONAL PARA CENTROS I+D DE UNA INSTITUCIÓN DE EDUCACIÓN SUPERIOR

Directory of Open Access Journals (Sweden)

Ruth Reátegui

2015-01-01

Full Text Available El objetivo del artículo es proponer un modelo de Sistemas de Memoria Organizacional (SMO para un centro de Investigación y Desarrollo (I+D basado en cuatro componentes: social, cultural, tecnológico y de procesos para una IES de Ecuador. Las instituciones de educación superior (IES son organizaciones donde la investigación es una de sus actividades fundamentales que requiere una adecuada gestión del conocimiento. Para esta propuesta se utilizó un método de investigación inductiva basado en entrevistas a los docentes involucrados para conocer las actividades y procesos que conlleva el desarrollo de este tipo de proyectos. Los SMO permiten preservar el conocimiento para ser utilizarlo en las actividades actuales y futuras. Uno de los problemas encontrados es que no se está conservando ni mucho menos compartiendo el conocimiento que las personas poseen como resultado de experiencias, prácticas, actitudes, entre otros aspectos, relacionados con los proyectos. Además el modelo resultante se implementó en un sistema basado en software libre y tecnologías web. La implementación de este modelo muestra como resultado un alto nivel de aceptación por parte de directivos e inves tigadores de los centros de I+D

Multivalent Fcγ-receptor engagement by a hexameric Fc-fusion protein triggers Fcγ-receptor internalisation and modulation of Fcγ-receptor functions.

Science.gov (United States)

Qureshi, O S; Rowley, T F; Junker, F; Peters, S J; Crilly, S; Compson, J; Eddleston, A; Björkelund, H; Greenslade, K; Parkinson, M; Davies, N L; Griffin, R; Pither, T L; Cain, K; Christodoulou, L; Staelens, L; Ward, E; Tibbitts, J; Kiessling, A; Smith, B; Brennan, F R; Malmqvist, M; Fallah-Arani, F; Humphreys, D P

2017-12-06

Engagement of Fcγ-receptors triggers a range of downstream signalling events resulting in a diverse array of immune functions. As a result, blockade of Fc-mediated function is an important strategy for the control of several autoimmune and inflammatory conditions. We have generated a hexameric-Fc fusion protein (hexameric-Fc) and tested the consequences of multi-valent Fcγ-receptor engagement in in vitro and in vivo systems. In vitro engagement of hexameric-Fc with FcγRs showed complex binding interactions that altered with receptor density and triggered the internalisation and degradation of Fcγ-receptors. This caused a disruption of Fc-binding and phagocytosis. In vivo, in a mouse ITP model we observed a short half-life of hexameric-Fc but were nevertheless able to observe inhibition of platelet phagocytosis several days after hexameric-Fc dosing. In cynomolgus monkeys, we again observed a short half-life, but were able to demonstrate effective FcγR blockade. These findings demonstrate the ability of multi-valent Fc-based therapeutics to interfere with FcγR function and a potential mechanism through which they could have a sustained effect; the internalisation and degradation of FcγRs.

Saúde coletiva: história de uma idéia e de um conceito

Directory of Open Access Journals (Sweden)

Everardo Duarte Nunes

1994-12-01

Full Text Available O presente trabalho procura resgatar de forma sintética a trajetória histórica e conceitual da "Saúde Coletiva", evidenciando as suas raízes nos projetos preventivistas e da medicina social. Estes projetos, que se estenderam a partir dos anos 50 e que culminam com a idéia da chamada "Saúde Coletiva", apresentam aspectos que os diferenciam na apreensão do social e do coletivo. Ao tratar especificamente da idéia de uma Saúde Coletiva, o texto aponta para a sua tríplice dimensão: como corrente de pensamento, como movimento social e como prática teórica.

Estudio de los gastos de I+D :un análisis empírico en el sector del automóvil

Directory of Open Access Journals (Sweden)

Teresa Duarte Atoche, Ph.D

2012-07-01

Full Text Available La diferencia existente entre la información económico-financiera que divulgan las empresas y las necesidades informativas de los usuarios, han sido motivo de preocupación e interés creciente en el ámbito académico. La mayoría de las investigaciones sostienen que dicha diferencia viene explicada en gran medida por los activos intangibles desarrollados internamente, entre ellos los gastos de I+D .Actualmente sigue teniendo gran interés pues los organismos emisores de normas internacionales se encuentran en un proceso de armonización, en aras de revestir de utilidad de los actuales sistemas contables. El presente trabajo de investigación trata de contrastar la relevancia y fiabilidad de la información sobre I+D ,para ello, emplea, como función base, el modelo de Ohlson (1995. Los resultados rechazan la relevancia de los gastos de I+D corriente para valorar a las compañías cotizadas.

Estudio de los gastos de I+D: un análisis empírico en el sector del automóvil

Directory of Open Access Journals (Sweden)

TERESA DUARTE ATOCHE

2012-01-01

Full Text Available La diferencia existente entre la información económico-financiera que divulgan las empresas y las necesidades informativas de los usuarios, han sido motivo de preocupación e interés creciente en el ámbito académico. La mayoría de las investigaciones sostienen que dicha diferencia viene explicada en gran medida por los activos intangibles desarrollados internamente, entre ellos los gastos de I+D. Actualmente sigue teniendo gran interés pues los organismos emisores de normas internacionales se encuentran en un proceso de armonización, en aras de revestir de utilidad de los actuales sistemas contables. El presente trabajo de investigación trata de contrastar la relevancia y fiabilidad de la información sobre I+D, para ello, emplea, como función base, el modelo de Ohlson (1995. Los resultados rechazan la relevancia de los gastos de I+D corriente para valorar a las compañías cotizadas.

Controlling DIII-D QH-Mode Particle and Electron Thermal Transport with ECH

Science.gov (United States)

Ernst, D. R.; Burrell, K. H.; Rhodes, T. L.; Guttenfelder, W.; McKee, G. R.; Grierson, B. A.; Holland, C.; Dimits, A.; Petty, C. C.; Schmitz, L.; Wang, G.; Zeng, L.; Doyle, E. J.; Austin, M. E.

2014-10-01

Quiescent H-mode core particle transport and density peaking are locally controlled by modulated electron cyclotron heating (ECH) at ρ ~ 0 . 2 . Gyrokinetic simulations show density gradient driven trapped electron modes (TEMs) are only unstable in the inner core, where the density profile flattens in response to ECH. Thus α-heating could reduce density peaking, providing burn control. Density fluctuations from Doppler backscattering intensify at TEM wavenumbers kθρs ~ 0 . 8 during ECH, while new quasi-coherent modes are observed with adjacent toroidal mode numbers consistent with TEMs. Separately, ECH at two-deposition locations (r / a ~ ρ = 0 . 5 & 0.7) varied the electron temperature gradient. A jump in ``heat pulse'' diffusivity during the scan indicates a critical gradient was crossed. Work supported by the US DOE under DE-FC02-08ER54966, DE-FC02-04ER54698, DE-FG02-08ER54984, DE-AC02-09CH11466, DE-FG02-89ER53296, DE-FC02-11ER55104, DE-AC52-07NA27344 & DE-FG03-97ER54415.

Validez y fiabilidad del Researcher ID y de «Web of Science Production of Spanish Psychology»

Directory of Open Access Journals (Sweden)

José Alonso Olivas-Ávila

2014-01-01

Full Text Available La creación de sistemas integradores de productos de investigación, como el Researcher ID de Thomson Reuters, ha sido una necesidad emergente debido a lo complejo que es para los investigadores demostrar de manera periódica el impacto y difusión de su investigación. Sin embargo, estos sistemas se alimentan de información proveniente de las diversas bases de datos y cada vez son más inclusivos para captar productos de investigación. Varios estudios bibliométricos han demostrado que las bases de datos contienen imprecisiones de varios tipos, que afectan directamente a los sistemas integradores. Como consecuencia, se plantea este estudio descriptivo con el fin de analizar la precisión de los registros del Researcher ID de los miembros del consejo de www.psy-wos.es y de una muestra de usuarios de esta página para cotejar los registros con los contenidos en la base de datos Web of Science, diferenciándolos de contenidos ajenos a esta base de datos. Los resultados reflejan que existen imprecisiones y errores considerables en los Researcher ID de la muestra analizada, tales como duplicidad de registros y la inclusión de registros ajenos a la Web of Science. Se concluye que los Resercher ID así como el www.psy-wos.es no son válidos ni fiables.

Optimal football strategies: AC Milan versus FC Barcelona

OpenAIRE

Papahristodoulou, Christos

2012-01-01

In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

Simultaneously saccharification and fermentation approach as a tool for enhanced fossil fuels biodesulfurization.

Science.gov (United States)

Paixão, Susana M; Arez, Bruno F; Roseiro, José C; Alves, Luís

2016-11-01

Biodesulfurization can be a complementary technology to the hydrodesulfurization, the commonly physical-chemical process used for sulfur removal from crude oil. The desulfurizing bacterium Gordonia alkanivorans strain 1B as a fructophilic microorganism requires fructose as C-source. In this context, the main goal of this work was the optimization of a simultaneous saccharification and fermentation (SSF) approach using the Zygosaccharomyces bailii strain Talf1 crude enzymes with invertase activity and sucrose as a cheaper fructose-rich commercial C-source (50% fructose) towards dibenzothiophene (DBT) desulfurization by strain 1B. The determination of optimal conditions, for both sucrose hydrolysis and DBT desulfurization was carried out through two sequential experimental uniform designs according to the Doehlert distribution for two factors: pH (5.5-7.5) and temperature (28-38 °C), with the enzyme load of 1.16 U/g/L; and enzyme load (0-4 U/g/L) and temperature (28-38 °C), with pH at 7.5. Based on 2-hydroxybiphenyl production, the analysis of the response surfaces obtained pointed out for pH 7.5, 32 °C and 1.8 U/g/L as optimal conditions. Further optimized SSF of sucrose during the DBT desulfurization process permitted to attain a 4-fold enhanced biodesulfurization. This study opens a new focus of research through the exploitation of sustainable low cost sucrose-rich feedstocks towards a more economical viable bioprocess scale-up. Copyright © 2016 Elsevier Ltd. All rights reserved.

Final Technical Report for DOE Award DE-FG07-00ID13890

Energy Technology Data Exchange (ETDEWEB)

Timothy R. Titus

2006-02-28

The ITRC is a state-led national coalition dedicated to developing tools and strategies to overcome barriers and enable the deployment of beneficial new environmental technologies. ITRC works in partnership with federal agencies, industry, academia, and public and tribal stakeholders to develop these tools and strategies and means of disseminating the tools to state environmental regulators, and technology users

Sistema de memoria organizacional para centros I+D de una institución de educación superior

Directory of Open Access Journals (Sweden)

Ruth Reátegui, Ana Poma

2015-05-01

Full Text Available El objetivo del artículo es proponer un modelo de Sistemas de Memoria Organizacional (SMO para un centro de Investigación y Desarrollo (I+D basado en cuatro componentes: social, cultural, tecnológico y de procesos para una IES de Ecuador. Las instituciones de educación superior (IES son organizaciones donde la investigación es una de sus actividades fundamentales que requiere una adecuada gestión del conocimiento. Para esta propuesta se utilizó un método de investigación inductiva basado en entrevistas a los docentes involucrados para conocer las actividades y procesos que conlleva el desarrollo de este tipo de proyectos. Los SMO permiten preservar el conocimiento para ser utilizarlo en las actividades actuales y futuras. Uno de los problemas encontrados es que no se está conservando ni mucho menos compartiendo el conocimiento que las personas poseen como resultado de experiencias, prácticas, actitudes, entre otros aspectos, relacionados con los proyectos. Además el modelo resultante se implementó en un sistema basado en software libre y tecnologías web. La implementación de este modelo muestra como resultado un alto nivel de aceptación por parte de directivos e investigadores de los centros de I+D.

Voix des peuples et idée de nation chez Herder

Directory of Open Access Journals (Sweden)

Mario Longo

2005-01-01

Full Text Available L'idée de nation se manifeste dans le contexte de la pensée herderienne du langage, en polémique avec les idéaux cosmopolites du siècle des Lumières. En niant une nature humaine toujours égale et sans différences qualitatives, Herder soutient l'originalité de chaque moment du développement historique, compte tenu de la nature linguistique, et donc historique, de l'homme. En utilisant une métaphore suggérée par Herder, l'humanité est un concert polyphonique, d'autant plus majestueux et harmonique que son orchestration est riche et nombreuse. Écouter la voix des peuples pour comprendre l'homme dans son expression la plus étendue: ceci est l'objectif des recherches linguistiques et historico-littéraires du jeune Herder aboutissant dans l'imposant tableau historique de Auch eine Philosophie der Geschichte. Cette vision de l'histoire, qui tend à mettre en valeur le fragment et les parties, ne conduit pas toutefois au relativisme historique, à la négation du sens universel de l'histoire, mais vise à critiquer un modèle de cosmopolitisme à la Voltaire, froid et abstrait, qui ne sait comprendre et aimer que soi-même, ayant glorifié à tel point le principe de sa propre culture qu'il reste indifférent à toutes les autres manifestations de la vie des peuples. Il en ressort, d'un côté, une vive appréciation pour l'âme de chaque peuple, âme qui par la magie du langage vit dans ses expressions les plus authentiques dans la poésie, dans les mythes et dans la religion, et, d'autre part, la primauté attribuée à ces facteurs spirituels de la vie des peuples par rapport à l'organisation politique de l'état. L'idée de nation pour Herder ne se résout donc pas dans la négation du cosmopolitisme, mais plutôt dans le refus de ce cosmopolitisme basé sur la politique, propre du siècle des Lumières, qui avait fait de la création de l'État-machine un modèle que l'on aurait voulu imposer à tous les peuples de la terre.

Aplicación de GHSOM (Growing Hierarchical Self-Organizing Maps a sistemas de detección de intrusos (IDS

Directory of Open Access Journals (Sweden)

Eduardo Miguel De la Hoz

2012-01-01

Full Text Available Con el pasar de los años, en el ámbito de la seguridad informática el problema de la intrusión se desarrolla cada día más, incrementando la existencia de programas que buscan afectar a computadoras tanto a nivel local como a toda una red informática. Esta dinámica lleva a entender los ataques y la mejor manera de contrarrestarlos, ya sea previniéndolos o detectándolos a tiempo, procurando que su impacto sea menor al esperado por el atacante. En este artículo se presenta una revisión de los ataques a sistemas informáticos, ahondando en los Sistemas de Detección de Intrusos (IDS y en la implementación de técnicas de agrupamiento de datos —como las redes neuronales—, con el fin de encontrar métodos con altas precisiones en la detección de anomalías. Esta propuesta presenta la aplicación de GHSOM en IDS, utilizando el conjunto de datos NSL-KDD, y mostrando las mejoras encontradas en la detección de ataques en el proceso de búsqueda.

Evolucion de las habilidades y la estructura ocupacional: un estudio del sector de I+D

OpenAIRE

Elche Hortelano, Dioni; Consoli, Davide

2014-01-01

Este trabajo se centra en el estudio del sector de servicios de I+D por su importancia actual, contextualizado en Estados Unidos (EE.UU.) debido a los antecedentes históricos del sector, y porque éste ha sido un país pionero en el desarrollo de este tipo de servicios. Analizamos la estructura ocupacional a partir del nivel de empleo, los requisitos de formación y las habilidades requeridas a los empleados para trabajar en cada una de las ocupaciones del sector. En concreto, el objetivo princi...

Producción de anticuerpos policlonales IgG contra la proteina iduronato-2-sulfato sulfatasa y desarrollo de un sistema de detección para IDS humana recombinante.

Directory of Open Access Journals (Sweden)

Olga Peña

2005-06-01

Full Text Available Introducción. La enfermedad de Hunter es un trastorno lisosómico caracterizado por la deficiencia de la enzima iduronato-2-sulfato sulfatasa (IDS (EC 3.1.6.13. Esta enfermedad, al igual que muchos trastornos metabólicos, son patologías intratables mediante la terapéutica convencional; sin embargo, existe la posibilidad de ser tratada alternativamente mediante terapia génica o terapia de reemplazo enzimático. Objetivo. El Instituto de Errores Innatos del Metabolismo (IEIM ha desarrollado un sistema de expresión de sulfatasas para producir IDS humana recombinante (IDShr en Escherichia coli y Pichia pastoris, con resultados favorables. El objetivo principal de este trabajo fue desarrollar un sistema de detección de IDS humana recombinante. Materiales y métodos. Para el efecto, se inmunizaron con IDS comercial de TKT (Cambridge, MA dos conejos de raza Nueva Zelanda blanca y los anticuerpos purificados a partir del suero se utilizaron en el desarrollo de una técnica semicuantitativa por dot-blot. Diferentes muestras de extractos crudos de fermentaciones con P. pastoris y E. coli se procesaron con el fin de poder determinar la presencia de la enzima. Resultados. Se demostró que los anticuerpos eran específicos en el reconocimiento de la IDS sin presentar reactividad cruzada con proteínas contaminantes de los extractos crudos. Conclusión. Por consiguiente, los anticuerpos se podrán usar en el desarrollo de una técnica ELISA tipo sandwich como método de detección y cuantificación de la enzima y en procesos de purificación de la misma mediante cromatografía de afinidad.

Diesel Engine Light Truck Application

Energy Technology Data Exchange (ETDEWEB)

None

2007-12-31

The Diesel Engine Light Truck Application (DELTA) program consists of two major contracts with the Department of Energy (DOE). The first one under DE-FC05-97-OR22606, starting from 1997, was completed in 2001, and consequently, a final report was submitted to DOE in 2003. The second part of the contract was under DE-FC05-02OR22909, covering the program progress from 2002 to 2007. This report is the final report of the second part of the program under contract DE-FC05-02OR22909. During the course of this contract, the program work scope and objectives were significantly changed. From 2002 to 2004, the DELTA program continued working on light-duty engine development with the 4.0L V6 DELTA engine, following the accomplishments made from the first part of the program under DE-FC05-97-OR22606. The program work scope in 2005-2007 was changed to the Diesel Particulate Filter (DPF) soot layer characterization and substrate material assessment. This final report will cover two major technical tasks. (1) Continuation of the DELTA engine development to demonstrate production-viable diesel engine technologies and to demonstrate emissions compliance with significant fuel economy advantages, covering progress made from 2002 to 2004. (2) DPF soot layer characterization and substrate material assessment from 2005-2007.

Três idéias sedutoras e quatro sugestões preciosas: algumas reflexões de Jerome Kagan

Directory of Open Access Journals (Sweden)

José Fernando Bitencourt Lomônaco

Full Text Available São consideradas três idéias, denominadas por Jerome Kagan idéias sedutoras pela sua capacidade de se apresentarem como intuitivamente verdadeiras. A primeira é a de que processos psicológicos tais como inteligência, consciência, etc, podem ser amplamente generalizados para uma ampla gama de situações. A segunda refere-se ao determinismo infantil, à crença de que as primeiras experiências infantis constituem uma influência determinante no desenvolvimento. A terceira é relativa ao princípio do prazer, à noção de que o comportamento humano é regido fundamentalmente pela busca do prazer. Fundamentado em dados de diferentes áreas do conhecimento, Kagan demonstra a falácia de cada uma dessas idéias e apresenta quatro sugestões construtivas para aqueles que trabalham nas ciências sociais e comportamentais.

DeID – A Data Sharing Tool for Neuroimaging Studies

Directory of Open Access Journals (Sweden)

Xuebo eSong

2015-09-01

Full Text Available Funding institutions and researchers increasingly expect that data will be shared to increase scientific integrity and provide other scientists with the opportunity to use the data with novel methods that may advance understanding in a particular field of study. In practice, sharing human subject data can be complicated because data must be de-identified prior to sharing. Moreover, integrating varied data types collected in a study can be challenging and time consuming. For example, sharing data from structural imaging studies of a complex disorder requires the integration of imaging, demographic and/or behavioral data in a way that no subject identifiers are included in the de-identified dataset and with new subject labels or identification values that cannot be tracked back to the original ones. We have developed a Java program that users can use to remove identifying information in neuroimaging datasets, while still maintaining the association among different data types from the same subject for further studies. This software provides a series of user interaction wizards to allow users to select data variables to be de-identified, implements functions for auditing and validation of de-identified data, and enables the user to share the de-identified data in a single compressed package through various communication protocols, such as FTPS and SFTP. DeID runs with Windows, Linux, and Mac operating systems and its open architecture allows it to be easily adapted to support a broader array of data types, with the goal of facilitating data sharing. DeID can be obtained at http://www.nitrc.org/projects/deid.

40 CFR 230.97 - Management.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Management. 230.97 Section 230.97... Losses of Aquatic Resources § 230.97 Management. (a) Site protection. (1) The aquatic habitats, riparian.... For government property, long-term protection may be provided through federal facility management...

40 CFR 97.73 - Notifications.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Notifications. 97.73 Section 97.73 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Monitoring and Reporting § 97.73...

40 CFR 97.355 - Banking.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.355 Section 97.355 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... System § 97.355 Banking. (a) CAIR NOX Ozone Season allowances may be banked for future use or transfer in...

Spray Forming Aluminum - Final Report (Phase II)

Energy Technology Data Exchange (ETDEWEB)

D. D. Leon

1999-07-08

The U.S. Department of Energy - Office of Industrial Technology (DOE) has an objective to increase energy efficient and enhance competitiveness of American metals industries. To support this objective, ALCOA Inc. entered into a cooperative program to develop spray forming technology for aluminum. This Phase II of the DOE Spray Forming Program would translate bench scale spray forming technology into a cost effective world class process for commercialization. Developments under DOE Cooperative Agreement No. DE-FC07-94ID13238 occurred during two time periods due to budgetary constraints; April 1994 through September 1996 and October 1997 and December 1998. During these periods, ALCOA Inc developed a linear spray forming nozzle and specific support processes capable of scale-up for commercial production of aluminum sheet alloy products. Emphasis was given to alloys 3003 and 6111, both being commercially significant alloys used in the automotive industry. The report reviews research performed in the following areas: Nozzel Development, Fabrication, Deposition, Metal Characterization, Computer Simulation and Economics. With the formation of a Holding Company, all intellectual property developed in Phases I and II of the Project have been documented under separate cover for licensing to domestic producers.

Molecular biological enhancement of coal biodesulfurization. Seventh quarter report, May--July 1990

Energy Technology Data Exchange (ETDEWEB)

Kilbane, J.J.; Bielaga, B.A.

1990-07-01

The overall objective of this project is to sue molecular genetics to develop strains of bacteria with enhanced ability to remove sulfur from coal and to obtain data that will allow the performance and economics of a coal biodesulfurization process to be predicted. The work planned for the current quarter (May 1990 to July 1990) includes the following activities: (1) Construct a cloning vector that can be used in Rhodococcus rhodochrous IGTS8 from the small cryptic plasmid found in Rhodococcus rhodochrous ATCC 190607; (2) Develop techniques for the genetic analysis of IGTS8; (3) Continue biochemical experiments, particularly those that may allow the identification of desulfurization-related enzymes; (4) Continue experiments with coal to determine the kinetics of organic sulfur removal.

40 CFR 97.301 - Purpose.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Purpose. 97.301 Section 97.301 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... and nitrogen oxides. ...

29 CFR 97.33 - Supplies.

Science.gov (United States)

2010-07-01

... aggregate fair market value upon termination or completion of the award, and if the supplies are not needed... 29 Labor 1 2010-07-01 2010-07-01 true Supplies. 97.33 Section 97.33 Labor Office of the Secretary... GOVERNMENTS Post-Award Requirements Changes, Property, and Subawards § 97.33 Supplies. (a) Title. Title to...

Aliénation et idéologie

OpenAIRE

Kanabus, Benoît; Popa, Délia

2017-01-01

Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...

L’idéologie dans les chants de l’EPON

Directory of Open Access Journals (Sweden)

Joëlle Dalègre

2011-11-01

Full Text Available L’idéologie de l’EPON, (organisation de jeunesse de la résistance grecque vue à travers ses chants, l’une de ses armes favorites de propagande.Cette communication se propose, à travers quelques chants, de montrer les grandes thèmes idéologiques de l’EPON, tout en la replaçant dans le cadre spécifique grec. Créée par le mouvement de résistance de masse du pays, l’EAM, l’EPON se propose d’encadrer les jeunes de tous âges, de les faire participer à la résistance, civile et parfois armée et de les conduire vers la construction de l’avenir radieux qui leur est promis à la fin de la guerre. Le chant fait partie des nombreux moyens de propagande utilisés par l’EPON (et précédemment par l’EON mais aussi d’un réel travail d’éducation entrepris en tous lieux par les cadres de l’organisation, souvent des enseignants. Justice, travail, école, prospérité, égalité homme/femme, des réalités inconnues dans la Grèce de l’avant-guerre qui ne peuvent que provoquer enthousiasme et espérance dans une génération prête à se sacrifier généreusement.Based on a number of songs, this communication summarizes the great ideological themes of EPON, while at the same time placing them in the specifically Greek context. Created by EAM, the national resistance movement, EPON set out to recruit the young of all ages, to make them participate in the civil and armed resistance against the occupiers, and to help them build the brilliant future they were promised at the end of the war. Song was one of the many forms of propaganda used by EPON, but also a real form of education undertaken everywhere by the heads of the organisation, who were often teachers. Justice, work, school, prosperity, equality between men and women, unknown realities in pre-war Greece that could only inspire enthusiasm and hope in a generation prepared to make any sacrifice.

Revendo idéias de Viktor Frankl no centenário de seu nascimento

Directory of Open Access Journals (Sweden)

Roehe, Marcelo V.

2005-01-01

Full Text Available Em homenagem ao centenário de nascimento do psicoterapeuta austríaco Viktor Frankl, o artigo apresenta uma síntese de sua vasta produção teórica. Frankl foi o criador de Logoterapia, chamada, por vezes, de terapia do sentido da vida em função de sua idéia básica, a de que o ser humano vive motivado, fundamentalmente, pela vontade de realizar sentido na vida; para isso, o homem deve se empenhar na realização de valores na forma de criações, vivências e atitudes. A teorização de Frankl, historicamente situada no campo fenomenológico-existencial, é uma das que mais radicalmente se opôs a qualquer reducionismo no entendimento do ser humano

40 CFR 97.1 - Purpose.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Purpose. 97.1 Section 97.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... transport of ozone and nitrogen oxides, an ozone precursor. ...

Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C

International Nuclear Information System (INIS)

Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.

1995-01-01

The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines

Enhancement of dibenzothiophene biodesulfurization using {beta}-cyclodextrins in oil-to-water media

Energy Technology Data Exchange (ETDEWEB)

Ainhoa Caro; Pedro Leton; Eloy Garcia-Calvo; Leonardo Setti [Universidad de Alcala, Madrid (Spain). Departamento de Quimica Analitica e Ingeniera Quimica

2007-11-15

It has been reported that biodesulfurization (BDS) of dibenzothiophene (DBT) in oil-to-water emulsions is carried out by growing cells of the aerobic Rhodococcus erythropolis IGTS8 strain and developing the so-called 4S desulfurization pathway. On adding {beta}-cyclodextrins, it is possible to improve the BDS yields, increase the diffusion of DBT into the aqueous phase or avoid the HBP accumulation. Moreover, by using greater biocatalyst initial concentrations and adding 15 ppm of {beta}-cyclodextrin, a very high BDS yield has been observed, but the presence of mass transfer limitations and the inhibition effects were not satisfactorily avoided. The Haldane kinetic model agreed well with the experimental results obtained, and the values of the kinetic parameters were determined. Short communication. 20 refs., 2 figs., 2 tabs.

Optimization on Fc for Improvement of Stability and Aggregation Resistance.

Science.gov (United States)

Chen, Xiaobo; Zeng, Fang; Huang, Tao; Cheng, Liang; Liu, Huan; Gong, Rui

2016-01-01

Fc-based therapeutics including therapeutic full-size monoclonal antibodies (mAbs) and Fcfusion proteins represent fastest-growing market in biopharmaceutical industrial. However, one major challenge during development of Fc-based therapeutics is how to maintain their efficacy in clinic use. Many factors may lead to failure in final marketing. For example, the stability and aggregation resistance might not be high enough for bearing the disadvantages during fermentation, purification, formulation, storage, shipment and other steps in manufacture and sale. Low stability and high aggregation tendency lead to decreased bioactivity and increased risk of immunogenicity resulting in serious side effect. Because Fc is one of the major parts in monoclonal antibodies and Fc-fusion proteins, engineering of Fc to increase its stability and reduce or eliminate aggregation due to incorrect association are of great importance and could further extend the potential of Fc-based therapeutics. Lots of studies focus on Fc optimization for better physical and chemical characteristics and function by structured-based computer-aid rational design, high-throughput screening expression system selection and other methods. The identification of optimized Fc mutants increases the clinic potential of currently existed therapeutics mAbs and Fc-fusion proteins, and accelerates the development of new Fc-based therapeutics. Here we provide an overview of the related field, and discuss recent advances and future directions in optimization of Fc-based therapeutics with modified stability and aggregation resistance. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Información sobre I+D y valoración de empresas El caso del sector automotriz en Estados Unidos de Norteamérica y Reino Unido

Directory of Open Access Journals (Sweden)

Teresa Duarte Atoche

2012-01-01

Full Text Available Los Principios de Contabilidad Generalmente Aceptados en EE.UU. requieren del tratamiento como gasto de las inversiones de I+D. Sin embargo, las Normas Internacionales de Información Financiera permiten su capitalización siempre y cuando se cumplan ciertos criterios (IAS 38. En la actualidad, la Junta de Normas Internacionales de Contabilidad (IASB y el Consejo de Normas de Contabilidad Financiera (FASB están de acuerdo en unificar esfuerzos para reducir o eliminar las diferencias entre el IFRS y los Principios de Contabilidad Generalmente Aceptados en EE.UU. Los comités del IASB y FASB continúan trabajando sobre las inversiones en I+D; por ello es que en este trabajo se contrastó la relevancia y fiabilidad de la información sobre I+D con objeto de poder estimar el valor de mercado de las empresas que cotizan en los mercados de capitales. El método se centró en el empleo en diferentes variaciones del modelo de Ohlson (1995. La muestra estuvo formada por empresas que cotizan en Estados Unidos y en el Reino Unido y que pertenecen al sector del automóvil; el horizonte temporal analizado comprende diez años (1995-2004. Se encontró que los inversores consideran la inversión en I+D con un lapso temporal mayor a un ejercicio económico como un activo; sin embargo, la inversión en I+D corriente es considerada como un gasto del ejercicio sin aportar valor añadido a las compañías; consecuencia de esto, la normativa internacional debería seguir lo regulado por el IASB.

28 CFR 97.12 - Employee training.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Employee training. 97.12 Section 97.12... OR DETAINEE SERVICES § 97.12 Employee training. Private prisoner transport companies must require the completion of a minimum of 100 hours of employee training before an employee may transport violent prisoners...

29 CFR 97.25 - Program income.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Program income. 97.25 Section 97.25 Labor Office of the... LOCAL GOVERNMENTS Post-Award Requirements Financial Administration § 97.25 Program income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees...

Universidad e investigación: la financiación competitiva de los proyectos de I+D, con especial referencia a las Ciencias Sociales y Económicas

Directory of Open Access Journals (Sweden)

LUIS SANZ MENÉNDEZ

2005-01-01

Full Text Available El objetivo de este trabajo es medir la relación de las universidades con la investigación. Se trata de situar a cada universidad en escalas relativas de capacidad investigadora, de esfuerzo u orientación hacia la investigación y de excelencia investigadora. El método utilizado se basa en el análisis de los resultados agregados de la competencia que los investigadores desarrollan por la financiación pública de la I+D. El periodo utilizado para la construcción de los datos corresponde a los proyectos de I+D financiados por la Administración General del Estado entre 1996 y 2001, a través de los Programas Nacionales de I+D y del Programa de Promoción General del Conocimiento (PGC. De modo singular se analizarán las actividades de investigación en el ámbito de las Ciencias Sociales y Económicas.

40 CFR 97.101 - Purpose.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Purpose. 97.101 Section 97.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... chapter, as a means of mitigating interstate transport of fine particulates and nitrogen oxides. ...

29 CFR 97.41 - Financial reporting.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Financial reporting. 97.41 Section 97.41 Labor Office of the... LOCAL GOVERNMENTS Post-Award Requirements Reports, Records Retention, and Enforcement § 97.41 Financial reporting. (a) General. (1) Except as provided in paragraphs (a)(2) and (5) of this section, grantees will...

Coherencia de tendencias en cosmética, con procesos de I+D en BELCORP

Directory of Open Access Journals (Sweden)

Iván Felipe Acosta

2016-07-01

Full Text Available La constante necesidad de las empresas por actualizarse o reinventarse para mantenerse vigentes en el mercado ha llevado a que tengan como estrategia la implementación de modelos de Innovación y Desarrollo (I+D. BELCORP, una empresa del sector cosmético ha implementado un sistema denominado Stage Gate, una metodología eficiente para el desarrollo de productos que comprende desde la conceptualización hasta la etapa posterior al lanzamiento y la comercialización de sus productos. Para garantizar su éxito, BELCORP tiene como estrategia mantenerse al día con las tendencias de la moda vigente pero, para lanzar sus productos también está considerando otros factores como los gustos de los consumidores, la cultura y las posibilidades tecnológicas existentes en los mercados donde tiene presencia.

29 CFR 97.44 - Termination for convenience.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Termination for convenience. 97.44 Section 97.44 Labor Office of the Secretary of Labor UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND COOPERATIVE... § 97.44 Termination for convenience. Except as provided in § 97.43 awards may be terminated in whole or...

Événement, idéologie et utopie

Directory of Open Access Journals (Sweden)

Jean-Luc AMALRIC

2014-12-01

Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim   

40 CFR 97.55 - Banking.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.55 Section 97.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. NOX allowances may be banked for future use or transfer in a compliance account, an overdraft...

29 CFR 452.97 - Secret ballot.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Secret ballot. 452.97 Section 452.97 Labor Regulations... OF 1959 Election Procedures; Rights of Members § 452.97 Secret ballot. (a) A prime requisite of elections regulated by title IV is that they be held by secret ballot among the members or in appropriate...

Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

Directory of Open Access Journals (Sweden)

Hye-Ji Choi

Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

40 CFR 97.155 - Banking.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.155 Section 97.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR NOX allowances may be banked for future use or transfer in a compliance account or a...

40 CFR 97.40 - Trading program budget.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading program budget. 97.40 Section...) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS NOX Allowance Allocations § 97.40 Trading program budget. In accordance with §§ 97.41 and 97.42, the Administrator will allocate to the NOX...

Electron ID in ATLAS Run 2

CERN Document Server

Thais, Savannah Jennifer; The ATLAS collaboration

2018-01-01

Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.

Zircaloy cladding ID/OD oxidation studies. Final report

International Nuclear Information System (INIS)

Westerman, R.E.; Hesson, G.M.

1977-11-01

The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations

40 CFR 97.255 - Banking.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.255 Section 97.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a compliance account or a...

Bio-desulfurization technology in Japan; Wagakuni ni okeru baio datsuryu gijutsu

Energy Technology Data Exchange (ETDEWEB)

Maruhashi, K. [Petroleum Energy Center, Tokyo (Japan)

2000-05-01

A bio-reaction of microbes (catalytic reaction by an enzyme) is characterized in that the reaction is carried out at a normal temperature and under a normal pressure and has particularly high specificity with respect to substrate (reactant). It is considered that a low loading process of environment harmony type can be constructed by applying the bio-reaction in petroleum refinery process. CO{sub 2} exhaust and energy consumption in the bio-desulfurization (BDS) is estimated to be 70 to 80% lower than those in hydrodesulfurization (HDS). The bio-technologies that can be applied to the petroleum refinery process include, for example, desulfurization, demetallation, dewaxing, denitration, cracking and so on. In this paper, the present state of bio-desulphurization technology is introduced. Particularly, as the research results in Japan, acquirement of mesophile R.erythropolis KA2-5-1 strain, thermophile Paenibacillus sp. A11-2 strain whose optimum temperature is 50 degrees C, BT degradation fungus Rhodococcus sp. T09 and the like are introduced. (NEDO)

Roman picaresque et prose d’idées : Guzmán de Alfarache de Mateo Alemán

Directory of Open Access Journals (Sweden)

Jean-Louis Brau

2011-01-01

Full Text Available La prose d’idées et la littérature ne sont pas des catégories textuelles étanches car si la première utilise abondamment des exempla fictionnels pour illustrer ses démonstrations, la seconde contient toujours une dimension idéologique plus ou moins importante et plus ou moins explicite. Il s’agit donc d’une affaire de « dosage » entre la matière idéologique et la matière fictionnelle, dosage qui permet en principe de ranger les oeuvres dans l’une ou l’autre catégorie, ce qui n’est pas toujours évident car certaines oeuvres se situent à la frontière entre les deux. C’est le cas du roman picaresque espagnol, facétieux et burlesque, mais qui véhicule aussi dès les origines une indéniable satire sociale et morale. Le chef-d’œuvre du genre, le Guzmán de Alfarache de Mateo Alemán, se distingue par sa structure extrêmement digressive. Les aventures picaresques du protagoniste sont constamment entrecoupées de discours idéologiques sur toutes sortes de sujets touchant à la société et à la morale, discours entrelardés de cellules narratives secondaires qui font office d’exempla. L’ensemble de ces « sermons », d’un pessimisme profond, a sa source dans la doctrine religieuse catholique longuement exposée et appliquée rigoureusement et dans laquelle se détachent les thèmes fondamentaux du déterminisme, donc de la prédestination, et du libre arbitre de l’homme. Le Guzmán de Alfarache apparaît ainsi comme un vaste traité théologico-moral illustré par une infinité d’exempla parmi lesquels la fiction picaresque, l’histoire du gueux, est aussi un exemplum, le plus vaste et le plus important, au service de la thèse centrale du livre : la possibilité de rédemption de l’homme, fût-il le criminel le plus endurci, s’il est sauvé par la miséricorde divine. A tous les niveaux, thématique, réthorique et stylistique, le Guzmán de Alfarache a donc de grandes affinités avec la prose d’id

A Scientific Calculator for Exact Real Number Computation Based on LRT, GMP and FC++

Directory of Open Access Journals (Sweden)

J. A. Hernández

2012-03-01

Full Text Available Language for Redundant Test (LRT is a programming language for exact real number computation. Its lazy evaluation mechanism (also called call-by-need and its infinite list requirement, make the language appropriate to be implemented in a functional programming language such as Haskell. However, a direction translation of the operational semantics of LRT into Haskell as well as the algorithms to implement basic operations (addition subtraction, multiplication, division and trigonometric functions (sin, cosine, tangent, etc. makes the resulting scientific calculator time consuming and so inefficient. In this paper, we present an alternative implementation of the scientific calculator using FC++ and GMP. FC++ is a functional C++ library while GMP is a GNU multiple presicion library. We show that a direct translation of LRT in FC++ results in a faster scientific calculator than the one presented in Haskell.El lenguaje de verificación redundante (LRT, por sus siglas en inglés es un lenguaje de programación para el cómputo con números reales exactos. Su método de evaluación lazy (o mejor conocido como llamada por necesidad y el manejo de listas infinitas requerido, hace que el lenguaje sea apropiado para su implementación en un lenguaje funcional como Haskell. Sin embargo, la implementación directa de la semántica operacional de LRT en Haskell así como los algoritmos para funciones básicas (suma, resta, multiplicación y división y funciones trigonométricas (seno, coseno, tangente, etc hace que la calculadora científica resultante sea ineficiente. En este artículo, presentamos una implementación alternativa de la calculadora científica usando FC++ y GMP. FC++ es una librería que utiliza el paradigma Funcional en C++ mientras que GMP es una librería GNU de múltiple precisión. En el artículo mostramos que la implementación directa de LRT en FC++ resulta en una librería más eficiente que la implementada en Haskell.

Evaluación de cuatro métodos para la detección de Staphylococcus aureus meticilino-resistente de muestras clínicas en un hospital regional Evaluation of four methods for detecting methicillin-resistant Staphylococcus aureus isolates from clinical specimens at a regional hospital in Mexico

Directory of Open Access Journals (Sweden)

Gabriel Acosta-Pérez

2012-02-01

Full Text Available OBJETIVO: Investigar la prevalencia de Staphylococcus aureus meticilino-resistente (MRSA en aislados clínicos y determinar la concordancia entre los métodos de detección de MRSA en un laboratorio con recursos y personal limitado. MATERIAL Y MÉTODOS: Se analizaron 140 cepas de Staphylococcus aureus aisladas de muestras clínicas de diferentes departamentos mediante pruebas convencionales: producción de β-lactamasa, sensibilidad a oxacilina con MIC-Vitek 2-XL, ChromID MRSA, difusión en agar para discos de 30 μg de cefoxitina, detección de PBP2a y PCR para el gen mecA. Se determinó el índice kappa de Cohen, para evaluar la concordancia entre los diferentes métodos utilizados. RESULTADOS: La prevalencia encontrada fue de 90.7%. La sensibilidad y especificidad para los diferentes métodos de detección fue: difusión en disco para cefoxitina 97 y 92% respectivamente, MIC Vitek 2-XL 97 y 69%, ChromoID MRSA 97 y 85% y detección de PBP2a 98 y 100%. CONCLUSIONES: Todos los métodos son muy buenos para la detección de MRSA; la elección en el uso de cada método dependerá de la infraestructura de cada laboratorio.OBJETIVE: To estimate the prevalence of methicillin-resistant Staphylococcus aureus (MRSA in clinical isolates and to compare different methods for detection of MRSA in a lab with limited available personnel and resources. MATERIAL AND METHODS: 140 Staphylococcus aureus strains isolated from patients in several departments were assayed for β-lactamase production, MIC-Vitek 2 oxacillin, ChromID MRSA, disk diffusion in agar for cefoxitin 30 μg and PBP2a detection. The results of conventional tests were compared with the "gold standard" PCR test for mecA gene. Cohen´s kappa index was also calculated in order to evaluate the intra assay agreement between the used methods. RESULTS: The found prevalence was 90.7%. Sensitivity and specificity were: disk diffusion for cefoxitin 97 and 92% respectively, MIC Vitek 2-XL 97 and 69%, ChromoID

Diseño e implementación de la red social NetID

OpenAIRE

Martín Vallés, Gabriel

2015-01-01

En esta memoria se va a documentar el desarrollo, diseño y programación de una red social denominada NetID. La red social implementada en este documento pretende mejorar las tecnologías de red social existentes en el mercado, basándonos en tres puntos clave como pilar de apoyo a la innovación: Objetivos. Cuestiones metodológicas. Entorno de la aplicación (marco tecnológico actual). La existencia de redes sociales es bien conocida por su gran auge en los últimos años en Internet. L...

29 CFR 97.26 - Non-Federal audit.

Science.gov (United States)

2010-07-01

... in a fiscal year, shall: (1) Determine whether State or local subgrantees have met the audit... 29 Labor 1 2010-07-01 2010-07-01 true Non-Federal audit. 97.26 Section 97.26 Labor Office of the... LOCAL GOVERNMENTS Post-Award Requirements Financial Administration § 97.26 Non-Federal audit. (a) Basic...

Wicked ID: Conceptual Framework for Considering Instructional Design as a Wicked Problem

Directory of Open Access Journals (Sweden)

Katrin Becker

2007-02-01

Full Text Available The process of instructional design has parallels in other design disciplines. Software design is one that has experienced intense attention in the last 30 or so years, and many lessons learned there can be applied to ID. Using software design as a springboard, this concept paper seeks to propose a new approach to ID. It suggests that instructional design is almost always a Wicked Problem. The connection is formed between Wicked Problems as first described by Rittel and Webber in 1973, and the models in and processes of instructional design. The areas of social planning, organizational management and software design all posses some accepted and tested approaches to the solution of Wicked Problems. These will be described, and how they can be applied to ID will be explained. Finally, this paper will propose a meta-model for ID and explain how it can be used in the current context. Résumé : Le processus de conception pédagogique a des similitudes avec d’autres disciplines. La conception de logiciels a fait l’objet d’une grande attention dans les trente dernières années et de nombreuses leçons tirées peuvent s’appliquer à la conception pédagogique. En se basant sur la conception de logiciels, cet article cherche à proposer une nouvelle méthode à la conception pédagogique. Il laisse entendre que la conception pédagogique constitue presque toujours un problème épineux. Le lien est formé entre les problèmes épineux tels que décrits par Rittel et Webber en 1973 et les modèles et processus de la conception pédagogique. Les secteurs de l’organisation sociale, de la gestion des organisations et de la conception de logiciels comptent des méthodes acceptées et validées à la résolution de problèmes épineux. Nous les décrirons et expliquerons comment ils peuvent servir à la conception pédagogique. Enfin, l’article proposera un meta-modèle de la conception pédagogique et expliquera comment il peut servir dans le

Corrosion rate of steel embedded in blended Portland and fluid catalytic cracking catalyst residue (FC3R cement mortars

Directory of Open Access Journals (Sweden)

Payá, J.

2008-12-01

Full Text Available This paper reports on a study of the corrosion levels in steel bars embedded in mortars made with a blend of Portland cement and (0-20% spent fluid catalytic cracking catalyst residue (FC3R, with a variable (0.3-0.7 water/binder (w/b ratio. The specimens were stored in the following conditions: relative humidity of 40, 80 or 100% and CO2 concentrations of 5 and 100%. The steel corrosion rate was measured with polarization resistance techniques. In the absence of aggressive agents, the steel was found to remain duly passivated in mortars with an FC3R content of up to 15% under all the conditions of relative humidity tested. The reinforcement corrosion level in mortars with a w/b ratio of 0.3 and 15% FC3R subjected to accelerated carbonation was similar to the level observed in the unblended Portland cement control mortar.En este trabajo se ha estudiado el nivel de corrosión de barras de acero embebidas en morteros de cemento Portland con relación agua/material cementante (a/mc variable (0,3-0,7, en los que parte del cemento (0-20% se sustituyó por catalizador de craqueo usado (FC3R. Las condiciones de conservación de las probetas elaboradas fueron las siguientes: distintas humedades relativas (40, 80 y 100% y dos concentraciones de CO2 (5 y 100%. La velocidad de corrosión de los aceros se midió mediante la técnica de resistencia de polarización. Se ha podido determinar que, bajo las distintas condiciones de humedad relativa y ausencia de agresivo, los aceros se mantuvieron correctamente pasivados en los morteros con contenidos de FC3R de hasta el 15%. El nivel de corrosión que presenta el refuerzo embebidos en morteros con sustitución de un 15% de cemento por FC3R y relación a/mc 0,3, al ser sometidos a un proceso de carbonatación acelerada, era muy similar al mostrado por el mortero patrón, sin FC3R.

Mise en perspective de l’article de Jean Duvignaud « L'idéologie, cancer de la conscience »

OpenAIRE

Corbeau, Jean-Pierre

2007-01-01

Introduction à l’article de Jean Duvignaud « L'idéologie, cancer de la conscience », paru en 1969 dans le volume 46 des Cahiers internationaux de sociologie. Sa thématique concerne, depuis toujours, l'ensemble de la communauté scientifique, au-delà des frontières artificielles ou obsolètes entre sciences sociales, humaines, politiques, économiques, juridiques, du vivant, etc. Ses analyses résonnent avec l'actualité, concernent la citoyenneté qui s'interroge sur le fonctionnement de nos sociét...

Influência do polimorfismo I/D do gene da eca na HPE de jovens normotensos

Directory of Open Access Journals (Sweden)

Manuella de Oliveira Fernandes

2015-08-01

Full Text Available INTRODUÇÃO: A hipotensão pós-exercício (HPE é considerada uma estratégia não farmacológica adotada para redução da pressão arterial (PA. Ademais, sabe-se que a presença de alguns polimorfismos genéticos influencia a resposta pressórica, como o I/D do gene da enzima conversora da angiotensina (ECA. Objetivo: Analisar a influência do polimorfismo I/D da ECA sobre a HPE após três diferentes intensidades de exercício em jovens normotensos e fisicamente ativos.MÉTODOS: Vinte e seis jovens saudáveis (DD = 11; ID/II = 15 realizaram uma sessão máxima de 1.600 metros, na pista de atletismo e outras três sessões experimentais (Sessão Moderada: 6% abaixo do limiar anaeróbio, Sessão Intensa: 6% acima do limiar anaeróbio e Sessão de Controle, com aferições prévias da PA, por 20 minutos e posteriores ao exercício por 60 minutos.RESULTADOS: Observou-se que o exercício moderado ocasionou HPE independentemente do grupo genotípico, sendo mais evidente para a pressão arterial sistólica nos momentos 45 minutos e 60 minutos (p ≤ 0,05. Verificou-se também que a característica gênica exerceu influência sobre a área abaixo da curva pressórica (p ≤ 0,005 sobre a pressão arterial diastólica, formada 1 hora após o exercício.CONCLUSÃO: Conclui-se que o exercício moderado ocasiona HPE em jovens normotensos e fisicamente ativos, independentemente do polimorfismo I/D no gene da ECA, sendo que esse polimorfismo exerce influência sobre a hipotensão diastólica, e os indivíduos portadores do alelo I apresentam maior decaimento da PA diastólica (PAD.

Clarté des idées innées ?

DEFF Research Database (Denmark)

Schøsler, Jørn

2013-01-01

Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....

La relevancia de los gastos de I+D. Estudio empírico en el sector del automóvil

Directory of Open Access Journals (Sweden)

Teresa duarte Atoche

2012-07-01

Resultado y conclusiones: Nuestros resultados muestran que los inversores consideran que los gastos de I+D corriente y los del ejercicio anterior no aportan valor añadido a las compañías, es decir, que los valoran como cualquier otro gasto del ejercicio y que, por tanto, no son relevantes para estimar el valor de mercado de las compañías que forman nuestra muestra.

Transmisión experimental del virus de la encefalitis equina venezolana, subgrupo ID, por psorophora confinnis a ratones

Directory of Open Access Journals (Sweden)

Alberto Morales

1983-06-01

Full Text Available Se realizó un experimento con el objeto de investigar la capacidad del mosquito Psorophora confinnis para transmitir por picadura a ratones blanco-suizos de 21 días una cepa de virus de encefalitis equina venezolana, subgrupo ID. Cuando los mosquitos se alimentaron sobre hamster con altas viremias (7.5, 6.5 y 6.3 dex en 0.1 ml. de suero, los porcentajes de infección de los mosquitos y los de transmisión fueron altos. Sin embargo, cuando los mosquitos se alimentaron sobre Proechimys hendei con viremias bajas (1,4 y 2.6 dex en 0.1 ml. de suero el porcentaje de infección de los mosquitos fue muy bajo y no hubo transmisión. Cuando la viremia en el Proechimys fue de 4.4 dex en 0.1 ml. de suero, el porcentaje de infección de los mosquitos aumentó y hubo transmisión baja (9%. Los resultados sugieren que Psorophora confinnis es un mosquito que tiene un alto umbral de infección para EEV subgrupo ID.

FcγRll: Characterisation of novel Fc receptor interactions and a new receptor form.

OpenAIRE

JESSICA CLAIRE ANANIA

2018-01-01

Leukocyte Fc receptors (FcR) bind to immunogloulins (Ig) to link the innate and humoral immune system to help balance the immune system and clear infections. We have characterised a novel FcR for IgG (FcγR) form, designated FcγRIIa3, which contains a 19 amino acid insert. This insert interacts with cytoskeletal structures allowing the receptor to be retained for longer periods of time at the cells surface upon activation, higher cell signalling which causes greater cellular activation. Theref...

29 CFR 1910.97 - Nonionizing radiation.

Science.gov (United States)

2010-07-01

... electromagnetic energy or in which the cross section of the body is smaller than the cross section of the incident... Warning Symbol (4) Scope. This section applies to all radiations originating from radio stations, radar... 29 Labor 5 2010-07-01 2010-07-01 false Nonionizing radiation. 1910.97 Section 1910.97 Labor...

Improvement of Biodesulfurization Rate of Alginate Immobilized Rhodococcus erythropolis R1.

Science.gov (United States)

Derikvand, Peyman; Etemadifar, Zahra

2014-03-01

Sulfur oxides released from the burning of oil causes severe environmental pollution. The sulfur can be removed via the 4S pathway in biodesulfurization (BDS). Immobilization approaches have been developed to prevent cell contamination of oil during the BDS process. The encapsulation of Rhodococcus erythropolis R1 in calcium alginate beads was studied in order to enhance conversion of dibenzothiophene (DBT) to 2-hydroxy biphenyl (2-HBP) as the final product. Also the effect of different factors on the BDS process was investigated. Calcium alginate capsules were prepared using peristaltic pumps with different needle sizes to control the beads sizes. Scanning electron microscopy and flow cytometry methods were used to study the distribution and viability of encapsulated cells, respectively. Two non-ionic surfactants and also nano Ƴ-Al2O3were used with the ratio of 0.5% (v/v) and 1:5 (v/v) respectively to investigate their BDS efficiency. In addition, the effect of different bead sizes and different concentrations of sodium alginate in BDS activity was studied. The 2% (w/v) sodium alginate beads with 1.5mm size were found to be the optimum for beads stability and efficient 2-HBP production. The viability of encapsulated cells decreased by 12% after 20 h of desulfurization, compared to free cells. Adding the non-ionic surfactants markedly enhanced the rate of BDS, because of increasing mass transfer of DBT to the gel matrix. In addition, Span 80 was more effective than Tween 80. The nanoƳ-Al2O3 particles could increase BDS rate by up to two-folds greater than that of the control beads. The nano Ƴ-Al2O3 can improve the immobilized biocatalyst for excellent efficiency of DBT desulfurization. Also the BDS activity can be enhanced by setting the other explained factors at optimum levels.

Importance of neonatal FcR in regulating the serum half-life of therapeutic proteins containing the Fc domain of human IgG1: a comparative study of the affinity of monoclonal antibodies and Fc-fusion proteins to human neonatal FcR.

Science.gov (United States)

Suzuki, Takuo; Ishii-Watabe, Akiko; Tada, Minoru; Kobayashi, Tetsu; Kanayasu-Toyoda, Toshie; Kawanishi, Toru; Yamaguchi, Teruhide

2010-02-15

The neonatal FcR (FcRn) binds to the Fc domain of IgG at acidic pH in the endosome and protects IgG from degradation, thereby contributing to the long serum half-life of IgG. To date, more than 20 mAb products and 5 Fc-fusion protein products have received marketing authorization approval in the United States, the European Union, or Japan. Many of these therapeutic proteins have the Fc domain of human IgG1; however, the serum half-lives differ in each protein. To elucidate the role of FcRn in the pharmacokinetics of Fc domain-containing therapeutic proteins, we evaluated the affinity of the clinically used human, humanized, chimeric, or mouse mAbs and Fc-fusion proteins to recombinant human FcRn by surface plasmon resonance analysis. The affinities of these therapeutic proteins to FcRn were found to be closely correlated with the serum half-lives reported from clinical studies, suggesting the important role of FcRn in regulating their serum half-lives. The relatively short serum half-life of Fc-fusion proteins was thought to arise from the low affinity to FcRn. The existence of some mAbs having high affinity to FcRn and a short serum half-life, however, suggested the involvement of other critical factor(s) in determining the serum half-life of such Abs. We further investigated the reason for the relatively low affinity of Fc-fusion proteins to FcRn and suggested the possibility that the receptor domain of Fc-fusion protein influences the structural environment of the FcRn binding region but not of the FcgammaRI binding region of the Fc domain.

Diego Velázquez e os retratos de Felipe IV: A pintura Barroca e a idéia de tempo na sociedade espanhola do século XVII

Directory of Open Access Journals (Sweden)

Susana Aparecida da Silva

2012-08-01

Full Text Available Esta pesquisa reflete a respeito da possibilidade de se analisar a idéia de tempo na Espanha Barroca do século XVII através de cinco retratos feitos pelo pintor espanhol Diego Velázquez (1599-1660. Estes retratos são feitos após o período em que o pintor é admitido na corte de Felipe IV da Espanha (1605-1665 como pintor oficial. As fontes visuais selecionadas para esta pesquisa no sentido de possibilitar a análise da idéia de tempo são retratos do rei feitos por Diego Velázquez e representam o rei jovem e posteriormente envelhecido. Acredita-se que a idéia de tempo para Velázquez tenha estreita relação com a sociedade barroca espanhola do século XVII na qual ele está inserido. Neste sentido, as representações do poder e do envelhecimento do monarca possíveis de serem vistas nas pinturas de Velázquez contribuem para se pensar a concepção de tempo do artista e da sociedade espanhola daquele período

The neonatal Fc receptor, FcRn, as a target for drug delivery and therapy.

Science.gov (United States)

Sockolosky, Jonathan T; Szoka, Francis C

2015-08-30

Immunoglobulin G (IgG)-based drugs are arguably the most successful class of protein therapeutics due in part to their remarkably long blood circulation. This arises from IgG interaction with the neonatal Fc receptor, FcRn. FcRn is the central regulator of IgG and albumin homeostasis throughout life and is increasingly being recognized as an important player in autoimmune disease, mucosal immunity, and tumor immune surveillance. Various engineering approaches that hijack or disrupt the FcRn-mediated transport pathway have been devised to develop long-lasting and non-invasive protein therapeutics, protein subunit vaccines, and therapeutics for treatment of autoimmune and infectious disease. In this review, we highlight the diverse biological functions of FcRn, emerging therapeutic opportunities, as well as the associated challenges of targeting FcRn for drug delivery and disease therapy. Copyright © 2015 Elsevier B.V. All rights reserved.

40 CFR 97.3 - Measurements, abbreviations, and acronyms.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Measurements, abbreviations, and acronyms. 97.3 Section 97.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... electrical. NOX-nitrogen oxides. O2-oxygen. ton-2000 pounds. ...

Sistemas de gestión de la calidad y desempeño: importancia de las prácticas de gestión del conocimiento y de I+D

OpenAIRE

Camisón Zornoza, César; Boronat Navarro, Montserrat; Villar López, Ana; Puig Denia, Alba

2009-01-01

En este trabajo se estudia la influencia de la implantación de sistemas de gestión de la calidad en la adopción de prácticas de gestión del conocimiento y de la gestión de la I+D y, a su vez, los efectos individuales y conjuntos de los distintos tipos de prácticas de gestión sobre el desempeño. A través de un modelo de ecuaciones estructurales y utilizando la metodología Partial Least Squares (PLS), se demuestra que los sistemas de gestión de la calidad integrados con la gestión del conocimie...

40 CFR 97.140 - State trading budgets.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false State trading budgets. 97.140 Section...) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR NOX Allowance Allocations § 97.140 State trading budgets. The State trading budgets for annual allocations of CAIR NOX allowances...

31 CFR 9.7 - Conduct of investigation.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Conduct of investigation. 9.7 Section 9.7 Money and Finance: Treasury Office of the Secretary of the Treasury EFFECTS OF IMPORTED ARTICLES... Secretary or his designee may also request further data from other sources through the use of questionnaires...

40 CFR 97.340 - State trading budgets.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false State trading budgets. 97.340 Section...) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR NOX Ozone Season Allowance Allocations § 97.340 State trading budgets. (a) Except as provided in paragraph (b) of this section, the State...

Field flow fractionation for assessing neonatal Fc receptor and Fcγ receptor binding to monoclonal antibodies in solution.

Science.gov (United States)

Pollastrini, Joey; Dillon, Thomas M; Bondarenko, Pavel; Chou, Robert Y-T

2011-07-01

Analysis of the strength and stoichiometry of immunoglobulin G (IgG) binding to neonatal Fc receptor (FcRn) and Fcγ receptor (FcγR) is important for evaluating the pharmacokinetics and effector functions of therapeutic monoclonal antibody (mAb) products, respectively. The current standard for assessing FcγR and FcRn binding is composed of cell-based and surface plasmon resonance (SPR) assays. In this work, asymmetrical flow field flow fractionation (AF4) was evaluated to establish the true stoichiometry of IgG binding in solution. AF4 and liquid chromatography-mass spectrometry (LC-MS) were applied to directly observe IgG/FcγR and IgG/FcRn complexes, which were not observed using nonequilibrium size exclusion chromatography (SEC) analysis. Human serum albumin (HSA), an abundant component of human blood and capable of binding FcRn, was studied in combination with FcRn and IgG. AF4 demonstrated that the majority of large complexes of IgG/FcRn/HSA were at an approximate 1:2:1 molar ratio. In addition, affinity measurements of the complex were performed in the sub-micromolar affinity range. A significant decrease in binding was detected for IgG molecules with increased oxidation in the Fc region. AF4 was useful in detecting weak binding between full-length IgG/Fc fragments and Fc receptors and the effect of chemical modifications on binding. AF4 is a useful technique in the assessment of mAb product quality attributes. Copyright © 2011 Elsevier Inc. All rights reserved.

Biodesulfurization of coals of different rank: Effect on combustion behavior

Energy Technology Data Exchange (ETDEWEB)

Rubiera, F.; Arenillas, A.; Fuente, E.; Pis, J.J. [CSIC, Oviedo (Spain). Inst. Nacional del Carbon; Marteinz, O.; Moran, A. [Univ. de Leon (Spain). Escuela de Ingenieria Tecnica Minera

1999-02-01

The emission of sulfur oxides during the combustion of coal is one of the causes, among other air pollution problems, of acid rain. The contribution of coal as the mainstay of power production will be determined by whether its environmental performance is equal or superior to other supply options. In this context, desulfurization of coal before combustion by biological methods was studied. Four Spanish high-sulfur content coals of different rank were inoculated with bacteria isolated from mine-drainage waters and with naturally occurring bacteria inherent in the coals to be treated. Higher levels of desulfurization were obtained in the case of the samples treated with their own accompanying bacteria and when aeration was increased. All the samples were amenable to the biodepyritization processes. However, it is of little value to achieve large sulfur reductions if a decrease in coal combustion performance is obtained in the process. For this reason, a comparison was made between the combustibility characteristics of the original coals and those of the biodesulfurized samples. Results indicated that combustibility was not substantially modified by the overall biological treatment. The benefits of reduced sulfur emissions into the atmosphere ought to be taken into account as part of the general evaluation of the processes.

A ingestão de cafeína não melhora o desempenho de atletas de judô The intake of caffeine does not improve the performance of judo

Directory of Open Access Journals (Sweden)

Lucas Adriano Pereira

2010-09-01

Full Text Available O objetivo do presente estudo foi investigar os efeitos ergogênicos da ingestão de cafeína, sobre o desempenho motor de atletas de judô feminino. Participaram do estudo 13 atletas do sexo feminino (17,6 ± 1,6 anos, 58,3 ± 11,4 kg, 162 ± 4,1 cm, 22,5 ± 4 kg/m², vinculadas à Federação Paranaense de Judô, por pelo menos dois anos. O desempenho motor foi avaliado mediante a utilização do Special Judô Fitness Test (SJFT, a partir do qual foi analisado o número de arremessos em cada bloco, número total de arremessos, frequência cardíaca (FC final e de recuperação e o índice no SJFT. Os sujeitos foram testados em duas condições, após ingestão de cafeína (6 mg.kg-1 ou placebo (dextrose 60 minutos antes dos testes, em um delineamento duplo-cego, cruzado. O número de arremessos em cada bloco não diferiu entre as condições cafeína (CAF e placebo (PL (Bloco A: 4,53 ± 0,51 CAF e 4,46 ± 0,51 PL; Bloco B: 8,3 ± 0,63 CAF e 8,23 ± 0,72 PL; Bloco C: 7,23 ± 0,59 CAF e 7,46 ± 0,77 PL, bem como o número total de arremessos (20,07 ± 1,18 CAF e 20,15 ± 1,67 PL, FC (Final: 190,3 ± 9,63 bpm CAF e 190,69 ± 9,19 bpm PL; Recuperação: 162,07 ± 13,78 bpm CAF e 164,3 ± 9,64 bpm PL e índice no SJFT (17,59 ± 1,4 CAF e 17,75 ± 1,98 PL. A ingestão de cafeína não melhorou o desempenho durante atividade de alta intensidade e curta duração em lutadores de judô.The objective of this study was to investigate the ergogenic effects of caffeine on motor performance of judo female athletes. Thirteen female athletes (17.6 ± 1.6 years, 58.3 ± 11.4 kg, 162 ± 4.1 cm, 22.5 ± 4 kg/m², registered in the State Federation of Judo for at least two years, participated in this study. The motor performance was assessed using the Special Judo Fitness Test (SJFT, from which was considered the number of throws in each block, the total number of throws, recovery and final heart rate (HR and final score in SJFT. The subjects were tested in two

Enjeux esthético-idéologiques du stéréotype dans les derniers romans de Mongo Beti

Directory of Open Access Journals (Sweden)

J.-J. Rousseau Tandia Mouafou

2009-12-01

Full Text Available Cette réflexion se propose d’actualiser le concept de stéréotype, habituellement réservé aux sciences sociales, dans l’exploration du texte littéraire. Nous observons ainsi que l’idée de fixité au cœur de la problématique du stéréotype est un concept opératoire qui permet de lire autrement le récit sur le triple plan linguistique, thématico-narratif et idéologique. Les valeurs textuelles que ce concept permet de mettre en évidence portent à croire que notre corpus apparaît, dans une perspective sociocritique, comme une métaphore des sociétés africaines post-coloniales.

Structural characterization of the Man5 glycoform of human IgG3 Fc

Energy Technology Data Exchange (ETDEWEB)

Shah, Ishan S.; Lovell, Scott; Mehzabeen, Nurjahan; Battaile, Kevin P.; Tolbert, Thomas J. (Kansas); (HWMRI)

2017-12-01

Immunoglobulin G (IgG) consists of four subclasses in humans: IgG1, IgG2, IgG3 and IgG4, which are highly conserved but have unique differences that result in subclass-specific effector functions. Though IgG1 is the most extensively studied IgG subclass, study of other subclasses is important to understand overall immune function and for development of new therapeutics. When compared to IgG1, IgG3 exhibits a similar binding profile to Fcγ receptors and stronger activation of complement. All IgG subclasses are glycosylated at N297, which is required for Fcγ receptor and C1q complement binding as well as maintaining optimal Fc conformation. We have determined the crystal structure of homogenously glycosylated human IgG3 Fc with a GlcNAc2Man5 (Man5) high mannose glycoform at 1.8 Å resolution and compared its structural features with published structures from the other IgG subclasses. Although the overall structure of IgG3 Fc is similar to that of other subclasses, some structural perturbations based on sequence differences were revealed. For instance, the presence of R435 in IgG3 (and H435 in the other IgG subclasses) has been implicated to result in IgG3-specific properties related to binding to protein A, protein G and the neonatal Fc receptor (FcRn). The IgG3 Fc structure helps to explain some of these differences. Additionally, protein-glycan contacts observed in the crystal structure appear to correlate with IgG3 affinity for Fcγ receptors as shown by binding studies with IgG3 Fc glycoforms. Finally, this IgG3 Fc structure provides a template for further studies aimed at engineering the Fc for specific gain of function.

Tank 241-TX-302C grab samples 302C-TX-97-1A through 302C-TX-97-3B analytical results for the final report

Energy Technology Data Exchange (ETDEWEB)

Esch, R.A.

1998-03-12

This document is the final report for tank 241-TX-302C grab samples. Six grabs samples (302C-TX-97-1A, 302C-TX-97-1B, 302C-TX-97-2A, 302C-TX-97-2B, 302C-TX-97-3A, and 302C-TX-97-3B) were collected from the catch tank level gauge riser on December 19, 1997. The ``A`` and ``B`` portions from each sample location were composited and analyses were performed on the composites in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. Appearance and Sample Handling Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information.

Tank 241-TX-302C grab samples, 302C-TX-97-1A through 302C-TX-97-3B analytical results for the final report

International Nuclear Information System (INIS)

Esch, R.A.

1998-01-01

This document is the final report for tank 241-TX-302C grab samples. Six grabs samples (302C-TX-97-1A, 302C-TX-97-1B, 302C-TX-97-2A, 302C-TX-97-2B, 302C-TX-97-3A, and 302C-TX-97-3B) were collected from the catch tank level gauge riser on December 19, 1997. The ''A'' and ''B'' portions from each sample location were composited and analyses were performed on the composites in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. Appearance and Sample Handling Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information

Sistema de información de apoyo en la calidad de atención de la Ugel 07, San Borja, 2016

OpenAIRE

Sarmiento Bances, Teresa

2016-01-01

En la investigación titulada: Sistema de información de apoyo en la calidad de atención de la Ugel 07, San Borja, 2016, el objetivo general de la investigación fue Determinar: La influencia del sistema de información de apoyo en la calidad de atención de la UGEL 07, San Borja, 2016. El tipo de investigación es correlacional - causal, el nivel de investigación es descriptivo y el diseño de la investigación es no experimental y el enfoque es cuantitativo. La muestra estuvo con...

Revisiting Field Capacity (FC: variation of definition of FC and its estimation from pedotransfer functions

Directory of Open Access Journals (Sweden)

Theophilo Benedicto Ottoni Filho

2014-12-01

Full Text Available Taking into account the nature of the hydrological processes involved in in situ measurement of Field Capacity (FC, this study proposes a variation of the definition of FC aiming not only at minimizing the inadequacies of its determination, but also at maintaining its original, practical meaning. Analysis of FC data for 22 Brazilian soils and additional FC data from the literature, all measured according to the proposed definition, which is based on a 48-h drainage time after infiltration by shallow ponding, indicates a weak dependency on the amount of infiltrated water, antecedent moisture level, soil morphology, and the level of the groundwater table, but a strong dependency on basic soil properties. The dependence on basic soil properties allowed determination of FC of the 22 soil profiles by pedotransfer functions (PTFs using the input variables usually adopted in prediction of soil water retention. Among the input variables, soil moisture content θ (6 kPa had the greatest impact. Indeed, a linear PTF based only on it resulted in an FC with a root mean squared residue less than 0.04 m³ m-3 for most soils individually. Such a PTF proved to be a better FC predictor than the traditional method of using moisture content at an arbitrary suction. Our FC data were compatible with an equivalent and broader USA database found in the literature, mainly for medium-texture soil samples. One reason for differences between FCs of the two data sets of fine-textured soils is due to their different drainage times. Thus, a standardized procedure for in situ determination of FC is recommended.

Tank 241-AX-101, grab samples, 1AX-97-1 through 1AX-97-3 analytical results for the final report

International Nuclear Information System (INIS)

Esch, R.A.

1997-01-01

This document is the final report for tank 241-AX-101 grab samples. Four grab samples were collected from riser 5B on July 29, 1997. Analyses were performed on samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. All four samples contained settled solids that appeared to be large salt crystals that precipitated upon cooling to ambient temperature. Less than 25 % settled solids were present in the first three samples, therefore only the supernate was sampled and analyzed. Sample 1AX-97-4 contained approximately 25.3 % settled solids. Compatibility analyses were not performed on this sample. Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information. All four samples contained settled solids that appeared to be large salt crystal that precipitated upon cooling to ambient temperature. The settled solids in samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 were less than 25% by volume. Therefore, for these three samples, two 15-mL subsamples were pipetted to the surface of the liquid and submitted to the laboratory for analysis. In addition, a portion of the liquid was taken from each of the these three samples to perform an acidified ammonia analysis. No analysis was performed on the settled solid portion of the samples. Sample 1AX-97-4 was reserved for the Process Chemistry group to perform boil down and dissolution testing in accordance with Letter of Instruction for Non-Routine Analysis of Single-Shell Tank 241-AX-101 Grab Samples (Field, 1997) (Correspondence 1). However, prior to the analysis, the sample was inadvertently

Tank 241-AX-101 grab samples 1AX-97-1 through 1AX-97-3 analytical results for the final report

Energy Technology Data Exchange (ETDEWEB)

Esch, R.A.

1997-11-13

This document is the final report for tank 241-AX-101 grab samples. Four grab samples were collected from riser 5B on July 29, 1997. Analyses were performed on samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. All four samples contained settled solids that appeared to be large salt crystals that precipitated upon cooling to ambient temperature. Less than 25 % settled solids were present in the first three samples, therefore only the supernate was sampled and analyzed. Sample 1AX-97-4 contained approximately 25.3 % settled solids. Compatibility analyses were not performed on this sample. Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information. All four samples contained settled solids that appeared to be large salt crystal that precipitated upon cooling to ambient temperature. The settled solids in samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 were less than 25% by volume. Therefore, for these three samples, two 15-mL subsamples were pipetted to the surface of the liquid and submitted to the laboratory for analysis. In addition, a portion of the liquid was taken from each of the these three samples to perform an acidified ammonia analysis. No analysis was performed on the settled solid portion of the samples. Sample 1AX-97-4 was reserved for the Process Chemistry group to perform boil down and dissolution testing in accordance with Letter of Instruction for Non-Routine Analysis of Single-Shell Tank 241-AX-101 Grab Samples (Field, 1997) (Correspondence 1). However, prior to the analysis, the sample was inadvertently

Role of activatory Fc gamma RI and Fc gamma RIII and inhibitory Fc gamma RII in inflammation and cartilage destruction during experimental antigen-induced arthritis.

NARCIS (Netherlands)

Lent, P.L.E.M. van; Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Sloetjes, A.W.; Putte, L.B.A. van de; Verbeek, S.; Berg, W.B. van den

2001-01-01

IgG-containing immune complexes, which are found in most RA joints, communicate with hematopoietic cells using three classes of Fc receptors(Fc gamma RI, -II, -III). In a previous study we found that if a chronic T-cell-mediated antigen-induced arthritis (AIA) was elicited in knee joints of FcR

Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

International Nuclear Information System (INIS)

Steen, F.H.

1997-01-01

This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed

Rapid desensitization of mice with anti-FcγRIIb/FcγRIII mAb safely prevents IgG-mediated anaphylaxis.

Science.gov (United States)

Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Clay, Corey D; Morris, Suzanne C; Finkelman, Fred D

2013-12-01

Stimulatory IgG receptors (FcγRs) on bone marrow-derived cells contribute to the pathogenesis of several autoimmune and inflammatory disorders. Monoclonal antibodies that block FcγRs might suppress these diseases, but they can induce anaphylaxis. We wanted to determine whether a rapid desensitization approach can safely suppress IgG/FcγR-mediated anaphylaxis. Mice were injected with serially increasing doses of 2.4G2, a rat mAb that blocks the inhibitory FcγR, FcγRIIb, and the stimulatory receptor, FcγRIII. Rectal temperature was used to detect the development of anaphylaxis. Passive and active IgG-mediated anaphylaxis were evaluated in mice that had been rapidly desensitized with 2.4G2 or mock-desensitized in mice in which monocyte/macrophages, basophils, or neutrophils had been depleted or desensitized and in mice in which FcγRI, FcγRIII, and/or FcγRIV had been deleted or blocked. Rapid desensitization with 2.4G2 prevented 2.4G2-induced shock and completely suppressed IgG-mediated anaphylaxis. Rapid desensitization of ovalbumin-sensitized mice with 2.4G2 was safer and more effective than rapid desensitization with ovalbumin. 2.4G2 treatment completely blocked FcγRIII and removed most FcγRI and FcγRIV from nucleated peripheral blood cells. Because IgG(2a)-mediated anaphylaxis was partially FcγRI and FcγRIV dependent, the effects of 2.4G2 on FcγRI and FcγRIV were probably crucial for its complete inhibition of IgG(2a)-mediated anaphylaxis. IgG(2a)-mediated anaphylaxis was partially inhibited by depletion or desensitization of monocyte/macrophages, basophils, or neutrophils. IgG-mediated anaphylaxis can be induced by ligation of FcγRI, FcγRIII, or FcγRIV on monocycte/macrophages, basophils, or neutrophils and can be safely suppressed by rapid desensitization with anti-FcγRII/RIII mAb. A similar approach may safely suppress other FcγR-dependent immunopathology. Published by Mosby, Inc.

Determinantes de la inversión en I+D: un análisis empírico en empresas europeas de software y servicios informáticos

OpenAIRE

Fernández López, Javier

2013-01-01

Estudio empírico de los factores determinantes de la inversión en I+D en empresas europeas de software y servicios informáticos entre 2004-2010 Economía Financiera y Contabilidad Máster en Contabilidad y Gestión Financiera

Improvement of Biodesulfurization Rate of Alginate Immobilized Rhodococcus erythropolis R1

Science.gov (United States)

Derikvand, Peyman; Etemadifar, Zahra

2014-01-01

Background: Sulfur oxides released from the burning of oil causes severe environmental pollution. The sulfur can be removed via the 4S pathway in biodesulfurization (BDS). Immobilization approaches have been developed to prevent cell contamination of oil during the BDS process. Objectives: The encapsulation of Rhodococcus erythropolis R1 in calcium alginate beads was studied in order to enhance conversion of dibenzothiophene (DBT) to 2-hydroxy biphenyl (2-HBP) as the final product. Also the effect of different factors on the BDS process was investigated. Materials and Methods: Calcium alginate capsules were prepared using peristaltic pumps with different needle sizes to control the beads sizes. Scanning electron microscopy and flow cytometry methods were used to study the distribution and viability of encapsulated cells, respectively. Two non-ionic surfactants and also nano Ƴ-Al2O3were used with the ratio of 0.5% (v/v) and 1:5 (v/v) respectively to investigate their BDS efficiency. In addition, the effect of different bead sizes and different concentrations of sodium alginate in BDS activity was studied. Results: The 2% (w/v) sodium alginate beads with 1.5mm size were found to be the optimum for beads stability and efficient 2-HBP production. The viability of encapsulated cells decreased by 12% after 20 h of desulfurization, compared to free cells. Adding the non-ionic surfactants markedly enhanced the rate of BDS, because of increasing mass transfer of DBT to the gel matrix. In addition, Span 80 was more effective than Tween 80. The nanoƳ-Al2O3 particles could increase BDS rate by up to two-folds greater than that of the control beads. Conclusions: The nano Ƴ-Al2O3 can improve the immobilized biocatalyst for excellent efficiency of DBT desulfurization. Also the BDS activity can be enhanced by setting the other explained factors at optimum levels. PMID:25147685

Fc-fusion Proteins in Therapy: An Updated View.

Science.gov (United States)

Jafari, Reza; Zolbanin, Naime M; Rafatpanah, Houshang; Majidi, Jafar; Kazemi, Tohid

2017-01-01

Fc-fusion proteins are composed of Fc region of IgG antibody (Hinge-CH2-CH3) and a desired linked protein. Fc region of Fc-fusion proteins can bind to neonatal Fc receptor (FcRn) thereby rescuing it from degradation. The first therapeutic Fc-fusion protein was introduced for the treatment of AIDS. The molecular designing is the first stage in production of Fc-fusion proteins. The amino acid residues in the Fc region and linked protein are very important in the bioactivity and affinity of the fusion proteins. Although, therapeutic monoclonal antibodies are the top selling biologics but the application of therapeutic Fc-fusion proteins in clinic is in progress and among these medications Etanercept is the most effective in therapy. At present, eleven Fc-fusion proteins have been approved by FDA. There are novel Fc-fusion proteins which are in pre-clinical and clinical development. In this article, we review the molecular and biological characteristics of Fc-fusion proteins and then further discuss the features of novel therapeutic Fc-fusion proteins. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Resposta cronotrópica ao teste anaeróbio máximo de corrida - MART

Directory of Open Access Journals (Sweden)

Flávio Areal Lemos

2013-06-01

Full Text Available INTRODUÇÃO: A frequência cardíaca (FC no teste anaeróbio máximo de corrida (MART expressa o comportamento autonômico cardíaco em exercício. Ainda não foi investigado se tais respostas cronotrópicas apresentam associação com o desempenho aeróbio e anaeróbio. OBJETIVOS: Descrever a resposta cronotrópica cardíaca durante o MART nos segundos iniciais de estímulo (FC ON e de recuperação (FC OFF e estabelecer a associação entre as variáveis cronotrópicas com o desempenho aeróbio e anaeróbio. MÉTODOS: Foram voluntários 13 homens assintomáticos e fisicamente ativos, com 25,1 ± 4,9 anos, 76,8 ± 12,5 kg, 178,4 ± 9,0 cm e 50,6 ± 4,1 mL×kg‑1×min‑1. Na primeira visita, após a anamnese e medidas antropométricas, foi realizado um teste cardiopulmonar de exercício (TCPE com monitoração direta dos gases expirados. Na segunda visita, foi feita uma familiarização ao MART e na terceira, o teste de MART conduzido até a exaustão. RESULTADOS: A FC de recuperação (58 ± 20 bpm comparada à FC de pico alcançada no primeiro e no último estágio de MART (39 ± 14 bpm apresentou maior inclinação, resultando em maior amplitude de variação ao longo do teste, caracterizando diferenças significativas (P = 0,0017. A FC ON apresentou entre o momento inicial, meio e final do MART diferenças significativas (inicial versus final, p = 0,007. Para FC OFF foram encontradas diferenças significativas do início com o meio (p = 0,035 e do início com o final (p = 0,005 do teste. As correlações entre as variáveis cronotrópicas e de desempenho não apresentaram significância estatística (P < 0,05, assim como com as variáveis de desempenho. CONCLUSÃO: O MART parece ser um modelo de sobrecargas fisiológicas adequado para investigação da modulação autonômica cardíaca. Observou-se atuação do sistema parassimpático mesmo em cargas supramáximas até o final do teste.

« L'idée de développement culturel : esquisse pour une psychanalyse »

Directory of Open Access Journals (Sweden)

Fernand Dumont

2007-06-01

Full Text Available Texte intégral de l’article de Fernand Dumont paru dans la revue Sociologie et Sociétés, vol. XI, n°1, 1979, précédé d’une introduction par Daniel Mercure. Dans cet article, l'auteur discute en profondeur de la notion de développement culturel en se posant les questions suivantes : de quelle culture s'agit-il lorsque l'on parle de développement culturel ? Et pourquoi le développement ? C’est parce que l'auteur plaide pour la primauté de la culture dans l'observation sociale qu'il se montre très critique envers les idées reçues.Unabridged version of the article of Fernand Dumont about « L’idée de développement culturel : esquisse pour une psychanalyse » (« The idea of cultural development : outline of a psychoanalysis », published in Sociologie et Sociétés in 1979. It’s preceded of an introduction by Daniel Mercure. In this paper, the author discusses in depth the notion of cultural development, asking himself the following questions : with which culture are we dealing when we speak of cultural development ? And why development ? Showing himself very critical of accepted ideas, the author pleads the case for the primacy of culture in the process of social observationTexto integral del artículo de Fernand Dumont, « L'idée de développement culturel : esquisse pour une psychanalyse » publicado en la revista Sociologie et Sociétés, vol. XI, n°1, 1979. Prólogo de Daniel Mercure. En este artículo, el autor profudiza la noción de desarrollo cultural y se plantea las preguntas siguientes : de que cultura se trata cuando se habla de desarrollo cultural ? y por qué el desarrollo ? El autor se déclara favorable a la primacía de la cultura en la observación social y es por esta razón que se muestra muy crítico hacia las ideas establecidas.

37 CFR 1.97 - Filing of information disclosure statement.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Filing of information disclosure statement. 1.97 Section 1.97 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing...

Natural form of noncytolytic flexible human Fc as a long-acting carrier of agonistic ligand, erythropoietin.

Directory of Open Access Journals (Sweden)

Se Jin Im

Full Text Available Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc consisting of IgD and IgG4, and tested its function using erythropoietin (EPO conjugate, EPO-hyFc. Despite low amino acid homology (20.5% between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H, a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last. Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.

Natural form of noncytolytic flexible human Fc as a long-acting carrier of agonistic ligand, erythropoietin.

Science.gov (United States)

Im, Se Jin; Yang, Sang In; Yang, Se Hwan; Choi, Dong Hoon; Choi, So Young; Kim, Hea Sook; Jang, Do Soo; Jin, Kyeong Sik; Chung, Yo-Kyung; Kim, Seung-Hee; Paik, Sang Hoon; Park, Yoo Chang; Chung, Moon Koo; Kim, Yong Bum; Han, Kang-Hyun; Choi, Kwan Yong; Sung, Young Chul

2011-01-01

Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc) consisting of IgD and IgG4, and tested its function using erythropoietin (EPO) conjugate, EPO-hyFc. Despite low amino acid homology (20.5%) between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H), a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H) not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last)). Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.

Cross-Linking GPVI-Fc by Anti-Fc Antibodies Potentiates Its Inhibition of Atherosclerotic Plaque- and Collagen-Induced Platelet Activation

Directory of Open Access Journals (Sweden)

Janina Jamasbi, RPh

2016-04-01

Full Text Available To enhance the antithrombotic properties of recombinant glycoprotein VI fragment crystallizable (GPVI-Fc, the authors incubated GPVI-Fc with anti-human Fc antibodies to cross-link the Fc tails of GPVI-Fc. Cross-linking potentiated the inhibition of human plaque- and collagen-induced platelet aggregation by GPVI-Fc under static and flow conditions without increasing bleeding time in vitro. Cross-linking with anti-human-Fc Fab2 was even superior to anti-human-Fc immunoglobulin G (IgG. Advanced optical imaging revealed a continuous sheath-like coverage of collagen fibers by cross-linked GPVI-Fc complexes. Cross-linking of GPVI into oligomeric complexes provides a new, highly effective, and probably safe antithrombotic treatment as it suppresses platelet GPVI-plaque interaction selectively at the site of acute atherothrombosis.

The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.

Science.gov (United States)

Abdiche, Yasmina Noubia; Yeung, Yik Andy; Chaparro-Riggers, Javier; Barman, Ishita; Strop, Pavel; Chin, Sherman Michael; Pham, Amber; Bolton, Gary; McDonough, Dan; Lindquist, Kevin; Pons, Jaume; Rajpal, Arvind

2015-01-01

The neonatal Fc receptor (FcRn) is expressed by cells of epithelial, endothelial and myeloid lineages and performs multiple roles in adaptive immunity. Characterizing the FcRn/IgG interaction is fundamental to designing therapeutic antibodies because IgGs with moderately increased binding affinities for FcRn exhibit superior serum half-lives and efficacy. It has been hypothesized that 2 FcRn molecules bind an IgG homodimer with disparate affinities, yet their affinity constants are inconsistent across the literature. Using surface plasmon resonance biosensor assays that eliminated confounding experimental artifacts, we present data supporting an alternate hypothesis: 2 FcRn molecules saturate an IgG homodimer with identical affinities at independent sites, consistent with the symmetrical arrangement of the FcRn/Fc complex observed in the crystal structure published by Burmeister et al. in 1994. We find that human FcRn binds human IgG1 with an equilibrium dissociation constant (KD) of 760 ± 60 nM (N = 14) at 25°C and pH 5.8, and shows less than 25% variation across the other human subtypes. Human IgG1 binds cynomolgus monkey FcRn with a 2-fold higher affinity than human FcRn, and binds both mouse and rat FcRn with a 10-fold higher affinity than human FcRn. FcRn/IgG interactions from multiple species show less than a 2-fold weaker affinity at 37°C than at 25°C and appear independent of an IgG's variable region. Our in vivo data in mouse and rat models demonstrate that both affinity and avidity influence an IgG's serum half-life, which should be considered when choosing animals, especially transgenic systems, as surrogates.

Immunoglobulin Fc receptors in clinical strains of Staphylococcus aureus do not confer resistance to Phagocytosis in an in vitro assay Los receptores Fc para inmunoglobulinas en cepas clínicas de Staphylococcus aureus no confieren resistencia a la fagocitosis in vitro

Directory of Open Access Journals (Sweden)

Benito VEGA

1999-05-01

Full Text Available Staphylococcus aureus binds Immunoglobulin G (IgG on its external surface due to the presence of specific receptors for the Fc domain of this immunoglobulin. This mechanism represents a kind of camouflage against phagocytic cells. In order to confirm that possibility an in vitro evaluation of the phagocytic activity of leukocytes polymorpho-nuclear (PMN against strains of Staphylococcus aureus was done, comparing 18 strains isolated from clinical samples and 16 from healthy individuals. The presence of Fc receptors was evaluated by haemagglutination (HA with erythrocytes group A after incubation of the strains with IgG anti blood group A. Phagocytosis of S. aureus was carried out by mixing live bacteria with a suspension of human PMN and incubating at 37 °C for 1 h; survivors were counted as colony forming units by plating. The strains from clinical specimens showed higher HA than those from healthy individuals (p = 0.01; but the former were killed more efficiently than the latter (80-90% and 40%, respectively. It is may be possible that S. aureus showed different behavior in vivo, where could express other virulence factors to prevent the action of phagocytes.Staphylococcus aureus liga inmunoglobulinas G (IgG a su superficie externa debido a la presencia de receptores para el dominio Fc de esas inmunoglobulinas. Este mecanismo representa una clase de camuflage contra células fagocíticas. Para confirmar tal posibilidad se realizó una evaluación in vitro de la actividad fagocítica de leucocitos polimorfonucleares (PMN contra cepas de Staphylococcus aureus, comparando 18 cepas aisladas de casos clínicos y 16 de individuos sanos. La presencia de receptores fue evaluada por hemaglutinación (HA con eritrocitos grupo A luego que las cepas fueron incubadas con IgG anti grupo sanguíneo A. La fagocitosis de S. aureus fue realizada mezclando células vivas con una suspensión de PMN e incubada a 37 °C por una hora; las bacterias sobrevivientes

40 CFR 97.323 - CAIR permit contents and term.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.323 Section 97.323 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... authority, as necessary to facilitate coordination of the renewal of the CAIR permit with issuance, revision...

Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS

CERN Document Server

Piersa, Monika

2016-01-01

The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...

Condutividade e teste quantitativo coulométrico na triagem neonatal para fibrose cística

Directory of Open Access Journals (Sweden)

Mouseline Torquato Domingos

2015-12-01

Full Text Available Resumo Objetivo Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém0nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos O teste do suor foi feito simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60 mmol/L. Resultados Fizeram o teste do suor por condutividade e dosagem coulométrica simultaneamente 444 RN sem FC (185 do sexo masculino, 234 do feminino e 24 não informado e obtiveram resultado mediano de 32 mmol/L e 12 mmol/L respectivamente. Para os noventa RN com FC os valores medianos de condutividade e dosagem coulométrica foram 108 mmol/L e 97 mmol/L respectivamente. O índice de falso positivo para condutividade foi de 16,7% e em todos os pacientes FC foi superior a 50 mmol/L, o que confere ao método 100% de sensibilidade (IC 95% = 93,8 a 97,8, especificidade de 96,2% (IC 95% = 93,8 a 97,8, valor preditivo positivo 83,3 (IC 95% = 74,4 a 91,1, valor preditivo negativo 100% (IC 95% = 90,5 a 109,4 e acurácia 9,8%. A correlação entre os métodos foi de r = 0,97 (p > 0,001.O melhor valor de corte sugerido foi de 69,0 mmol/L, coeficiente de kappa = 0,89. Conclusão O teste da condutividade apresentou excelente correlação com o quantitativo coulométrico, alta sensibilidade e especificidade e pode ser usado no diagnóstico da FC em crianças detectadas pela triagem neonatal.

A difusão do Priscilianismo pela Gallaecia: o testemunho de Idácio de Chaves * The diffusion of Priscillianism for through Gallaecia: the testimony of Hydatius of Chaves

Directory of Open Access Journals (Sweden)

DANILO MEDEIROS GAZZOTTI

2012-05-01

Full Text Available O presente artigo tem o intuito de realizar uma análise da crônica do bispo Idácio de Chaves. Esse episcopal era um fiel seguidor do Concílio de Niceia e, por isso, era totalmente contra as interpretações cristãs que diferiam da oficial, o cristianismo ortodoxo. Na região de seu episcopado, Idácio teve que lidar com uma interpretação cristã chamada de priscilianismo, a qual teve muita aceitação pela população. Apesar de não ser adotada em larga escala por um povo bárbaro, como o arianismo, a mesma acabou se difundido de tal modo na região da Gallaecia que viria a ser um dos motivos por qual Idácio de Chaves acreditava que a unificação religiosa do Império Romano na região estava ameaçada. Temos a intenção de discorrer nesse artigo sobre a difusão do priscilianismo nessa região durante finais do século IV d.C. até meados do século V d.C. e de interpretar o que foi essa heresia para Idácio de Chaves. Palavras-chave: Priscilianismo – Gallaecia – Idácio de Chaves.  Abstract: This paper aims to carry out an analysis about the chronicle of the Bishop Hydatius. This espiscopate was a loyal believer of the Council of Nicaea and, for that reason, he was thoroughly against Christian interpretations which were different from the official one, the orthodox Christianity. In his episcopal region, Hydatius had to deal with a Christian interpretation called Priscillianism, which had a lot of acceptance by the population. Although it was not largely adopted by a barbarian population like arianism, it became much widespread in the region of Gallaecia which would be one of the reasons in which Hydatius believed that the religious unification of Roman Empire in the region was endangered. In this article, we aim to talk about the diffusion of Priscillianism in this region during the end of IV Century a.C. until in the middle V Century a.D. and to interpret what this heresy was to Hydatius of Chaves. Keywords: Priscillianism �

29 CFR 97.20 - Standards for financial management systems.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Standards for financial management systems. 97.20 Section 97... Standards for financial management systems. (a) A State must expand and account for grant funds in... financial management systems of other grantees and subgrantees must meet the following standards: (1...

40 CFR 97.123 - CAIR permit contents and term.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.123 Section 97.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR NOX...

Ferdinand Buisson no Brasil: pistas, vestígios e sinais de suas idéias pedagógicas (1870-1900

Directory of Open Access Journals (Sweden)

Maria Helena Camara Bastos

2012-06-01

Full Text Available  O presente estudo analisa a influência das idéias pedagógicas de Ferdinand Buisson no Brasil, nas três décadas finais do século 19, a partir da análise da produção de dois representantes da ilustração brasileira - Rui Barbosa (1849-1923 e Joaquim José Menezes Vieira (1848-1897. Busca pistas, sinais e vestígios de sua influência na tradução de Primary Object Lessons (leçons de choses de Norman Allison Calkins, por Rui Barbosa em 1881; na implantação do método intuitivo; na elaboração dos Pareceres de Reforma do Ensino Primário, Secundário, Superior e de várias instituições complementares, por Rui Barbosa (1882-1883; na realização de exposições pedagógica (1883 e escolares; na implantação do Pedagogium (1890-1919, museu pedagógico brasileiro segundo o modelo francês; na redação da Revista Pedag6gica (1890-1896, editada segundo a organização da Revue Pédagogique, por Menezes Vieira.Palavras-chave: história da educação, idéias pedagógicas, influência francesa.   Résume L'étude analyse I'influence des idées pédagogiques de Ferdinand Buisson au Brésil, pendant les trois dernieres décennies du 19eme siecle, à travers I'analyse de Ia production des deux représentants de l'illustration brésilienne - Rui Barbosa (1849-1923 et Joaquim José de Menezes Vieira (1848-1897. On cherchera des traces, signaux et vestiges de l'influence de Buisson dans Ia traduction, par Rui Barbosa, de l'oeuvre Primary Object Lessons (Leçon de choses, de Norman Allison Calkins, en 1881; dans l'élaboration des Pareceres de Reforma do Ensino Primário, Secundário, Superior e de Várias Instituições Complementares (Exposé sur Ia Réforme de I'Enseignement primaire, secondaire, supérieur et d'autres institutions complémentaires par Rui Barbosa (1882-1883; dans promotion de Ia méthode intuitive; dans Ia réalisation d'expositions pédagogiques (1883 et scolaires; dans I'implantation du musée pédagogique Pedagogium

Establishing the transport properties of QCD with heavy ion reactions. Final Scientific Report for DE-FG02-07ER41524

International Nuclear Information System (INIS)

Teaney, Derek

2008-01-01

During the time period from 9/1/07 - 3/1/08 the principle investigator was awarded a federal grant from the Department of Energy (DE-FG02-07ER41524) to establish the transport properties of QCD through heavy ion reactions. A relativistic viscous hydrodynamic computer code was developed in 2+1 dimensions which is suitable for extracting the shear viscosity from available heavy ion data. In addition, the transport coefficients of heavy mesons in strongly coupled N = 4 plasmas were determined using the gauge gravity duality. These transport coefficients are suppressed by 1/N c 2 which stymied previous efforts to determine the kinetics of these mesons.

40 CFR 97.223 - CAIR permit contents and term.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.223 Section 97.223 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR SO2...

Yucca Mountain Project Integrated Data System (IDS). Final report, October 1, 1989--December 31, 1990

International Nuclear Information System (INIS)

1991-01-01

This final report for LANL Subcontract 9-XS8-2604-1 includes copies of all formal letters, memorandums, and reports provided by CAG to support the IDS effort in the LANL Test Managers Office, Las Vegas, Nevada from October 1, 1989 through the end of the contract on December 31, 1990. The material is divided into two sections; the Functional Requirements Document (FRD) and other reports, letters, and memorandums. All documents are arranged in chronological order with most recent last. Numerous draft copies of the FRD were prepared and cover sheets for all drafts are included. The complete text of only the last version supplied (July 27, 1990) is included in this document

Valor de las pruebas inmunológicas en el diagnóstico de las enfermedades micóticas: experiencia de un centro de referencia

Directory of Open Access Journals (Sweden)

Magaly Chinchilla

1998-09-01

Full Text Available Las pruebas inmunológicas han sido ampliamente utilizadas como evidencia indirecta de infección micótica y tienen valor diagnóstico; algunas de estas pruebas pueden ser fácilmente adaptadas en los laboratorios con un bajo nivel de complejidad. El Laboratorio de Mitología del Grupo de Microbiología del lnstituto Nacional de Salud es centro de referencia para el diagnóstico de las micosis sistémicas en el país; por tal motivo y con el fin de establecer una red nacional, se seleccionaron cuatro laboratorios regionales y se entrenó personal en técnicas inmunológicas para realizar el diagnóstico de la histoplasmosis y de la paracoccidioidomicosis. Las técnicas empleadas fueron: inmunodifusión (ID para histoplasmosis, paracoccidioidomicosis y aspergilosis; fijación de complemento (FC para histoplasmosis y paracoccidioidomicosis y, aglutinación con partículas de látex para la antigenemia en la criptococosis. En un período de 7 años (1990 -1996, los laboratorios procesaron 6.841 muestras de suero correspondientes a 6.411 pacientes con diagnósticos compatibles con micosis sistémicas. Los cuatro laboratorios regionales analizaron 1.918 muestras (28% y el centro de referencia, 4.923 (72%. La reactividad total fue de 13,5% (923/6.841, discriminada así: histoplasmosis, 42,5%; paracoccidioidomicosis, 33%; criptococosis, 21,2%, y aspergilosis, 3,3%. El número total de casos diagnosticados fue de 441: 155 histoplasmosis, 120 paracoccidioidomicosis, 138 criptococosis y 28 aspergilosis. El empleo de la ID en los centros regionales permitió el diagnóstico de 31% de los pacientes con histoplasmosis, de 41,6% de los pacientes con paracoccidioidomicosis y 53,6% de los pacientes con aspergilosis, lo cual indica que el diagnóstico precoz se puede realizar a nivel regional. La sensibilidad y la simplicidad de la prueba de ID constituye un excelente recurso para los laboratorios de baja complejidad, a nivel regional, que operan en áreas endémicas.

Human FcγRIIA induces anaphylactic and allergic reactions.

Science.gov (United States)

Jönsson, Friederike; Mancardi, David A; Zhao, Wei; Kita, Yoshihiro; Iannascoli, Bruno; Khun, Huot; van Rooijen, Nico; Shimizu, Takao; Schwartz, Lawrence B; Daëron, Marc; Bruhns, Pierre

2012-03-15

IgE and IgE receptors (FcεRI) are well-known inducers of allergy. We recently found in mice that active systemic anaphylaxis depends on IgG and IgG receptors (FcγRIIIA and FcγRIV) expressed by neutrophils, rather than on IgE and FcεRI expressed by mast cells and basophils. In humans, neutrophils, mast cells, basophils, and eosinophils do not express FcγRIIIA or FcγRIV, but FcγRIIA. We therefore investigated the possible role of FcγRIIA in allergy by generating novel FcγRIIA-transgenic mice, in which various models of allergic reactions induced by IgG could be studied. In mice, FcγRIIA was sufficient to trigger active and passive anaphylaxis, and airway inflammation in vivo. Blocking FcγRIIA in vivo abolished these reactions. We identified mast cells to be responsible for FcγRIIA-dependent passive cutaneous anaphylaxis, and monocytes/macrophages and neutrophils to be responsible for FcγRIIA-dependent passive systemic anaphylaxis. Supporting these findings, human mast cells, monocytes and neutrophils produced anaphylactogenic mediators after FcγRIIA engagement. IgG and FcγRIIA may therefore contribute to allergic and anaphylactic reactions in humans.

An online ID identification system for liquefied-gas cylinder plant

Science.gov (United States)

He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao

2017-11-01

An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.

A novel Bacillus pumilus-related strain from tropical landfarm soil is capable of rapid dibenzothiophene degradation and biodesulfurization.

Science.gov (United States)

Buzanello, Elizandra Bruschi; Rezende, Rachel Passos; Sousa, Fernanda Maria Oliveira; Marques, Eric de Lima Silva; Loguercio, Leandro Lopes

2014-10-08

The presence of organic sulfur-containing compounds in the environment is harmful to animals and human health. The combustion of these compounds in fossil fuels tends to release sulfur dioxide in the atmosphere, which leads to acid rain, corrosion, damage to crops, and an array of other problems. The process of biodesulfurization rationally exploits the ability of certain microorganisms in the removal of sulfur prior to fuel burning, without loss of calorific value. In this sense, we hypothesized that bacterial isolates from tropical landfarm soils can demonstrate the ability to degrade dibenzothiophene (DBT), the major sulfur-containing compound present in fuels. Nine bacterial isolates previously obtained from a tropical landfarm soil were tested for their ability to degrade dibenzothiophene (DBT). An isolate labeled as RR-3 has shown the best performance and was further characterized in the present study. Based on physiological aspects and 16 s rDNA sequencing, this isolate was found to be very closely related to the Bacillus pumillus species. During its growth, high levels of DBT were removed in the first 24 hours, and a rapid DBT degradation within the first hour of incubation was observed when resting cells were used. Detection of 2-hydroxybiphenyl (HBP), a marker for the 4S pathway, suggests this strain has metabolical capability for DBT desulfurization. The presence of MgSO4 in growth medium as an additional sulfur source has interfered with DBT degradation. To our knowledge, this is the first study showing that a Bacillus strain can metabolize DBT via the 4S pathway. However, further evidences suggest RR-3 can also use DBT (and/or its derivative metabolites) as carbon/sulfur source through another type of metabolism. Compared to other reported DBT-degrading strains, the RR-3 isolate showed the highest capacity for DBT degradation ever described in quantitative terms. The potential application of this isolate for the biodesulfurization of this sulfur

Quadripartition et idéologie dans les communautés aymaras de Carangas (Bolivie

Directory of Open Access Journals (Sweden)

1983-01-01

Full Text Available Dans les communautés aymaras de Carangas (hauts-plateaux boliviens les moitiés et ayllu existent toujours bien qu'ils aient perdu, depuis longtemps sans doute, toute fonction économique et sociale spécifique. Les représentations symboliques qui lient ces unités entre elles ont cependant pu conserver une fonction idéologique importante jusqu'à nos jours, nécessaire pour assurer la continuité et la solidarité de la communauté. Il convient pourtant de ne pas généraliser et de considérer la variété des contextes. L'exemple de Sabaya montre que dans une société où les tensions et les inégalités sont de plus en plus fortes, la fonction idéologique du langage quadripartite a rapidement perdu son sens: ignoré ou oublié par les secteurs dominants, il n'est désormais utilisé que par une population paysanne marginalisée. Dès lors, le dualisme et la quadripartition ne sont plus le signe d'une belle tradition supposée andine mais la manifestation d'un traditionalisme devenu 'obligatoire'. En las comunidades aymaras de Carangas (altiplano boliviano, las mitades y los ayllu siguen existiendo aunque hayan perdido, desde mucho tiempo, toda función económica y social específica. Sin embargo las representaciones simbólicas que ligan esas unidades entre sí han podido conservar una función ideológica importante hasta nuestros días en la medida en que garantizan la continuidad y la solidaridad de la comunidad. En todo caso conviene considerar la variedad de los contextos para evitar toda clase de generalización El ejemplo de Sabaya muestra que en una sociedad donde las tensiones y las desigualdades son cada vez más fuertes, la función ideológica del lenguaje cuadripartita ha perdido rápidamente su sentido: olvidado o ignorado por los sectores dominantes, ahora sólo es utilizado por una población campesina marginalizada. El dualismo y la cuadripartición ya no son entonces la expresión de una bella tradición andina sino

Ingestão de alimentos e adequação de nutrientes no final da infância Food intake and nutritional adequacy in final phase of childhood

Directory of Open Access Journals (Sweden)

Maria de Fátima Machado de ALBUQUERQUE

2002-09-01

Full Text Available Este trabalho reúne informações sobre a ingestão de alimentos e a adequação dos nutrientes no período final da infância. O grupo estudado foi composto por 247 escolares, sendo 150 do sexo feminino e 97 do masculino, com idade de nove e dez anos, pertencentes a escolas públicas municipais de Maceió. Os dados sobre ingestão de alimentos foram coletados através do recordatório de 24 horas e comparados com as recomendações preconizadas pelo National Research Council de 1989. De acordo com os resultados, a ingestão alimentar dos escolares apresentou-se deficiente em relação à energia e aos micronutrientes, especialmente as vitaminas e alguns minerais pesquisados, com exceção do ferro. Essa deficiência foi encontrada independente do sexo. Tais achados sugerem que o aporte insuficiente dos nutrientes estudados, se persistente, poderá contribuir negativamente para o desempenho do crescimento linear durante a fase da adolescência.This study analyzes the results of a dietary intake survey. The main goal was to estimate the nutrient and energy intake of children in final phase of childhood and the nutritional adequacy of their diet. The studied group was composed of 247 schoolchildren (150 females and 97 males, aged nine to ten years old from public schools of the city of Maceió, state of Alagoas. Food intake data were collected through a 24-hour dietary recall and compared with the standards of National Research Council-Recommended Dietary Allowances (RDA, 1989. According to the results, the children food intake, independently of the sex, was deficient in energy and micronutrients, specially vitamins and some minerals, with the exception of iron. These findings suggest that in this group specific nutrients deficits can be a limiting factor which may contribute to an inadequate growth performance during adolescence.

O papel das Forças Armadas na I&D da Defesa como vector de desenvolvimento nacional

OpenAIRE

Simões, Luís

2010-01-01

A humanidade sempre se preocupou com o seu bem-estar, de alguma forma. Neste âmbito, o desenvolvimento económico tem vindo a desempenhar um papel fundamental. Após a revolução industrial, mas particularmente depois da II Guerra Mundial, os Estados têm-se preocupado com o respectivo desenvolvimento económico sustentável, entre outras questões, como garante de bem-estar das suas populações. A investigação e desenvolvimento (I&D), no seu conjunto, têm sido apontados como um possível vector de de...

Um novo Fundef? As idéias de Anísio Teixeira

Directory of Open Access Journals (Sweden)

Amaral Nelson Cardoso

2001-01-01

Full Text Available O professor Anísio Teixeira, na década de 1960, preocupado com o financiamento da educação, apresentou uma proposta de como definir e implantar um fundo que garantisse recursos permanentes para o ensino primário. Em seus aspectos metodológicos, o Fundo de Manutenção e Desenvolvimento do Ensino Fundamental e de Valorização do Magistério (Fundef, criado pelo Governo, assemelha-se à proposta apresentada por Anísio Teixeira. Existem, entretanto, diferenças importantes e fundamentais, pelo fato do professor Anísio definir o volume total de recursos a partir do estabelecimento do salário dos docentes. Nesse estudo apresentam-se as semelhanças e diferenças entre os dois fundos e realiza-se uma simulação do que se poderia chamar "Um novo Fundef", baseado nas idéias de Anísio Teixeira. Como resultado, obtém-se valores perfeitamente viáveis para serem financiados por uma economia com a dimensão da economia brasileira, assim como ocorreu no estudo apresentado por Anísio Teixeira no livro Educação é um direito.

Bulk Fermi surface and electronic properties of Cu0.07Bi2Se3

Science.gov (United States)

Martin, C.; Craciun, V.; Miller, K. H.; Uzakbaiuly, B.; Buvaev, S.; Berger, H.; Hebard, A. F.; Tanner, D. B.

2013-05-01

The electronic properties of Cu0.07Bi2Se3 have been investigated using Shubnikov-de Haas and optical reflectance measurements. Quantum oscillations reveal a bulk, three-dimensional Fermi surface with anisotropy kFc/kFab≈ 2 and a modest increase in free-carrier concentration and in scattering rate with respect to the undoped Bi2Se3, also confirmed by reflectivity data. The effective mass is almost identical to that of Bi2Se3. Optical conductivity reveals a strong enhancement of the bound impurity bands with Cu addition, suggesting that a significant number of Cu atoms enter the interstitial sites between Bi and Se layers or may even substitute for Bi. This conclusion is also supported by x-ray diffraction measurements, where a significant increase of microstrain was found in Cu0.07Bi2Se3, compared to Bi2Se3.

Id1 and Id3 expression is associated with increasing grade of prostate cancer: Id3 preferentially regulates CDKN1B

International Nuclear Information System (INIS)

Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep

2012-01-01

As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype

Advances in therapeutic Fc engineering - modulation of IgG associated effector functions and serum half-life

Directory of Open Access Journals (Sweden)

Abhishek Saxena

2016-12-01

Full Text Available Today monoclonal immunoglobulin gamma (IgG antibodies have become a major option in cancer therapy especially for the patients with advanced or metastatic cancers. Efficacy of monoclonal antibodies (mAbs are achieved through both its antigen binding fragment (Fab and crystallizable fragment (Fc. Fab can specifically recognize tumor associated antigen (TAA and thus modulate TAA-linked downstream signaling pathways that may lead to inhibition of tumor growth, induction of tumor apoptosis and differentiation. The Fc region can further improve mAbs’ efficacy by mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC, complement-dependent cytotoxicity (CDC and antibody dependent cell-mediated phagocytosis (ADCP. Moreover, Fc is the region interacting with the neonatal Fc receptor (FcRn in a pH-dependent manner that can slow down IgG’s degradation and extend its serum half-life. Loss of the antibody Fc region dramatically shortens its serum half-life and weakens its anti-cancer effects. Given the essential roles that the Fc region plays in the modulation of the efficacy of mAb in cancer treatment, Fc engineering has been extensively studied in the past years. This review focuses on the recent advances in therapeutic Fc engineering that modulates its related effector functions and serum half-life. We also discuss the progress made in aglycosylated mAb development that may substantially reduce cost of manufacture but maintain similar efficacies as conventional glycosylated mAb. Finally, we highlight several Fc engineering based mAbs under clinical trials.

Comparison of the Fc fragment from a human IgG1 and its CH2, pFc', and tFc' subfragments. A study using reductive methylation and 13C NMR

International Nuclear Information System (INIS)

Jentoft, J.E.; Rayford, R.

1989-01-01

The Fc fragment of a human monoclonal IgG1 was compared with subfragments containing (a) the intact CH2 domain (CH2 fragment) or (b) the intact CH3 domain (pFc' and tFc' fragments). All fragments were reductively 13 C-methylated and their resulting dimethyllysyl resonances characterized in 0.1 M KCl as a function of pH by 13 C NMR spectroscopy. Seven resonances were characterized for the 18 lysine residues of the Fc fragment, eight for the 12 lysines of the CH2 fragment, and five each for the 9 lysines of the pFc' and the 6 lysines of the tFc' fragments, respectively. The multiplicity of resonances indicates that the lysine residues in each fragment exist in a variety of microenvironments and that the fragments are all highly structured. The correspondence between 6 of the 12 or 13 perturbed lysine residues in the Fc fragment and the smaller subfragments indicates that the conformation of the CH2 and CH3 domains is largely unchanged in the smaller fragments. However, in addition to three lysines at the CH2-CH3 domain interface, whose environments were known to be disrupted in the smaller fragments, three or four lysine residues have somewhat different properties in the Fc fragment and in the subfragments, indicating that some local perturbations are included in the domain structure in the subfragments

Información sobre I+D y valoración de empresas El caso del sector automotriz en Estados Unidos de Norteamérica y Reino Unido

OpenAIRE

Teresa Duarte Atoche; José Ángel Pérez López; José Antonio Camúñez Ruiz

2012-01-01

Los Principios de Contabilidad Generalmente Aceptados en EE.UU. requieren del tratamiento como gasto de las inversiones de I+D. Sin embargo, las Normas Internacionales de Información Financiera permiten su capitalización siempre y cuando se cumplan ciertos criterios (IAS 38). En la actualidad, la Junta de Normas Internacionales de Contabilidad (IASB) y el Consejo de Normas de Contabilidad Financiera (FASB) están de acuerdo en unificar esfuerzos para reducir o eliminar las diferencias entre el...

Substituição parcial e total da proteína do farelo de soja pela proteína dos farelos de canola e algodão em dietas para alevinos de piavuçu, Leporinus macrocephalus (Garavello & Britski, 1988 Partial and total replacement of soybean meal protein by canola or cottonseed meal protein in diets of Leporinus macrocephalus (Garavello & Britski, 1988 fingerlings

Directory of Open Access Journals (Sweden)

Anna Christina Esper Amaro de Faria

2001-05-01

Full Text Available Com o objetivo de avaliar a substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC e farelo de algodão (FA, em dietas para alevinos de piavuçu, Leporinus macrocephalus (Characiformes, Anostomidae, realizou-se um experimento com duração de 60 dias, utilizando-se 300 alevinos, com peso inicial médio de 0,10 g distribuídos em um delineamento em blocos casualizados, com seis tratamentos e cinco repetições. As dietas isoprotéicas foram formuladas de forma a terem o FS, FC, FA, FS+FC, FS+FA e FC+FA como fonte protéica. Os alevinos, alimentados com dietas contendo FS e FS+FA, apresentaram valores de peso final e taxa de eficiência protéica superiores (p 0,05 pelo uso das diferentes dietas. Observou-se redução linear dos valores de peso final, da taxa de eficiência protéica e aumento linear (p The effects of soybean meal (SB protein replacement by canola meal (CN or cottonseed meal (CT protein in diets of Leporinus macrocephalus (Characiformes, Anostomidae fingerlings are provided. Assay was carried out during 60 days. Three hundred fingerlings with mean initial weight of 1.00g were distributed in a block randomized design with six treatments and five replicates. Isoprotein diets contained SB, CN, CT, SB+CN, SB+CT and CN+CT as protein source. Fingerlings fed on diets with SB, SB+CN, SB+CT showed better final mean weight and protein efficiency rate values (p 0.05 by different diets linear reduction (p macrocephalus fingerlings, replacing 50.00% of SB protein.

O conceito de federalismo e a idéia de interesse no Brasil do século XIX

Directory of Open Access Journals (Sweden)

Ivo Coser

2008-01-01

Full Text Available Dans cet article, on cherche à comprendre la formation du concept de fédéralisme dans le domaine politique brésilien du XIXe siècle. C'est-à-dire, le passage du concept de confédération vers celui de fédéralisme ainsi que les valeurs politiques qui y seront associés. Suivant la méthodologie de l'Histoire des Concepts proposée par Reinhart Koselleck, on a essayé d'observer les continuités et les discontinuités par rapport au sujet de la décentralisation. D'après l'analyse des journaux et des débats parlementaires de l'époque, on perçoit que l'idée d'intérêt provincial est un aspect fondamental pour comprendre la pensée fédéraliste diffusée pendant la première moitié du XIXe siècle.

40 CFR 97.253 - Recordation of CAIR SO2 allowances.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 97... (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR SO2 Allowance Tracking System § 97.253 Recordation of CAIR SO2 allowances. (a)(1) After a compliance account is...

Fibrose Cística: Análise da Coorte de 10 Anos de um Programa para Adultos

Directory of Open Access Journals (Sweden)

Paulo de Tarso Roth Dalcin

2011-07-01

Full Text Available Introdução: A fibrose cística (FC que já foi considerada doença da criança é agora doença do adulto e requer programa para adultos. Objetivo: definir características clínicas de uma coorte de 10 anos de um programa para adultos com FC e determinar as características associadas com desfechos clínicos. Métodos: coorte retrospectiva de pacientes com FC (idade ≥ 10 anos atendida pelo Programa para Adultos do Hospital de Clínicas de Porto Alegre, de outubro de 1998 a outubro de 2008. Foram coletados dados demográficos, dados clínicos, status nutricional, função pulmonar, testes laboratoriais e microbiologia do escarro. Foram definidos como desfechos clínicos: sobrevivência, sobrevivência com transplante pulmonar e óbito. Resultados: foram atendidos 94 pacientes pelo programa para adultos. A média de idade foi 24,0±7,4 anos e a média do volume expiratório forçado no primeiro segundo (VEF1 foi 56,4±28,8%. Setenta e sete pacientes foram sobreviventes, 6 sobreviventes com transplante pulmonar e 11 morreram. Na análise univariada, etnia caucasiana (p=0,016, mutação F508del (p=0,04, escore clínico (p<0,001, índice de massa corporal (p<0,001,  oxigenoterapia (p<0,001, capacidade vital forçada (p=0,023 e VEF1 (p<0,001 se associaram com os desfechos clínicos. A análise de regressão logística identificou fatores associados com desfecho precário: VEF1 (RC=0,.72, ICI=0,54-0,94, p=0,017 e escore clínico  (RC = 0,70, IC=0,50-0,97, p = 0,034. Insuficiência respiratória crônica exacerbada por infecção respiratória aguda foi causa imediata de morte na maioria dos casos. Conclusão: Este estudo descreveu uma coorte de 94 pacientes com FC atendidos por um programa de adultos. VEF1 e escore clinico se associaram com os desfechos clínicos.

HAL/S-FC compiler system specifications

Science.gov (United States)

1976-01-01

This document specifies the informational interfaces within the HAL/S-FC compiler, and between the compiler and the external environment. This Compiler System Specification is for the HAL/S-FC compiler and its associated run time facilities which implement the full HAL/S language. The HAL/S-FC compiler is designed to operate stand-alone on any compatible IBM 360/370 computer and within the Software Development Laboratory (SDL) at NASA/JSC, Houston, Texas.

Adaptación del Inventario de Estrategias de Afrontamiento (CSI a la población penitenciaria de Mexico

Directory of Open Access Journals (Sweden)

Francisco Javier Rodríguez-Díaz

2014-01-01

Full Text Available El objetivo del estudio es adaptar el CSI - Inventario de Estrategias de Afrontamiento - al contexto penitenciario. La muestra - 261 penados, 97% varones (n=253 - del Sistema Postpenitenciario y Atención a Liberados (DSPAL del Estado Jalisco, México. Los instrumentos utilizados: Ficha Penitenciaria de Historia de Vida y el Inventario CSI. Los resultados refieren una estructura de primer orden casi idéntica a la obtenida para la población general, con niveles de consistencia interna satisfactorios, al mismo tiempo que la interpretación de segundo orden no confirma la estructura de segundo y tercer orden. Se discuten las implicaciones de los resultados para intervención penitenciaria.

Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha Tomato seedlings production using substrates with coconut fiber and rock waste

Directory of Open Access Journals (Sweden)

Regynaldo A Sampaio

2008-12-01

Full Text Available Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC e pó de rocha de granito (RG como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC e pó de rocha de granito (RG: T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. O cultivo foi feito em bandeja de poliestireno expandido com células de 3,5 x 3,5 x 5,0 cm. Foram avaliados o diâmetro do coleto, a altura da planta, o índice de velocidade de emergência, a percentagem de emergência e a massa fresca e seca da parte aérea e da raiz. Em praticamente todas as características avaliadas o substrato comercial foi superior aos substratos contendo fibra de coco e pó de rocha. Considerando-se apenas os substratos contendo fibra de coco e pó de rocha, as mudas com melhores características foram obtidas com a mistura de aproximadamente 70% em volume de fibra de coco.A greenhouse experiment was carried out to evaluate the ratio of coconut fiber and rock waste, in the tomato seedling production (cultivar Kada Gigante, in Montes Claros, Brazil. The experimental design was of randomized complete blocks with four replicates. The treatments were composed of a control and six ratios of coconut fiber (FC and rock waste (RG: T1 - Commercial Substrate Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. The cultivation was done in polystyrene trays with cells of 3.5 x 3.5 x 5,0 cm. Stem diameter, seedling height, emergency speed index, emergency percentage, root and aerial part of fresh and dry matter were evaluated. In

40 CFR 97.85 - NOX Budget opt-in permit contents.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false NOX Budget opt-in permit contents. 97... (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Individual Unit Opt-ins. § 97.85 NOX Budget opt-in permit contents. (a) Each NOX Budget opt-in permit will contain all elements...

Qualidade de vida, ponto de partida ou resultado final?

Directory of Open Access Journals (Sweden)

Alby Duarte Rocha

Full Text Available O que é qualidade de vida e o quanto podemos medir dela? Pensa-se em qualidade de vida como resultado das políticas públicas e desenvolvimento de uma sociedade, onde os determinantes socioambientais se manifestam como atributo de seus atores. Ao mesmo tempo, pode-se entender esta idéia no outro extremo da análise, a partir da percepção de uma população protagonista de sua realidade, do que vem a ser qualidade de vida segundo ela mesma. Partindo-se dos aspectos conceituais de qualidade de vida, passou-se a adotar os conceitos de diferenciais intra-urbanos como a melhor maneira de caracterizar os desajustes e as desigualdades urbanas, para assim entender os componentes da iniqüidade desse meio. A primeira iniciativa marcou a utilização do método genebrino ou distancial. Hoje, já na segunda versão desse método, incorporou-se a esse contexto outras metodologias que possibilitam maior consistência de análise para ampliar a validade dessas medições. Soma-se a esse contexto, a análise de cluster e o Sistema de Informações Geográficas, tanto no cenário intra-urbano, quanto intermunicipal.

Quand l’idée fixe se met « à table »

Directory of Open Access Journals (Sweden)

Cécile de Bary

2008-03-01

Full Text Available Un livre de cuisine, comme A table de Claudian, édité en 1963, peut relever de la prose d’idées dans la mesure où son projet est sous-tendu par une idéologie très précise, qui seule lui donne sa cohérence. Si l’ethnocentrisme consiste à ne pas reconnaître à l’autre une culture, par exemple, ce livre apparaît comme ethnocentrique, puisqu’il a pour projet de départager les peuples qui savent et ceux qui ne savent pas. Il est encore réactionnaire, voué au rétablissement des savoir-faire des terroirs, contre les corruptions parisiennes en particulier. Dès lors, la présentation d’un plat est toujours susceptible de s’étendre ou de se faire discours, sous la poussée d’un lyrisme acrimonieux. Pour autant, il ne s’agit pas d’un faux livre de cuisine, d’un traité ou d’une « physiologie ». La recette est l’aboutissement logique de l’idée fixe. Elle est le lieu d’une bataille que l’argumentation sert, qu’elle met en scène et qu’elle prépare.

Assessing the Heterogeneity of the Fc-Glycan of a Therapeutic Antibody Using an engineered FcγReceptor IIIa-Immobilized Column.

Science.gov (United States)

Kiyoshi, Masato; Caaveiro, Jose M M; Tada, Minoru; Tamura, Hiroko; Tanaka, Toru; Terao, Yosuke; Morante, Koldo; Harazono, Akira; Hashii, Noritaka; Shibata, Hiroko; Kuroda, Daisuke; Nagatoishi, Satoru; Oe, Seigo; Ide, Teruhiko; Tsumoto, Kouhei; Ishii-Watabe, Akiko

2018-03-02

The N-glycan moiety of IgG-Fc has a significant impact on multifaceted properties of antibodies such as in their effector function, structure, and stability. Numerous studies have been devoted to understanding its biological effect since the exact composition of the Fc N-glycan modulates the magnitude of effector functions such as the antibody-dependent cell mediated cytotoxicity (ADCC), and the complement-dependent cytotoxicity (CDC). To date, systematic analyses of the properties and influence of glycan variants have been of great interest. Understanding the principles on how N-glycosylation modulates those properties is important for the molecular design, manufacturing, process optimization, and quality control of therapeutic antibodies. In this study, we have separated a model therapeutic antibody into three fractions according to the composition of the N-glycan by using a novel FcγRIIIa chromatography column. Notably, Fc galactosylation was a major factor influencing the affinity of IgG-Fc to the FcγRIIIa immobilized on the column. Each antibody fraction was employed for structural, biological, and physicochemical analysis, illustrating the mechanism by which galactose modulates the affinity to FcγRIIIa. In addition, we discuss the benefits of the FcγRIIIa chromatography column to assess the heterogeneity of the N-glycan.

Cultura Organizacional e Gestão de Equipes de Alto Rendimento: Os Casos FC Barcelona, Sporting Club de Portugal e AFC Ajax

Directory of Open Access Journals (Sweden)

Ary José Rocco Júnior

2015-01-01

Full Text Available 800x600 Em todo o mundo, a chamada Indústria do Esporte vêm experimentando vertiginoso crescimento financeiro. Com isso, o papel das agremiações esportivas adquiriu especial importância dentro da sociedade contemporânea global. A relevância do planejamento estratégico dessas organizações fez crescer a necessidade dos clubes esportivos investirem em estratégias que permitam o seu correto posicionamento no mercado e as suas conquistas no campo esportivo. A implantação e o desenvolvimento de uma cultura organizacional que permita o desenvolvimento de uma identidade do clube que agregue todos os seus stakeholders – atletas, torcedores, patrocinadores, marcas, investidores e outros -, é uma dessas estratégias. A criação estratégica e planejada de valores e princípios organizacionais que equilibrem resultados econômicos, mercadológicos e financeiros, com a performance esportiva, colabora para o desenvolvimento e implantação de uma cultura, que gera receita e traz conquistas no campo esportivo. O objetivo deste artigo é analisar três casos de sucesso – FC Barcelona, da Espanha; Sporting Club de Portugal; e, AFC Ajax, da Holanda -, de organizações esportivas que implantaram estratégias dessa natureza na Europa. Pretendemos, com isso, estimular agremiações esportivas do Brasil a adotarem estratégias semelhantes. Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4

Final Report for DOE Grant DE-FG02-03ER25579; Development of High-Order Accurate Interface Tracking Algorithms and Improved Constitutive Models for Problems in Continuum Mechanics with Applications to Jetting

Energy Technology Data Exchange (ETDEWEB)

Puckett, Elbridge Gerry [U.C. Davis, Department of Mathematics; Miller, Gregory Hale [.C. Davis, Department of Chemical Engineering

2012-10-14

published by Dr. Phillip Colella, the head of ANAG, and some of his colleagues. Chris Algieri is now employed as a staff member in Dr. Bill Collins' Climate Science Department in the Earth Sciences Division at LBNL working with computational models of climate change. Finally, it should be noted that the work conducted by Professor Puckett and his students Sarah Williams and Chris Algieri and described in this final report for DOE grant # DE-FC02-03ER25579 is closely related to work performed by Professor Puckett and his students under the auspices of Professor Puckett's DOE SciDAC grant DE-FC02-01ER25473 An Algorithmic and Software Framework for Applied Partial Differential Equations: A DOE SciDAC Integrated Software Infrastructure Center (ISIC). Dr. Colella was the lead PI for this SciDAC grant, which was comprised of several research groups from DOE national laboratories and five university PI's from five different universities. In theory Professor Puckett tried to use funds from the SciDAC grant to support work directly involved in implementing algorithms developed by members of his research group at UCD as software that might be of use to Puckett's SciDAC CoPIs. (For example, see the work reported in Section 2.2.2 of this final report.) However, since there is considerable lead time spent developing such algorithms before they are ready to become `software' and research plans and goals change as the research progresses, Professor Puckett supported each member of his research group partially with funds from the SciDAC APDEC ISIC DE-FC02-01ER25473 and partially with funds from this DOE MICS grant DE-FC02-03ER25579. This has necessarily resulted in a significant overlap of project areas that were funded by both grants. In particular, both Sarah Williams and Chris Algieri were supported partially with funds from grant # DE-FG02-03ER25579, for which this is the final report, and in part with funds from Professor Puckett's DOE SciDAC grant # DE-FC

L-fucose in crystal structures of IgG-Fc: Reinterpretation of experimental data

Czech Academy of Sciences Publication Activity Database

Kolenko, Petr; Skálová, Tereza; Dohnálek, Jan; Hašek, Jindřich

2008-01-01

Roč. 73, č. 5 (2008), s. 608-615 ISSN 0010-0765 R&D Projects: GA ČR GA305/07/1073 Grant - others:FP6-2005-LifeSciHealth-6(EU) LSHG-CT-2006-031220 Institutional research plan: CEZ:AV0Z40500505 Source of funding: R - rámcový projekt EK Keywords : immunoglobulin * Fc-fragment * fucose Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.784, year: 2008

SecurID

CERN Multimedia

Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.

Experimental investigation of small diameter two-phase closed thermosyphons charged with water, FC-84, FC-77 and FC-3283

International Nuclear Information System (INIS)

Jouhara, Hussam; Robinson, Anthony J.

2010-01-01

An experimental investigation of the performance of thermosyphons charged with water as well as the dielectric heat transfer liquids FC-84, FC-77 and FC-3283 has been carried out. The copper thermosyphon was 200 mm long with an inner diameter of 6 mm, which can be considered quite small compared with the vast majority of thermosyphons reported in the open literature. The evaporator length was 40 mm and the condenser length was 60 mm which corresponds with what might be expected in compact heat exchangers. With water as the working fluid two fluid loadings were investigated, that being 0.6 ml and 1.8 ml, corresponding to approximately half filled and overfilled evaporator section in order to ensure combined pool boiling and thin film evaporation/boiling and pool boiling only conditions, respectively. For the Fluorinert TM liquids, only the higher fill volume was tested as the aim was to investigate pool boiling opposed to thin film evaporation. Generally, the water-charged thermosyphon evaporator and condenser heat transfer characteristics compared well with available predictive correlations and theories. The thermal performance of the water-charged thermosyphon also outperformed the other three working fluids in both the effective thermal resistance as well as maximum heat transport capabilities. Even so, FC-84, the lowest saturation temperature fluid tested, shows marginal improvement in the heat transfer at low operating temperatures. All of the tested Fluorinert TM liquids offer the advantage of being dielectric fluids, which may be better suited for sensitive electronics cooling applications and were all found to provide adequate thermal performance up to approximately 30-50 W after which liquid entrainment compromised their performance.

The effect of FcγRIIA and FcγRIIB on coronary artery lesion formation and intravenous immunoglobulin treatment responses in children with Kawasaki disease

Science.gov (United States)

Chang, Ling-Sai; Lo, Mao-Hung; Li, Sung-Chou; Yang, Ming-Yu; Hsieh, Kai-Sheng; Kuo, Ho-Chang

2017-01-01

Previous research has found patients with the FcγRIIIB NA1 variant having increased risk of intravenous immunoglobulin (IVIG) resistance in Kawasaki disease (KD). Our previous studies revealed that elevated FcγRIIA expression correlated with the susceptibility of KD patients. We conducted this research to determine whether and how Fcγ receptors affect the susceptibility, IVIG treatment response, and coronary artery lesions (CAL) of KD patients. The activating FcγRIIA and inhibitory FcγRIIB methylation levels of seven patients with KD and four control subjects were examined using HumanMethylation27 BeadChip. We enrolled a total of 44 KD patients and 10 control subjects with fevers. We performed real-time RT-PCR to determine the FcγRIIA and FcγRIIB expression levels, as well as a luciferase assay of FcγRIIA. We found a considerable increase in methylation of both FcγRIIA and FcγRIIB in KD patients undergoing IVIG treatment. Promoter methylation of FcγRIIA inhibited reporter activity in K562 cells using luciferase assay. The FcγRIIB mRNA expression levels were not found to increase susceptibility, CAL formation, or IVIG resistance. FcγRIIA mRNA expression levels were significantly higher in IVIG-resistant patients than in those that responded to IVIG during the pre-treatment period. Furthermore, the FcγRIIA/IIB mRNA expression ratio was considerably higher in KD patients with CAL than in those without CAL. FcγRIIA and FcγRIIB both demonstrated increased methylation levels in KD patients that underwent IVIG treatment. FcγRIIA expression influenced the IVIG treatment response of KD patients. The FcγRIIA/IIB mRNA expression ratio was greater in KD patients with CAL formation. PMID:27893416

Anatomia do fígado de fetos de Guinea pig em final de gestação (Cavia porcellus [Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Mariangela Toledo Barbino

2011-08-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n3p97 Desenvolveu-se este trabalho com o objetivo de descrever a anatomia do fígado de fetos de Guinea pig (Cavia porcellus [Linnaeus, 1758] em final de gestação e obter caracterizações anatômicas que possam fundamentar e auxiliar na compreensão da fisiologia da circulação fetal. Coletou-se os fetos de 3 fêmeas em final de gestação, os quais foram dissecados e retirado o fígado. Estes foram analisados, descritos e fotodocumentados macroscopicamente, por microscopia de luz em coloração HE e por microscopia eletrônica de varredura. O fígado dos fetos apresenta coloração castanho avermelhada e sua divisão em lobos é nitidamente observada, assim como a presença da vesícula biliar.  O fígado divide-se em lobo lateral esquerdo, lobo medial esquerdo, lobo lateral direito, lobo medial direito, lobo quadrado e lobo caudado com processos papilar e caudado Através da microscopia de luz, observa-se o tecido intensamente vascularizado sendo que, a porção esquerda do fígado recebe o sangue oriundo da placenta pela veia umbilical, e a porção direita é irrigada pela veia porta. Através desses resultados pode-se concluir que os fetos de Guinea pig possuem estruturas semelhantes anatomicamente aos de outras espécies de mamíferos.

Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha

OpenAIRE

Sampaio,Regynaldo A; Ramos,Sílvio J; Guilherme,Denílson O; Costa,Cândido A da; Fernandes,Luiz Arnaldo

2008-01-01

Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC) e pó de rocha de granito (RG) como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC) e pó de rocha de granito (RG): T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% ...

Discussion on the tropospheric concentrations of FC21

Energy Technology Data Exchange (ETDEWEB)

Crescentini, G.; Mangani, F.; Mastrogiamcomo, A.R.; Cappiello, A.; Bruner, F.

1986-01-01

FC21 tropospheric mixing ratios measured in air samples collected at different locations in the world are presented. Results of a campaign carried out at two locations in the Sahara desert where FC21 and FC11 mixing ratios were simultaneously determined in 180 samples are also shown. Though scattered high values have been found, the average background concentration of FC21 ranged between 0 and 1 pptv. 9 references, 1 figure, 2 tables.

Qualidade e teores de nutrientes de palmeira-rápis em substrato com fibra de coco Quality and nutrient content of lady palm in coconut fiber substrate

Directory of Open Access Journals (Sweden)

Flávia dos S Alves

2010-03-01

Full Text Available As avaliações foram realizadas em quatro substratos compostos de mistura de fibra de coco triturada (FC e substrato comercial Plantmax HT® (SC, nas proporções de 0, 25, 50 e 75% de FC, em vasos com capacidade para 35 L, em delineamento de blocos ao acaso, com quatro repetições e três vasos por parcela, com uma planta por vaso. A adubação das plantas foi feita alternando-se, a cada três meses, 25 g de 4-14-8 com 10 g de uréia por vaso, a partir do plantio e durante os 24 meses do período experimental. O crescimento foi avaliado medindo-se a altura da haste inicial (da base do caule à inserção da última folha completamente expandida, número de folhas da haste inicial, número de perfilhos, número de folhas dos perfilhos, altura dos perfilhos e teores de nutrientes da última folha completamente expandida da haste inicial. A qualidade foi avaliada através de análise sensorial visual, baseado nos critérios "gostei"(muito ou pouco e "compraria"(sim ou não. Não houve diferença entre os tratamentos sobre as características de crescimento, exceto para o número de folhas da haste inicial. As plantas com melhor aceitação foram aquelas cultivadas na mistura com 50% FC e 50% SC. Nenhuma das plantas apresentou sintoma visual de deficiência de nutrientes, sendo os teores foliares encontrados em plantas sadias com padrão de qualidade para comercialização de: 17,80 - 18,29 g kg-1 de N; 0,66 - 0,81 g kg-1 de NO-3; 2,02 - 2,34 g kg-1 de P; 18,11 - 20,40 g kg-1 de K; 11,63 - 13,84 g kg-1 de Cl; 2,69 - 4,04 g kg-1 de Ca; 1,61 - 2,07 g kg-1 de S; 1,98 - 2,64 g kg-1 de Mg.It was evaluated the quality and nutrient content of lady palm in four substrates made up of a mixture of shredded coconut fiber (FC and commercial substrate Plantmax HT® (SC, in proportions of 0, 25, 50 and 75% of FC, in 35 liters containers, in a randomized block experiment with four replicates and three pots per plot, with one plant per pot. The plants were

Structural insights into the interaction of human IgG1 with FcγRI: no direct role of glycans in binding

Energy Technology Data Exchange (ETDEWEB)

Oganesyan, Vaheh, E-mail: oganesyanv@medimmune.com; Mazor, Yariv; Yang, Chunning; Cook, Kimberly E.; Woods, Robert M. [MedImmune LLC, 1 MedImmune Way, Gaithersburg, MD 20878 (United States); Ferguson, Andrew [AstraZeneca Pharmaceuticals, 35 Gatehouse Drive, Mailstop E3, Waltham, MA 02451 (United States); Bowen, Michael A.; Martin, Tom; Zhu, Jie; Wu, Herren; Dall’Acqua, William F., E-mail: oganesyanv@medimmune.com [MedImmune LLC, 1 MedImmune Way, Gaithersburg, MD 20878 (United States)

2015-10-31

In an effort to identify the critical structural features responsible for the high-affinity interaction of IgG1 Fc with FcγRI, the structure of the corresponding complex was solved at a resolution of 2.4 Å. The three-dimensional structure of a human IgG1 Fc fragment bound to wild-type human FcγRI is reported. The structure of the corresponding complex was solved at a resolution of 2.4 Å using molecular replacement; this is the highest resolution achieved for an unmutated FcγRI molecule. This study highlights the critical structural and functional role played by the second extracellular subdomain of FcγRI. It also explains the long-known major energetic contribution of the Fc ‘LLGG’ motif at positions 234–237, and particularly of Leu235, via a ‘lock-and-key’ mechanism. Finally, a previously held belief is corrected and a differing view is offered on the recently proposed direct role of Fc carbohydrates in the corresponding interaction. Structural evidence is provided that such glycan-related effects are strictly indirect.

Stendhal lecteur d’Helvétius et des Idéologues sur les avatars de l’amitié

OpenAIRE

Bassou, Muriel

2015-01-01

En janvier 1812, au moment de la conception du « beylisme », Henri Beyle, qui n’est pas encore Stendhal, fait le point sur le « Character of Mr Mys[elf] » en ces termes : Ses pensées sont neuves parce qu’il a refait à neuf beaucoup d’idées générales qui servent de mesure, comme : gloire, grandeur, bonheur, etc.Les autres mesurent ce qu’ils aperçoivent dans la nature avec une aune qui a quarante-deux pouces. Celle qu’il s’est faite au moyen d’Hel[vétius], de Tra[cy] et de l’expérience, est de ...

International Decommissioning Symposium 2000 (IDS 2000). Final Report

International Nuclear Information System (INIS)

Ebadian, M.A.

2001-01-01

The purpose of IDS 2000 was to deliver a world-class conference on applicable global environmental issues. The objective of this conference was to publicize environmental progress of individual countries, to provide a forum for technology developer and problem-holder interaction, to facilitate environmental and technology discussions between the commercial and financial communities, and to accommodate information and education exchange between governments, industries, universities, and scientists. The scope of this project included the planning and execution of an international conference on the decommissioning of nuclear facilities, and the providing of a business forum for vendors and participants sufficient to attract service providers, technology developers, and the business and financial communities. These groups, when working together with attendees from regulatory organizations and government decision-maker groups, provide an opportunity to more effectively and efficiently expedite the decommissioning projects

Final Report: Performance Engineering Research Institute

Energy Technology Data Exchange (ETDEWEB)

Mellor-Crummey, John [Rice Univ., Houston, TX (United States)

2014-10-27

This document is a final report about the work performed for cooperative agreement DE-FC02-06ER25764, the Rice University effort of Performance Engineering Research Institute (PERI). PERI was an Enabling Technologies Institute of the Scientific Discovery through Advanced Computing (SciDAC-2) program supported by the Department of Energy's Office of Science Advanced Scientific Computing Research (ASCR) program. The PERI effort at Rice University focused on (1) research and development of tools for measurement and analysis of application program performance, and (2) engagement with SciDAC-2 application teams.

Traces of pFc' in IVIG interact with human IgG Fc domains and counteract aggregation

NARCIS (Netherlands)

Rispens, Theo; Himly, Martin; Ooievaar-de Heer, Pleuni; den Bleker, Tamara H.; Aalberse, Rob C.

2010-01-01

To prevent multimer formation, intravenous immunoglobulin (IVIG) is often treated with traces of pepsin. So far, the mechanism behind this treatment has been unclear. Recently, we reported that human IgG4 binds other IgG molecules via Fc-Fc interactions. Here we show that IVIG treated with traces of

Nuclear Power 2010 Program Dominion Virginia Power Cooperative Project U.S. Department of Energy Cooperative Agreement DE-FC07-05ID14635 Construction and Operating License Demonstration Project Final Report

International Nuclear Information System (INIS)

Grecheck, Eugene S.; Batalo, David P.

2010-01-01

This report serves to summarize the major activities completed as part of Virginia Electric and Power Company's North Anna construction and operating license demonstration project with DOE. Project successes, lessons learned, and suggestions for improvement are discussed. Objectives of the North Anna COL project included preparation and submittal of a COLA to the USNRC incorporating ESBWR technology for a third unit a the North Anna Power Station site, support for the NRC review process and mandatory hearing, obtaining NRC approval of the COLA and issuance of a COL, and development of a business case necessary to support a decision on building a new nuclear power plant at the North Anna site.

Nuclear Power 2010 Program Dominion Virginia Power Cooperative Project U.S. Department of Energy Cooperative Agreement DE-FC07-05ID14635 Construction and Operating License Demonstration Project Final Report

Energy Technology Data Exchange (ETDEWEB)

Eugene S. Grecheck

2010-11-30

This report serves to summarize the major activities completed as part of Virginia Electric and Power Company's North Anna construction and operating license demonstration project with DOE. Project successes, lessons learned, and suggestions for improvement are discussed. Objectives of the North Anna COL project included preparation and submittal of a COLA to the USNRC incorporating ESBWR technology for a third unit a the North Anna Power Station site, support for the NRC review process and mandatory hearing, obtaining NRC approval of the COLA and issuance of a COL, and development of a business case necessary to support a decision on building a new nuclear power plant at the North Anna site.

Efecto de los parámetros de procesamiento sobre las características cristalinas de la solución sólida Y(CoxMn1-xO3, x=0.6, 0.7

Directory of Open Access Journals (Sweden)

Fernández, J. F.

2002-02-01

Full Text Available The preparation and crystalline features of perovskite solid solution Y(CoxMn1-xO3, x=0.6, 0.7, belonging to the Co-rich region of the pseudobinary system YMnO3-YCoO3 have been studied. Dilatometric essays performed under different atmospheres have been carried out for determining the best conditions to obtain single-phase samples. Influence of the thermal cycle and of the sintering density on the appearance of secondary phases has been also established. Firing under O2 atmosphere favours the formation of the pure perovskite. The cooling rate plays an important role for inhibiting the formation of secondary phases. All the crystalline parameters depend ultimately on the final density of the polycrystalline bodies.Se han estudiado la preparación y las características cristalinas de la solución sólida Y(CoxMn1-xO3, x=0.6, 0.7, con estructura de tipo perovsquita, perteneciente a la región rica en Co del sistema seudobinario YMnO3-YCoO3. Se han llevado a cabo ensayos dilatométricos bajo diferentes atmósferas para determinar las mejores condiciones para obtener cerámicas monofásicas. Se ha establecido igualmente la influencia del ciclo térmico y de la densidad de sinterizado sobre la aparición de fases secundarias. La sinterización en oxígeno favorece la formación de la perovsquita pura. La velocidad de enfriamiento juega un importante papel sobre la inhibición de la formación de fases secundarias. Todos los parámetros cristalinos dependen finalmente de la densidad final de los materiales cerámicos.

Influência do nível de performance na estratégia de ritmo de corrida em prova de 10 km de corredores recreacionais

Directory of Open Access Journals (Sweden)

Francisco de Assis MANOEL

2015-09-01

Full Text Available ResumoO objetivo do estudo foi verificar a influência do nível de performance na estratégia de ritmo de corrida de corredores recreacionais. Adicionalmente, objetivou-se descrever o comportamento da frequência cardíaca (FC obtida em prova de 10 km em pista de atletismo. Participaram 39 corredores recreacionais (31,5 ± 6,7 anos, experientes em provas de 10 km que realizaram uma performance nesta distância em pista de atletismo (400 m. A FC foi constantemente monitorada (Polar RS800 e o tempo a cada 400 m foi registrado para determinação da velocidade média (VM, posteriormente analisada a cada 2 km. Os participantes foram divididos em dois grupos de acordo com a VM alcançada nos testes: G1 = VM 10 km ≤ 11,81 (n = 20 e G2 = VM 10 km > 11,81 (n = 19. A comparação entre os valores de VM e FC obtidos nos diferentes momentos da performance para os dois grupos foi realizada pela Anova mista, adotando-se nível de significância de p < 0,05. Os valores de VM foram diferentes entre os grupos em todos os momentos analisados, com aumento significante da VM do momento 6-8 km para 8-10 km para o mesmo grupo. Os valores de FC foram diferentes apenas intra-grupos. No G1, houve aumento significante da FC a cada 2 km de prova. Para o G2, a FC aumentou do 2º ao 4º km e permaneceu estável até o 8º km, aumentando novamente nos últimos 2 km da performance. Concluímos que o nível de performance não influencia a estratégia de corrida de corredores recreacionais.

Relevancia de los diferentes momentos del juego y de las acciones a balón parado (ABP en los rendimientos del FC Barcelona y Real Madrid durante la liga nacional de fútbol profesional 2011/12

Directory of Open Access Journals (Sweden)

Xavier Planes i Fontestad

2015-08-01

Full Text Available El estudio se centra en la relevancia de las fases dinámicas y estáticas en los rendimientos del FC Barcelona y Real Madrid. Utilizamos la metodología observacional con el fin de tratar de asociar los diferentes Momentos o Fases del juego (MJ y las Acciones a Balón Parado (ABP con la obtención de cada uno de los goles. Para conseguirlo, hemos creado un instrumento de observación ad hoc (IOX y hemos utilizado dos instrumentos de registro (LINCE y MOTS. Para el análisis de los datos del registro y la obtención de resultados, hemos utilizado las técnicas de comparación de proporciones con el software Statgraphics, habiendo encontrado, inicialmente, diferencias significativas entre los dos equipos únicamente en la fase defensiva.

De uma política de idéias a uma política de presença? From a politics of ideas to a politics of presence?

Directory of Open Access Journals (Sweden)

ANNE PHILLIPS

2001-01-01

Full Text Available A crescente preocupação com o tema da exclusão política desafia o entendimento tradicional sobre os mecanismos representativos, em especial a percepção arraigada de que a chave da boa representação política está no programa e nas idéias compartilhadas entre representantes e representadas/os - sem qualquer referência à identidade das/os representantes. Contra isso, cada vez mais é afirmada a necessidade de presença física dos grupos excluídos nos locais de decisão, o que se traduz freqüentemente na adoção de cotas eleitorais. Mas não se trata de escolher uma ou outra forma de representação e sim de, compreendendo os limites de cada uma, buscar um sistema mais justo que incorpore tanto idéias quanto presença.Recent concern over the issue of political exclusion challenges traditional understanding of mechanisms of representation, specifically with regard to the conviction that the key to good political representation lies in the ideas and program shared by those who represent others and those who are represented -- with no reference as to the identity of those who represent. On the other hand, there is a growing claim for the physical presence of excluded groups in the locales where decisions are made which has frequently led to the adoption of electoral quotas. Nonetheless, more than just a matter of choosing one form of representation over another, we should understand the limitations of each, seeking a more just system that incorporates both presence and ideas.

INTENSIDAD DE LA MUSICA: EFECTO SOBRE LA FRECUENCIA CARDIACA Y EL ESFUERZO PERCIBIDO DURANTE LA ACTIVIDAD FISICA

Directory of Open Access Journals (Sweden)

Jorge Marín Hernández

2001-12-01

Full Text Available La música ha sido ampliamente utilizada en la práctica de ejercicios aeróbicos en la industria deportiva. El propósito de este estudio fue comparar el efecto de diferentes intensidades de la música sobre la frecuencia cardiaca (FC y el esfuerzo percibido (EP durante ejercicio estandarizado en un cicloergómetro. 13 hombres y 5 mujeres voluntarios, físicamente activos (edad 20.6 ± 2.2 años realizaron una prueba bajo tres condiciones en diferentes días, asignadas en un diseño contrabalanceado de medidas repetidas: no música (NM, música a 70 dB, (M70 y música a 85 dB (M85. Ellos se ejercitaron por 20 min. con una carga de trabajo constante predeterminada y equivalente al 80% de su FCMax (kp = 1.47 ± 0.4, 90 rev/min. La música utilizada fue del tipo 'Merengue House' en español con un tempo de 131 ± 4.30 bpm, las diferentes intensidades fueron calibradas con un sonómetro. La FC y el EP fueron registrados a los 10 y 20 min. con un monitor de FC Polar y la escala EP-15 de Borg. Prueba FC 10 min. FC 20 min. EP 10 min. EP 20 min. NM 164.78 ± 8.37 172.11 ± 8.54 12.06 ±1.92 13.78 ±2.58 M70 165.11 ±11.16 173.00 ±12.05 12.00 ±2.11 13.56 ±2.89 M85 163.00 ± 7.58 170.17 ± 7.87 11.50 ±1.55 12.94 ±2.07 Tanto para FC como para EP un ANOVA 3 x 2 con medidas repetidas indicó que los promedios a los 20 min. fueron significativamente mayores que a los 10 min. (p<0.05. Las diferencias en FC y EP entre las tres condiciones no fueron significativas (p >0.05. Los resultados indican que los rangos de intensidades de música estudiados M70 y M85 no produjeron un efecto sobre el EP y la FC cuando se realizó ejercicio estandarizado en un cicloergómetro comparado con una condición sin música NM.

Metabolic and process engineering for biodesulfurization in Gram-negative bacteria.

Science.gov (United States)

Martínez, I; El-Said Mohamed, M; Santos, V E; García, J L; García-Ochoa, F; Díaz, E

2017-11-20

Microbial desulfurization or biodesulfurization (BDS) is an attractive low-cost and environmentally friendly complementary technology to the hydrotreating chemical process based on the potential of certain bacteria to specifically remove sulfur from S-heterocyclic compounds of crude fuels that are recalcitrant to the chemical treatments. The 4S or Dsz sulfur specific pathway for dibenzothiophene (DBT) and alkyl-substituted DBTs, widely used as model S-heterocyclic compounds, has been extensively studied at the physiological, biochemical and genetic levels mainly in Gram-positive bacteria. Nevertheless, several Gram-negative bacteria have been also used in BDS because they are endowed with some properties, e.g., broad metabolic versatility and easy genetic and genomic manipulation, that make them suitable chassis for systems metabolic engineering strategies. A high number of recombinant bacteria, many of which are Pseudomonas strains, have been constructed to overcome the major bottlenecks of the desulfurization process, i.e., expression of the dsz operon, activity of the Dsz enzymes, retro-inhibition of the Dsz pathway, availability of reducing power, uptake-secretion of substrate and intermediates, tolerance to organic solvents and metals, and other host-specific limitations. However, to attain a BDS process with industrial applicability, it is necessary to apply all the knowledge and advances achieved at the genetic and metabolic levels to the process engineering level, i.e., kinetic modelling, scale-up of biphasic systems, enhancing mass transfer rates, biocatalyst separation, etc. The production of high-added value products derived from the organosulfur material present in oil can be regarded also as an economically viable process that has barely begun to be explored. Copyright © 2017 Elsevier B.V. All rights reserved.

Competencias en I+D del personal que labora en los Centros de Investigación adscritos a la Escuela de Educación de la Universidad del Zulia

Directory of Open Access Journals (Sweden)

Maritza Torres

2005-05-01

Full Text Available Se estudian las competencias en I+D de investigadores de los Centros de Investigación de la Escuela de Educación de l Universidad del Zulia. Es una investigación descriptiva, transversal y de campo. La muestra fue de 36 unidades muestrales, con validación de 5 expertos y confiabilidad de Kuder-Richarson. Se encontró que existe un porcentaje bajo de doctorados, hay planeación tecnológica, organización para la innovación, la gestión tecnológica está dirigida a la adquisición de conocimientos, la evaluación es ex –post y on-going. Se da más importancia a las competencias relacionadas con el desempeño docente y menos a las relacionadas con el desarrollo de la investigación, creatividad e innovación.

Vermicompostagem de lodo de esgoto urbano e bagaço de cana-de-açúcar Vermicomposting of urban sewage sludge and sugarcane bagasse

Directory of Open Access Journals (Sweden)

Carlos D. da Silva

2002-12-01

Full Text Available Com o objetivo de se avaliar alterações químicas no substrato orgânico no decorrer do processo de vermicompostagem de diferentes combinações de lodo de esgoto urbano (LEU com bagaço de cana-de-açúcar (BC, além de sua qualidade final como adubo orgânico, realizou-se um experimento em laboratório e campo. Os vermicompostos foram obtidos a partir dos tratamentos T1 = 150 kg de LEU; T2 = 121,6 kg de LEU + 97,30 kg de BC; T3 = 59 kg de LEU + 97,30 kg de BC; T4 = 35,5 kg de LEU + 97,30 kg de BC e T5 = 23,10 kg de LEU + 97,30 kg de BC. Para a realização do processo de vermicompostagem, foram utilizadas minhocas vermelhas-da-Califórnia (Eisenia fetida. As características químicas determinadas nos vermicompostos produzidos indicaram que os mesmos podem ser utilizados como adubo orgânico, principalmente no que se refere ao conteúdo de matéria orgânica, pH, relação C/N, concentração de nitrogênio e fósforo. As concentrações de metais pesados situaram-se abaixo dos limites de toxicidade, considerados pela legislação internacional. Aumento da proporção de LEU como substrato proporcionou aumento na concentração final de N, Ca e Mg, diminuídas de K.The purpose of the present study was to evaluate the chemical alterations in the substrate with time of the vermicomposting involving different combinations of urban sewage sludge (USS and sugarcane bagasse (SB, besides it's quality as organic fertilizer. The vermicomposts were obtained from the treatments T1= 150 kg of USS; T2 = 121.6 kg of USS + 97.30 kg of SB; T3 = 59 kg of USS + 97.30 kg of SB; T4 = 35.5 kg of USS + 97.30 kg of SB; T5= 23.10 kg of USS + 97.30 kg of SB. For the vermicomposting process, Red-California earthworm (Eisenia fetida was utilized. Chemical characteristics determined in the vermicomposts indicate that it can be used as organic fertilizer, mainly with regard to organic matter content, pH, C/N ratio, nitrogen and phosphorus levels. Heavy metal

A estabilização heterodoxa no brasil: idéias e redes políticas

Directory of Open Access Journals (Sweden)

Pio Carlos

2001-01-01

Full Text Available O artigo discute o papel das idéias e das "redes políticas" na explicação do conteúdo de políticas de estabilização no Brasil. As idéias heterodoxas dos economistas da Pontifícia Universidade Católica do Rio de Janeiro (PUC-RJ são apresentadas e comparadas ao conteúdo de dois programas de estabilização implementados no país: o Plano Cruzado (1986 e o Plano Real (desde 1993. Variáveis políticas são apontadas para explicar por que o segundo programa apresenta maior semelhança com as idéias originais dos economistas do que o primeiro, o que, segundo o autor, explica, em grande medida, seu maior êxito em reduzir a inflação.

Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function.

Science.gov (United States)

Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F; Mo, Xiaokui; Byrd, John C; Carson, William E; Butchar, Jonathan P; Tridandapani, Susheela

2016-02-05

The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. © 2016 by The American Society for Biochemistry

Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function*

Science.gov (United States)

Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F.; Mo, Xiaokui; Byrd, John C.; Carson, William E.; Butchar, Jonathan P.; Tridandapani, Susheela

2016-01-01

The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N′,N′-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. PMID:26627823

FINAL TECHNICAL REPORT Chagas Prevention in Central America

International Development Research Centre (IDRC) Digital Library (Canada)

Carlota Monroy

INFORME FINAL: PROYECTO ID 106531 - 001. CORRESPONDIENTE AL PERIODO DEL 1 DE MARZO 2011 AL 31 DE MARZO 2014. CONTENIDO. 1. Información general ……………………………………………………………1. 2. Resumen del proyecto ………………………………………………………….2. 3. Metas objetivos ...

Farelo de canola na alimentação de alevinos de carpa-capim (Ctenopharyngodon idella V. Use of canola meal in the diet of grasscarp fry (Ctenopharyngodon idella V.

Directory of Open Access Journals (Sweden)

Valéria Rossetto Barriviera Furuya

1998-10-01

Full Text Available Foram avaliados os efeitos da substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC, em dietas para alevinos de carpa-capim (Ctenopharyngodon idella. Foram utilizados 100 alevinos com peso vivo médio de 1,33 gramas e comprimento médio de 5,06cm, distribuídos em um delineamento inteiramente casualizado, com cinco tratamentos e quatro repetições, em 20 aquários com capacidade para 50 litros, com 5 peixes por unidade. Foram utilizados cinco níveis de substituição de proteína do FS pela do FC (0,00%; 20,00%; 40,00%; 60,00% e 80,00%, o que correspondeu a 0,00%; 8,03%; 16,10%; 24;10% e 32,15% de inclusão de FC nas dietas. As dietas, formuladas de modo a serem isoprotéicas, isocálcicas e isofosfóricas, foram fornecidas durante 28 dias; ao mesmo tempo, os parâmetros físico-químicos foram monitorados. Ao final do período experimental, foram avaliadas as características de desempenho. O ganho de peso, taxa de crescimento relativo, taxa de eficiência protéica, conversão alimentar, sobrevivência e custo de ração/peso ganho não foram afetados pelos níveis de substituição da proteína do FS pela do FC. Entretanto, foram observados efeitos quadráticos para o peso final (Y = 2,39190 + 0,01327X - 0,00019X2, r2 = 0,78, comprimento total (Y = 6,15270 + 0,01195X - 0,00016X2, r2 = 0,86 e incremento em comprimento total (Y = 1,10340 + 0,01198X - 0,00016X2, r2 = 0,86. Os parâmetros físico-químicos permaneceram dentro dos níveis adequados. O nível de substituição de 35,79% de proteína do FS pela do FC ou a inclusão de 14,40% de FC na dieta levou ao melhor desempenho em alevinos de carpa-capim.One hundred fry with 1.33 mean weight and 5.06cm mean length distributed in twenty 50-liter aquarium, with 5 fish each, were used in a completely randomized plotted experiment, with 4 replications, to evaluate the effects of soybean meal (SM protein replacement by canola meal (CM protein in diets for

Optimización del mantenimiento preventivo, utilizando las técnicas de diagnóstico integral. Resultados finales y evaluación económica; Optimization of the Preventive Maintenance Using the Techniques of Integral Diagnosis. Final Results and Economic Evalua

Directory of Open Access Journals (Sweden)

Pedro L Hernández Domínguez

2011-02-01

Full Text Available En este trabajo se obtienen los resultados finales y la evaluación económica de la aplicación de la metodologíaque aporta el diagnóstico integral (DI, presentada por los autores en los artículos anteriores, con la finalidad deintroducir el mantenimiento basado en la condición (MBC como una forma de mejoramiento o perfeccionamientodel mantenimiento preventivo planificado (MPP que se desarrolla en las centrales termoeléctricas (CCTT cubanas. In this paper, the authors obtained the final results and the economic evaluation of the application methodologythat contributes the integral diagnosis (ID, presented by they in a previous articles, with the purpose of introducingthe condition based maintenance (CBM like a form of improvement the Planned Preventive Maintenance(PPM that is developed in the cuban thermoelectric power stations.

ID card number detection algorithm based on convolutional neural network

Science.gov (United States)

Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan

2018-04-01

In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.

Immunization with avian metapneumovirus harboring chicken Fc induces higher immune responses.

Science.gov (United States)

Paudel, Sarita; Easwaran, Maheswaran; Jang, Hyun; Jung, Ho-Kyoung; Kim, Joo-Hun; Shin, Hyun-Jin

2016-07-15

In this study, we evaluated the immune responses of avian metapneumovirus harboring chicken Fc molecule. Stable Vero cells expressing chicken Fc chimera on its surface (Vero-cFc) were established, and we confirmed that aMPV grown in Vero-cFc incorporated host derived chimera Fc into the aMPV virions. Immunization of chicken with aMPV-cFc induced higher level of antibodies and inflammatory cytokines; (Interferon (IFN)-γ and Interleukin (IL)-1β) compared to those of aMPV. The increased levels of antibodies and inflammatory cytokines in chicken immunized with aMPV-cFc were statistically significantly (p<0.05) to that of aMPV and control. The aMPV-cFc group also generated the highest neutralizing antibody response. After challenges, chickens immunized with aMPV-cFc showed much less pathological signs in nasal turbinates and trachea so that we could confirm aMPV-cFc induced higher protection than that of aMPV. The greater ability of aMPV harboring chicken Fc to that of aMPV presented it as a possible vaccine candidate. Copyright © 2016 Elsevier B.V. All rights reserved.

Analytical FcRn affinity chromatography for functional characterization of monoclonal antibodies

Science.gov (United States)

Schlothauer, Tilman; Rueger, Petra; Stracke, Jan Olaf; Hertenberger, Hubert; Fingas, Felix; Kling, Lothar; Emrich, Thomas; Drabner, Georg; Seeber, Stefan; Auer, Johannes; Koch, Stefan; Papadimitriou, Apollon

2013-01-01

The neonatal Fc receptor (FcRn) is important for the metabolic fate of IgG antibodies in vivo. Analysis of the interaction between FcRn and IgG in vitro might provide insight into the structural and functional integrity of therapeutic IgG that may affect pharmacokinetics (PK) in vivo. We developed a standardized pH gradient FcRn affinity liquid chromatography method with conditions closely resembling the physiological mechanism of interaction between IgG and FcRn. This method allows the separation of molecular IgG isoforms, degradation products and engineered molecules based on their affinity to FcRn. Human FcRn was immobilized on the column and a linear pH gradient from pH 5.5 to 8.8 was applied. FcRn chromatography was used in comparison to surface plasmon resonance to characterize different monoclonal IgG preparations, e.g., oxidized or aggregated species. Wild-type and engineered IgGs were compared in vitro by FcRn chromatography and in vivo by PK studies in huFcRn transgenic mice. Analytical FcRn chromatography allows differentiation of IgG samples and variants by peak pattern and retention time profile. The method can distinguish: 1) IgGs with different Fabs, 2) oxidized from native IgG, 3) aggregates from monomer and 4) antibodies with mutations in the Fc part from wild-type IgGs. Changes in the FcRn chromatographic behavior of mutant IgGs relative to the wild-type IgG correlate to changes in the PK profile in the FcRn transgenic mice. These results demonstrate that FcRn affinity chromatography is a useful new method for the assessment of IgG integrity. PMID:23765230

Farelo de canola na alimentação do piavuçu, Leporinus macrocephalus (Garavello & Britski, na fase inicial Canola bran in piavuçu Leporinus macrocephalus (Garavello & Britski feeding, during initial phase

Directory of Open Access Journals (Sweden)

Valéria Rossetto Barriviera Furuya

2002-04-01

Full Text Available O presente estudo teve por objetivo determinar os efeitos da inclusão de farelo de canola (FC em substituição à proteína do farelo de soja (FS na alimentação do piavuçú, Leporinus macrocephalus (Garavello & Britski (Characiformes, Anastomidae, na fase inicial. Foram utilizados 100 alevinos (8,51 ± 0,07g, distribuídos em blocos casualizados com quatro tratamentos, cinco repetições, sendo que cada unidade experimental era constituída por cinco peixes. Foram elaboradas quatro rações isocalóricas (3.000kcal ED/kg e isoprotéicas (30% de PB com base em milho, farelo de soja e farinha de peixe, contendo 0%, 19%,12%; 38%,24% e 57,36% de FC. A análise de variância não apresentou efeitos dos níveis de inclusão de FC sobre as variáveis de consumo, sobrevivência, rendimento e composição química da carcaça, gordura visceral e índice hepatossomático. Foi observado efeito quadrático dos níveis de inclusão sobre a porcentagem de ganho de peso, ocorrendo o ponto máximo no nível de 19,11% de inclusão de FC. Com o aumento nos níveis de FC, foi observado piora linear sobre a conversão alimentar e taxa de eficiência protéica. A inclusão de 11,19% de FC resultou em melhor desempenho e rendimento de carcaça.This research aimed to investigate the effects of canola bran (CB inclusion, replacing the soybean bran crude protein in piavuçu diet, Leporinus macrocephalus (Garavello & Britski (Characiformes, Anastomidae, in initial phase. One hundred fingerlings (8.51 ± 0.07g were assigned to a completely randomized block design with five replications, totalizing 25 fishes per treatment. Four isocaloric (3,000kcal ED/kg and isoproteic (30% CP diets were formulated, based on corn, soybean bran and fish flour, containing 0%; 19.12%; 38.24% and 57.36% CB. Variance analysis showed no effect of CB inclusion on feed intake survival, carcass yield and composition, visceral fat and hepato somatic index. Quadratic effect of CM inclusion was

30 CFR 18.97 - Inspection of machines; minimum requirements.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Inspection of machines; minimum requirements... TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC MOTOR-DRIVEN MINE EQUIPMENT AND ACCESSORIES Field Approval of Electrically Operated Mining Equipment § 18.97 Inspection of machines; minimum...

Desempenho produtivo de Pseudoplatystoma corruscans estocados em sistemas de criação: semi-intensivo (viveiro escavado e intensivo (tanque-rede Growth performance of Pseudoplatystoma corruscans stocked in rearing systems: semi-intensive (ponds and intensive (cages

Directory of Open Access Journals (Sweden)

Andressa Daniela de Sousa Liranço

2011-03-01

were: temperature = 24.08°C; pH=6.89; dissolved oxygen = 7.57mg L-1. The values of mean final length (P=74.07±4.34cm; C=70.33±5.02cm and final weight (P=3.41±0.52kg; C=2.94±0.60kg they showed similar development in both systems. Means of factor condition - K - (0.009-0.036; daily weight gain - DWG - (9.29g day-1-8.95g day-1; feed conversion- FC - (3.09-4.15; Total ration consume - TRC - (29.6g day-1-74.16 g day-1; growing index - IC - (0.219-0.215; survival - S - (97.33-90.67% for P e C, respectively. Through the variance of analysis can be verified that there are significative interactions of the parameters between the culture systems and months (P<0.05. The produced weight of fish was R$ 8.76 (US$ 2.85 and R$ 8.73 (US$ 2.33 for P and C. Although P showed best performance during the period and economic vantage, the growing index demonstrated that both systems had similar development.

Ocular findings in Brazilian identical twins with Cohen syndrome: case report Achados oftalmológicos em gêmeos idênticos brasileiros com síndrome de Cohen: relato de caso

Directory of Open Access Journals (Sweden)

Priscila Hae Hyun Rim

2009-12-01

Full Text Available A case of identical male twins with Cohen syndrome who present multiple ophthalmic findings is reported. The patients were identical 16 year-old twin boys who showed down slanting eyelids, mild ptosis, high-grade myopia, small cortical lens opacities, posterior subcapsular cataracts, myotic and corectopic pupils with poor dilation due to focal iris atrophy and retinochoroidal dystrophy. Ophthalmologists must be aware of the ocular and systemic findings of Cohen syndrome in the evaluation of young patients with mental retardation and visual impairment.Relata-se caso de gêmeos idênticos com síndrome de Cohen que apresentam múltiplos achados oftalmológicos. Os pacientes eram gêmeos idênticos, do sexo masculino, que apresentavam pálpebras em forma de onda, ptose moderada, alta miopia, opacidades cristalinianas corticais discretas, catarata subcapsular posterior, pupilas mióticas e corectópicas com pobre dilatação devido à atrofia focal de íris, além de distrofia retinocoroidiana. Os oftalmologistas devem estar atentos quanto aos achados oftalmológicos e sistêmicos da síndrome de Cohen na avaliação de pacientes jovens com retardo mental e baixa visão.

Alimentação de juvenis de carpa capim com dietas à base de farelos vegetais e forragem = Feeding grass carp juveniles with plant-protein diets and forage

Directory of Open Access Journals (Sweden)

Cátia Aline Veiverberg

2010-07-01

Full Text Available Para avaliar o potencial dos ingredientes de origem vegetal como substitutos da farinha de carne suína em dietas para Ctenopharyngodon idella Valenciennes, (1844 (carpa capim, 180 juvenis (15 por tanque foram criados durante 60 dias em sistema de recirculação de água. Foi avaliada a substituição da farinha de carne suína (FCS por farelo de canola (FC, farelo de girassol (FG e a mistura dos farelos de canola e girassol (FCG. As dietas também continham farelo de soja como fonte proteica. O consumo diário de forragem (1,24 a 2,11% do peso vivo não diferiu entre os tratamentos. Peso final, ganho em peso, taxa de crescimento específico e conversão alimentar aparente não diferiram estatisticamente entre as dietas. O rendimento de filé foi maior nos tratamentos FC e FCG, enquanto o índice digestivossomático foi maior nos tratamentos FG e FCG. Maior teor degordura e menores teores de proteína no peixe inteiro e de cinzas no filé foram obtidos no tratamento FCG. Os filés dos tratamentos FCS e FCG apresentaram maior valor de luminosidade. Os peixes da dieta FCS apresentaram maiores valores de proteínas, triglicerídeos e colesterol total no soro. Conclui-se que os farelos de canola e girassol podem ser utilizados em dietas para recria da carpa capim.To evaluate the potential of plant-protein sources to replace porcine meat meal in diets for grass carp juveniles, 180 fish (15 per tank were reared for 60 days in a re-use water system. We evaluated the replacement of porcine meat meal (FCS for canola meal (FC, sunflowermeal (FG or a mixture of canola and sunflower meal (FCG. The diets were also composed of soybean meal as a protein source. Daily forage intake ranged from 1.24 to 2.11% body weight and did not differ among treatments. Final weight, weight gain, specific growth rate and feed conversion rate did not differ statistically among diets. The fillet yield was higher in FC and FCG diets, while the digestive-somatic index was higher

Cholecystokinin (CCK) functional cholescintigraphy (FC) in patients suspected of acalculous biliary disease (ABD)

International Nuclear Information System (INIS)

Fink-Bennett, D.; De Ridder, P.; Kolozsi, W.; Gordon, R.; Rapp, J.

1984-01-01

To determine if CCK FC can aid in the diagnosis (Dx.) of ABD, the authors retrospectively analyzed the max. gallbladder (GB) ejection fraction response (EFR) to CCK in 240 patients (pts.) with persistent symptoms of biliary colic, a normal GB Ultrasound exam and/or OCG. Each pt. (NPO after 12 A.M.) received 5 mCi of technetium (Tc)-99 Hepatolite. After max GB filling, .02 μg/kg CCK was administered (1-3 minutes) I.V. Background corrected GB EFs were determined q.5 min x4 by ratioing the pre-CCK GB cts. minus post-CCK GB cts. to pre-CCK GB cts. In 131/240 pts. the max. GBEFR was 35%. Eleven underwent surgery, 98 medical Rx. 4/11 Cx. apts had CAC, 7 were normal. Of the 98 medical Rx. pts. 21 lack followup, 71 are clinically felt not to have ABD; 6 are felt to have ABD. CCK FC appears to be a useful test for the detection of ABD. Its predictive value (GBEF <35%) in Cx. pts. is 97%; in all pts. (assuming medical Rx. correct), 94% (sensitivity - 91%, specificity - 93%)

The Fc-receptor III of cultured human monocytes. Structural similarity with FcRIII of natural killer cells and role in the extracellular lysis of sensitized erythrocytes

NARCIS (Netherlands)

Klaassen, R. J.; Ouwehand, W. H.; Huizinga, T. W.; Engelfriet, C. P.; von dem Borne, A. E.

1990-01-01

FcRIII is not present on peripheral blood monocytes, but becomes expressed upon culturing and can be demonstrated on tissue macrophages. We studied the expression of FcRIII of cultured monocytes in detail and compared its structure with FcRIII of neutrophils and NK cells. The cell density of FcRIII

32 CFR 842.97 - Referring a claim to the US Attorney or the Department of Justice.

Science.gov (United States)

2010-07-01

... 32 National Defense 6 2010-07-01 2010-07-01 false Referring a claim to the US Attorney or the Department of Justice. 842.97 Section 842.97 National Defense Department of Defense (Continued) DEPARTMENT OF... United States (31 U.S.C. 3701, 3711-3719) § 842.97 Referring a claim to the US Attorney or the Department...

Um barão brasileiro no congresso internacional de Buenos Aires: as idéias pedagógicas de Abílio César Borges, barão de Macahubas

Directory of Open Access Journals (Sweden)

Dermeval Saviani

2012-06-01

Full Text Available Partindo da intervenção do Barão de Macahubas em 2 de maio de 1882 na 9° seção do Congresso Pedagógico Internacional de Buenos Aires, este trabalho situa a vida e a obra de Abílio César Borges no contexto do Império do Brasil explicitando suas idéias pedagógicas com destaque para os seguintes temas: a concepção de homem e de infância e aprendizagem; b o papel da escola e sua organização; c os conteúdos do ensino; d os métodos de ensino; e a proeminência da educação moral. À guisa de conclusão busca-se esclarecer o significado dessas idéias pedagógicas explicitando as controvérsias que elas suscitaram, o caráter moderno da pedagogia preconizada a serviço, porém, de uma educação tradicional e, finalmente, o lugar de Abílio César Borges, o Barão de Macahubas, na história e na historiografia da educação brasileira. Pedagogo autodidata, Abílio César Borges era médico de formação, tendo desenvolvido suas idéias educacionais praticando-as nos colégios que fundou e se servindo das experiências de outros países, do que dão testemunho as três viagens que fez à Europa para observar o funcionamento das escolas, adquirir materiais didáticos e contratar professores. Palavras-chave: história da educação, barão de Macahubas, congresso pedagógico.   Abstract Grounded on Baron of Macahubas intervention in the 9th section of International Pedagogic Congress of Buenos Aires, on May 2, 1882, this paper places the life and works of Abílio César Borges in the context of Brazil' s Empire. It describes his pedagogic ideas, wilh emphasis to the following issues: a conception of man and of childhood and learning; b school role and its organization; c teaching contents; d teaching methods; e the prominence of moral education. What is pursued as conclusion is to enlighten the meaning of these pedagogic ideas, bringing to Iight: i the controversies they raised; li the modern character of his pedagogy, although it was

Single chain Fc-dimer-human growth hormone fusion protein for improved drug delivery.

Science.gov (United States)

Zhou, Li; Wang, Hsuan-Yao; Tong, Shanshan; Okamoto, Curtis T; Shen, Wei-Chiang; Zaro, Jennica L

2017-02-01

Fc fusion protein technology has been successfully used to generate long-acting forms of several protein therapeutics. In this study, a novel Fc-based drug carrier, single chain Fc-dimer (sc(Fc) 2 ), was designed to contain two Fc domains recombinantly linked via a flexible linker. Since the Fc dimeric structure is maintained through the flexible linker, the hinge region was omitted to further stabilize it against proteolysis and reduce FcγR-related effector functions. The resultant sc(Fc) 2 candidate preserved the neonatal Fc receptor (FcRn) binding. sc(Fc) 2 -mediated delivery was then evaluated using a therapeutic protein with a short plasma half-life, human growth hormone (hGH), as the protein drug cargo. This novel carrier protein showed a prolonged in vivo half-life and increased hGH-mediated bioactivity compared to the traditional Fc-based drug carrier. sc(Fc) 2 technology has the potential to greatly advance and expand the use of Fc-technology for improving the pharmacokinetics and bioactivity of protein therapeutics. Copyright © 2016 Elsevier Ltd. All rights reserved.

Desempenho vegetativo e produtivo de cultivares e linhagens de soja de ciclo precoce no município de Piracicaba-SP

Directory of Open Access Journals (Sweden)

CÂMARA G.M.S.

1998-01-01

Full Text Available Como parte da rede oficial do Estado de São Paulo relativa à competição de linhagens de soja, desenvolveu-se no município de Piracicaba-SP, durante o ano agrícola 1996/97, experimento de campo visando avaliar o desempenho vegetativo e produtivo de linhagens e cultivares de soja (Glycine max L. Merrill pertencentes ao ciclo de maturação precoce. Delineado em blocos ao acaso com 20 tratamentos (linhagens e cultivares e 4 repetições, o experimento foi instalado em Terra Roxa Estruturada eutrófica. As parcelas foram constituídas por 4 linhas espaçadas entre si de 0,50 m com 5,0 m de comprimento. Como padrões de comparação das novas linhagens, foram utilizados os cultivares IAS-5 (atualmente o mais cultivado no Estado de São Paulo e IAC-17 (com elevada produtividade nos últimos ensaios no Estado de São Paulo. Foram avaliadas as seguintes características: estande inicial; época de florescimento; época de maturação; altura de planta no florescimento e na maturação; altura de inserção da primeira vagem; grau de acamamento e rendimento em grãos. Concluiu-se que: a baixo estande de plantas promoveu menor altura final, menor altura de inserção de vagem e menor rendimento em grãos; b as linhagens BR 92-4428, BR 92-6528, IAC 93-680, IAC 90-938, IDS 413-F4, IAC 93-598 e IAC 90-1000, foram as mais produtivas, superando ambos os padrões; c as linhagens FT 90-2687 e BR 92-5261, apresentaram os piores rendimentos.

Recovery. Oxygen Transport Membrane-Based OxyCombustion for CO₂ Capture from Power Plants

Energy Technology Data Exchange (ETDEWEB)

Kelly, Sean [Praxair Inc, Tonawanda, NY (United States); Geary, Joan [Praxair Inc, Tonawanda, NY (United States); Chakravrti, Shrikar [Praxair Inc, Tonawanda, NY (United States); Wilson, Jamie [Praxair Inc, Tonawanda, NY (United States); Christie, Max [Praxair Inc, Tonawanda, NY (United States); Peck, John [Praxair Inc, Tonawanda, NY (United States); Li, Juan [Praxair Inc, Tonawanda, NY (United States); Lane, Jonathan [Praxair Inc, Tonawanda, NY (United States); Gonzalez, Javier [Praxair Inc, Tonawanda, NY (United States); Lu, Yunxiang [Praxair Inc, Tonawanda, NY (United States); Biradar, Mahesh [Praxair Inc, Tonawanda, NY (United States); Robinson, Chuck [Praxair Inc, Tonawanda, NY (United States); Lin, Jiefeng [Praxair Inc, Tonawanda, NY (United States); Plonczak, Pawel [Praxair Inc, Tonawanda, NY (United States); Lu, Zigui [Praxair Inc, Tonawanda, NY (United States); Swami, Sadashiv [Praxair Inc, Tonawanda, NY (United States); Stuckert, Ines [Praxair Inc, Tonawanda, NY (United States)

2015-12-22

This Final report documents and summarizes all of the work performed for the DOE award DE-FC26-07NT43088 during the period from April 2007 - June 2012. This report outlines accomplishments for the following tasks: Task 1 – Process and Systems Engineering, Task 2 – OTM Performance Improvement, Task 3 – OTM Manufacturing Development, Task 4 - Laboratory Scale Testing and Task 5 – Project Management.

L’idéologie du mouvement Oustachi de 1930 à 1941 The Oustachi movement ideology from 1930 to 1941

Directory of Open Access Journals (Sweden)

Stefan Sipic

2012-02-01

Full Text Available Quelles sont les racines idéologiques du mouvement oustachi d’Ante Pavelić, dans quelle mesure et depuis quelle date est-il purement fasciste ? Si le fascisme italien semble être un modèle pour Pavelić, peut-on pour autant considérer le mouvement oustachi comme fasciste ? Quelles sont ses racines idéologiques ? La politique qui engendra les massacres de 1941 était-elle inhérente à l’idéologie du mouvement dès les années 1930 ? Telles sont les questions auxquelles cette communication veut répondre. On peut dater la naissance de l’organisation oustachie au printemps 1930 sous l’appellation UHRO. Même s’il est soumis à l’influence très forte de l’Italie mussolinienne, le mouvement oustachi ne peut être considéré comme un mouvement purement fasciste avant 1941, pour Ante Pavelić, son but se résume à la création d’un État croate indépendant dont lui-même sera le chef absolu. La « question serbe » n’est pas directement abordée dans ces années-là, mais il est clair que le discours change vers la fin des années 30 et qu’à partir de 1941, dans des conditions exceptionnelles, l’idéologie oustachie s’inspirera directement du fascisme et du national-socialisme.If Italian fascism was a model for Pavelić, could the Oustachi movement be considered fascist? What were its ideological roots? Had the policies that led to the 1941 massacres been inherent to the ideology of the movement ever since the 1930s? These are the questions that this communication addresses. The birth of the Oustachi organisation, called UHRO, can be traced to the spring of 1930. Even if it succumbed to the powerful influence of Mussolini’s Italy, the Oustachi revolutionary movement cannot be considered purely fascist. Before 1941, for Ante Pavelić the goal of the movement boiled down to the creation of an independent Croatian state of which he himself would control absolutely. The 'Serb question' was not explicitly raised

Thermal decomposition of FC(O)OCH3 and FC(O)OCH2CH3.

Science.gov (United States)

Berasategui, M; Argüello, G A; Burgos Paci, M A

2018-05-09

The thermal decomposition of methyl and ethyl formates has been extensively studied due to their importance in the oxidation of several fuels, pesticidal properties and their presence in interstellar space. We hitherto present the study of the thermal decomposition of methyl and ethyl fluoroformates, which could help in the elucidation of the reaction mechanisms. The reaction mechanisms were studied using FTIR spectroscopy in the temperature range of 453-733 K in the presence of different pressures of N2 as bath gas. For FC(O)OCH3 two different channels were observed; the unimolecular decomposition which is favored at higher temperatures and has a rate constant kFC(O)OCH3 = (5.3 ± 0.5) × 1015 exp[-(246 ± 10 kJ mol-1/RT)] (in units of s-1) and a bimolecular channel with a rate constant kFC(O)OCH3 = (1.6 ± 0.5) × 1011 exp[-(148 ± 10 kJ mol-1/RT)] (in units of s-1 (mol L)-1). However for ethyl formate, only direct elimination of CO2, HF and ethylene operates. The rate constants of the homogeneous first-order process fit the Arrhenius equation kFC(O)OCH2CH3 = (2.06 ± 0.09) × 1013 exp[-(169 ± 6 kJ mol-1/RT)] (in units of s-1). The difference between the mechanisms of the two fluoroformates relies on the stabilization of a six-centered transition state that only exists for ethyl formate. First principles calculations for the different channels were carried out to understand the dynamics of the decomposition.

Fc-receptors and surface immunoglobulins in cells of the hairy cell leukemia

International Nuclear Information System (INIS)

Rieber, E.P.; Linke, R.P.; Riethmueller, G.; Heyden, H.W. von; Waller, H.D.

1976-01-01

Using 125 I-labelled aggregated IgG in a quantitative assay a strong expression of Fc-receptors was found on the leukemic cells of a patient with hairy cell leukemia. The Fc-receptor activity on these cells was much higher than that on monocytes and B-lymphocytes from normal blood. Surface immunoglobulins were detected by radioautography using radioactively labelled (Fab') 2 -fragments of monospecific antibodies directed against immunoglobulin heavy chains. Prior to radioautography the cells were stained for the tartrate resistant acid phosphatase. It is found that all cells containing this enzyme bore delta-chains on their surface. On more than 90% of these cells a simultaneous expression of μ-chains was detected. γ-chains could only be demonstrated on cells which were negative for the tartrate resistant acid phosphatase; part of these cells, however, were hairy cells by morphological criteria. (orig.) [de

Multiple Plasmodium falciparum erythrocyte membrane protein 1 variants per genome can bind IgM via its Fc fragment Fcμ

DEFF Research Database (Denmark)

Jeppesen, Anine; Ditlev, Sisse Bolm; Soroka, Vladyslav

2015-01-01

with severe clinical manifestations, such as cerebral malaria in children and placental malaria in pregnant women. PfEMP1 that can bind the Fc part of IgM (Fcμ) characterizes one such type, although the functional significance of this IgM binding to PfEMP1 remains unclear. In this study, we report...... resemble the rosette-mediating and IgM-binding PfEMP1 HB3VAR06, but none of them mediated formation of rosettes. We could map the capacity for Fc-specific IgM binding to DBLε domains near the C terminus for three of the four PfEMP1 proteins tested. Our study provides new evidence regarding Fc...

Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)

OpenAIRE

Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya

2013-01-01

1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...

Cyclin D1, Id1 and EMT in breast cancer

International Nuclear Information System (INIS)

Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran

2011-01-01

Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id

Autoestima y motivación laboral en el desempeño de los docentes de las instituciones educativas de la RED 07 – UGEL 04 - Lima – 2015

OpenAIRE

Bermudez Ramirez, María Lucy

2016-01-01

La investigación titulada Autoestima y motivación laboral en el desempeño de los docentes de las instituciones educativas de la RED 07 – UGEL 04 - Lima – 2015 se desarrolló a fin de alcanzar el objetivo de determinar cómo influye la Autoestima y motivación laboral en el desempeño de los docentes de las instituciones educativas de la RED 07 – UGEL 04 - Lima – 2015. Es un estudio de enfoque cuantitativo, explicativo causal, se trabajó con una muestra censal correspondiente a 1...

Fc-mediated immune precipitation. III. Visualization by electron microscopy

DEFF Research Database (Denmark)

Møller, NPH; Christiansen, Gunna

1983-01-01

with either rabbit anti-KLH IgG or anti-KLH F(ab')2 fragments. The Fc-Fc interactions were investigated by reacting these surface-adsorbed antibody-rich KLH immune complexes with soluble, antigen-rich ferritin-anti-ferritin complexes using either rabbit anti-ferritin IgG or the corresponding isomolar F(ab')2...... fragments as antibody. Fc-Fc interactions were indicated by the formation of clusters or ring structures of ferritin molecules, which were only seen when using KLH anti-KLH IgG and ferritin-anti-ferritin IgG complexes. When F(ab')2 fragments were used as antibody, no reaction between KLH anti-KLH complexes...

Estudo do crescimento inicial de plântulas de Cereus jamacaru DC em diferentes substratos

Directory of Open Access Journals (Sweden)

Wanderlucia Silva Rodrigues

2014-12-01

Full Text Available O presente trabalho objetivou avaliar o desenvolvimento de mudas de Cereus jamacaru DC, em substratos a base de fibra de coco e casca de arroz carbonizada. Os tratamentos utilizados foram dispostos em um delineamento inteiramente casualizado constituídos por cinco substratos a base de fibra de coco (FC e casca de arroz carbonizado (CAC, misturados com diferentes proporções volumétricas. Os tratamentos constituíram-se dos substratos 100% FC (T1, 100% CAC (T2, 75%FC+25%CAC (T3, 50%FC+50%CAC (T4, e 25%FC+75%CAC (T5. Cada tratamento foi composto por 14 repetições com 2 plantas por tratamento. Caixas de plástico transparente foram utilizados como recipientes. Aos 125 dias após o transplantio, foram avaliadas as seguintes variáveis das plântulas: comprimento, número, massa fresco e massa seco de raiz; massa fresco e massa seco da parte aérea; comprimento da parte aérea. Nas condições do experimento, conclui-se que o substrato composto somente por fibra de coco apresentou melhores resultados em todas as variáveis analisadas.

El uso de las redes sociales y el engagement de los clubes de la Liga Endesa ACB

OpenAIRE

Herrera-Torres, L.; Pérez-Tur, F.; García-Fernández, J.; Fernández-Gavira, J.

2017-01-01

Las redes sociales se han convertido en una plataforma idónea para dar a conocer y aumentar la visibilidad de una marca o empresa y también, para interactuar y analizar las acciones de los fans y seguidores de estas. Debido a ello, el presente estudio pretende averiguar las diferentes redes sociales que emplean los clubes de baloncesto de la Liga Endesa ACB, examinar el Engagement de Facebook y Twitter y, analizar si existe una correlación entre la posición en el ranking al final de la liga, ...

The Biocatalytic Desulfurization Project

Energy Technology Data Exchange (ETDEWEB)

David Nunn; James Boltz; Philip M. DiGrazia; Larry Nace

2006-03-03

The material in this report summarizes the Diversa technical effort in development of a biocatalyst for the biodesulfurization of Petro Star diesel as well as an economic report of standalone and combined desulfurization options, prepared by Pelorus and Anvil, to support and inform the development of a commercially viable process. We will discuss goals of the projected as originally stated and their modification as guided by parallel efforts to evaluate commercialization economics and process parameters. We describe efforts to identify novel genes and hosts for the generation of an optimal biocatalyst, analysis of diesel fuels (untreated, chemically oxidized and hydrotreated) for organosulfur compound composition and directed evolution of enzymes central to the biodesulfurization pathway to optimize properties important for their use in a biocatalyst. Finally we will summarize the challenges and issues that are central to successful development of a viable biodesulfurization process.

Efeitos de um programa de hidroterapia na pressão arterial e freqüência cardíaca de mulheres idosas sedentárias Effects of a hidrotherapy program on blood pressure and heart rate in elderly, sedentary women

Directory of Open Access Journals (Sweden)

Juliana Monteiro Candeloro

2008-01-01

Full Text Available Este estudo visou analisar as conseqüências cardiocirculatórias (na pressão arterial, PA, e freqüência cardíaca, FC de um programa de hidroterapia cujo objetivo clínico era ganho de força muscular e flexibilidade para mulheres idosas saudáveis e sedentárias. Participaram 16 idosas, de 65 a 70 anos. O programa constou de 32 sessões, com uma hora de duração cada, de exercícios em imersão para ganho de força muscular e flexibilidade, com grau de dificuldade crescente, em sete fases. As quatro primeiras sessões foram usadas para adaptação ao meio aquático e desconsideradas para coleta de dados. As medidas de PA e FC foram coletadas ao final de cada fase, em quatro momentos: repouso fora da água, em repouso 3 minutos após imersão, em imersão ao final dos exercícios, e três minutos após a saída da piscina. Os dados foram analisados estatisticamente com nível de significância a pThis study aimed at analysing cardiocirculatory effects (on blood pressure, BP, and heart rate, HR of a hydrotherapy program of which the purpose was to increase muscle force and flexibility of 16 sedentary, healthy, 65-to-70 year-old women. The program consisted of 32 1-hour sessions of strength and flexibility training exercises, with increasing degree of difficulty in seven phases. The first four sessions were used for adaptation to the aquatic environment and the respective data were not considered. BP and HR were monitored at the end of each phase in four different moments: at rest before diving, at rest 3 minutes after immersion, still immerged at the end of exercises, and at rest, 3 minutes after exiting the pool. Collected measures were statistically analysed, and significance level set at p<0.05. Results show significant mean at-rest systolic BP decrease of 5.6 mmHg, and mean at-rest diastolic BP decrease of 9.7 mmHg, from the 5th (base session to the 32nd (last session; participants' BP classification turned from threshold-normal to

Id-1 and Id-2 genes and products as markers of epithelial cancer

Science.gov (United States)

Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA

2008-09-30

A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.

Inhibición dual de la neprilisina y del receptor de la angiotensina (ARNI: una alternativa en los pacientes con falla cardiaca

Directory of Open Access Journals (Sweden)

Beatriz Wills

2016-03-01

Full Text Available La falla cardiaca (FC es la causa más común de admisión hospitalaria en adultos en el mundo. Además, de su importante prevalencia la FC tiene un alta tasa de mortalidad, se estima que aproximadamente el 50% de los pacientes con FC mueren a los 5 años posterior al egreso hospitalario. Esto ha motivado el desarrollo de nuevas terapias seguras y efectivas para el manejo de esta entidad. El LCZ696 es un inhibidor dual de la neprilisina y del receptor de angiotensina II que demostró en estudios de fase III disminuir el desenlace primario de muerte cardiovascular y hospitalización por empeoramiento de la FC y muerte global. Probablemente el LCZ696 se convertirá en la piedra angular del manejo en pacientes con FC con fracción de eyección deprimida.

Comportamento de variáveis fisiológicas em atletas de nado sincronizado durante uma sessão de treinamento na fase de preparação para as Olimpíadas de Atenas 2004 Comportamiento de variábles fisiológicas en atletas de nado sincronizado durante una sesion de entrenamiento en la fase de preparación para las Olimpíadas de Atenas 2004 Behavior of physiological variables in synchronized swimming athletes during a training session preparing for the Athens 2004 Olympic Games

Directory of Open Access Journals (Sweden)

Marina Guimarães Antunes Pazikas

2005-12-01

Full Text Available O objetivo do presente estudo foi avaliar o comportamento de variáveis fisiológicas durante uma sessão de treino de nado sincronizado realizada na fase de preparação para as Olimpíadas de Atenas 2004. MATERIAIS E MÉTODOS: A amostra utilizada foi constituída pelo dueto (24 ± 0 anos representante do Brasil em Atenas 2004. A coleta de dados foi realizada durante uma sessão de treinamento com duração de 198 minutos. O treino se iniciou com a parte física, seguida da parte técnica. Para a determinação da glicemia e da concentração de beta-hidroxibutirato foi utilizado o monitor Optium® com suas respectivas tiras. As concentrações de cortisol e das enzimas lactato desidrogenase (LDH e creatina quinase (CK foram determinadas por radioimunoensaio (DPC© e kits comerciais (CELM®, respectivamente. O acompanhamento da freqüência cardíaca (FC foi realizado com o freqüêncimetro Advantage Polar®. RESULTADOS: Foi observada redução (~2% do peso corporal. A glicemia também apresentou queda (~30% em comparação ao valor obtido no início do treino. Em contrapartida, foi observada elevação na concentração de cortisol (salivar 22% e plasmática 29% e de beta-hidroxibutirato (~340%. Não foi observada alteração significativa na concentração plasmática de CK e de LDH. O acompanhamento da FC demonstrou que dos 198 minutos que constituíram a sessão de treino, 36,5 ± 0,7 minutos foram realizados em intensidade leve; 103,5 ± 0,7 minutos em intensidade moderada, 54,0 ± 2,1 minutos em intensidade alta e 4,0 ± 0,0 minutos em intensidade muito alta. CONCLUSÕES: A perda de peso indica que a reposição hídrica não foi adequada. A redução na glicemia e o aumento na concentração de corpos cetônicos e de cortisol reforçam a importância da suplementação de carboidrato durante o treino de longa duração. O comportamento da FC demonstra que a sessão de treinamento foi realizada em uma intensidade moderada, porém com

Human IgG4 binds to IgG4 and conformationally altered IgG1 via Fc-Fc interactions

NARCIS (Netherlands)

Rispens, Theo; Ooievaar-de Heer, Pleuni; Vermeulen, Ellen; Schuurman, Janine; van der Neut Kolfschoten, Marijn; Aalberse, Rob C.

2009-01-01

The Fc fragment of IgG4 can interact with the Fc fragment of another IgG molecule. This interaction is a confounding factor when measuring IgG4 rheumatoid factor levels. Recently, we demonstrated that half-molecules of IgG4 can exchange to form a bispecific Ab. We expected these two phenomena to be

Modulating Cytotoxic Effector Functions by Fc Engineering to Improve Cancer Therapy.

Science.gov (United States)

Kellner, Christian; Otte, Anna; Cappuzzello, Elisa; Klausz, Katja; Peipp, Matthias

2017-09-01

In the last two decades, monoclonal antibodies have revolutionized the therapy of cancer patients. Although antibody therapy has continuously been improved, still a significant number of patients do not benefit from antibody therapy. Therefore, rational optimization of the antibody molecule by Fc engineering represents a major area of translational research to further improve this potent therapeutic option. Monoclonal antibodies are able to trigger a variety of effector mechanisms. Especially Fc-mediated effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement- dependent cytotoxicity (CDC) are considered important in antibody therapy of cancer. Novel mechanistic insights into the action of monoclonal antibodies allowed the development of various Fc engineering approaches to modulate antibodies' effector functions. Strategies in modifying the Fc glycosylation profile (Fc glyco-engineering) or approaches in engineering the protein backbone (Fc protein engineering) have been intensively evaluated. In the current review, Fc engineering strategies resulting in improved ADCC, ADCP and CDC activity are summarized and discussed.

Le manga et son histoire vus de France : entre idées reçues et approximations

Directory of Open Access Journals (Sweden)

Xavier Guilbert

2012-02-01

Full Text Available Le succès du manga en France au cours de la décennie passée a été accompagné d'un développement du discours tant critique qu'historique s'y rattachant. Cet article se propose d'examiner le traitement accordé à l'histoire de la bande dessinée japonaise dans les ouvrages de référence disponibles en français, ainsi que les idées reçues qui l'entourent. On s'y intéressera en particulier à la question de l'origine et du traitement de la figure centrale de Tezuka Osamu. On évoquera ensuite les déformations liées au prisme de l'accessibilité des œuvres à un lectorat francophone, qu'il s'agisse de l'importance accordée à un auteur comme Taniguchi Jirô, ou à la faible attention accordée à une production alternative encore peu traduite. On examinera également la vision de l'industrie du manga au Japon, et comment celle-ci s'établit principalement autour du cas emblématique de la revue Shônen Jump. Enfin, on observera la manière dont les éditeurs français retranscrivent cette vision dans leur approche et la constitution de leurs collections.The success of manga in France during the past decade has also seen the development of a critical and historical discourse on the Japanese production. This text proposes to consider the treatment of the history of manga in reference books available in French, with a focus on its preconceived ideas. We will consider in particular the question of the origin, and of the central figure of Tezuka Osamu. We will then analyze the distorsions linked to the availability of certain works in French, be it the importance of an author such as Taniguchi Jirou, or the limited attention given to the alternative production that still remains rarely translated. We will also consider the vision of the manga industry in Japan, and how this vision is mostly built on the emblematic case of the Shônen Jump weekly magazine. Finally, we will observe how French publishers translate this vision in their

Atividade antimicrobiana, antioxidante e teor de compostos fenólicos em casca e amêndoa de frutos de manga

Directory of Open Access Journals (Sweden)

Kettelin Aparecida Arbos

2013-04-01

Full Text Available O processamento industrial de frutos de manga gera elevada quantidade de resíduos agroindustriais, representados pelas cascas e sementes (amêndoa, os quais, sem aplicação viável, acabam sendo descartados diretamente no meio ambiente. Esses resíduos são ricos em compostos bioativos, amplamente reconhecidos pelas suas propriedades promotoras da saúde e em aplicações tecnológicas. Os objetivos foram avaliar as atividades antimicrobiana e antioxidante e o teor de compostos fenólicos de dois extratos: um obtido da casca (FC e outro da amêndoa (FA de manga variedade 'Tommy Atkins'. O teor de compostos fenólicos totais variou de 3.123 a 6.644 mg de catequina/100 g. Os extratos FC e FA demonstraram relevante atividade antimicrobiana frente às cepas das bactérias Escherichia coli, Salmonella sp., Pseudomonas aeruginosa . Staphylococcus aureus, determinadas pelo método de difusão em disco. A ação antioxidante de FC e FA aumentou com o aumento das concentrações testadas, atingindo o valor máximo de 88% (FC. Em todas as concentrações testadas os extratos FC apresentaram ação antioxidante significativamente superior às respectivas concentrações dos extratos FA. Esses resultados sugerem potencial aplicação dos resíduos de manga como fonte de compostos fenólicos, substâncias antimicrobianas e antioxidantes, podendo ser explorados pelas indústrias de alimentos.

La comunicación digital del FC Barcelona y del Real Madrid CF y su percepción por los periodistas deportivos / Digital communication of FC Barcelona and Real Madrid CF and its perception by sports journalists

Directory of Open Access Journals (Sweden)

Fernando Olabe Sánchez

2012-12-01

Full Text Available ResumenEl FC Barcelona y el Real Madrid CF han cambiado su modelo de gestión comunicativa, especialmente en su relación con los medios de comunicación. Favorecidos por la implantación de las TIC, los departamentos de Comunicación de estas entidades se constituyen en gatekeeper al controlar y emitir, a través de sus propios medios de comunicación, como las televisiones y radios propias y los soportes online, las informaciones que ellos mismos generan. De este modo, controlan los mensajes y los emiten directamente a sus públicos objetivos sin la intermediación de los medios convencionales, condicionando las rutinas productivas de los periodistas deportivos.El objetivo de este trabajo es mostrar la percepción que estos profesionales tienen sobre las diferentes herramientas y soportes online que los departamentos de Comunicación de estos clubes emplean en su actividad diaria con los medios.AbstractThe FC Barcelona and Real Madrid CF have changed their communicative management model, especially in its relationship with the media. Favored by the introduction of ICT, Communication departments of these entities constitute gatekeeper to control and issue, through their own media, such as television and radio stations and media own online, the information that they generate. Thus, controlling broadcast messages and their target audiences directly without the intermediation of the mainstream media, conditioning routines productive sports journalists.The aim of this paper is to show the perception that these professionals have about the different tools and online media Communication departments to use these clubs in their daily activities with the media.

40 CFR 97.86 - Withdrawal from NOX Budget Trading Program.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Withdrawal from NOX Budget Trading... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Individual Unit Opt-ins. § 97.86 Withdrawal from NOX Budget Trading Program. (a) Requesting withdrawal. To...

Características de las personas afectadas de fibrilación auricular en una consulta de cardiología

Directory of Open Access Journals (Sweden)

Patricia López-Mases

Full Text Available La Fibrilación auricular (FA presenta una elevada prevalencia en los ancianos. Se plantea como objetivo describir las características de la población afectada y valorar las relaciones existentes entre los diferentes aspectos medibles. Metodología: Estudio descriptivo e inferencial con muestreo por conveniencia, seleccionando todos los pacientes con episodios de FA asociados a frecuencias cardíacas (FC superiores a 80 ppm o que hayan revertido a ritmo sinusal, con el que se obtiene una muestra de 65 personas. Se han recopilado datos sociodemográficos, tipo de FA, variaciones en FC, visitas a urgencias y complicaciones. Los datos han sido analizados mediante el programa SPSS v.17.0. Resultados: La media de edad fue de 65 años. La FA paroxística se encuentra asociada a FC iniciales superiores a las del grupo de FA persistente, el cual se relaciona con edades más avanzadas. El grupo que acude a urgencias presenta FC iniciales superiores. Existen diferencias significativas, asociando directamente las consultas al servicio de urgencias con episodios de FA con FC elevadas que obliga a la derivación. A edades avanzadas, mayor asociación en el individuo de los factores de riesgo con los que esta se relaciona. Conclusiones: La FA es una de las arritmias más prevalentes, con un alto coste sanitario y con un empeoramiento de la calidad de vida, por lo que las actividades encaminadas a la detección precoz y tratamiento adecuado son fundamentales para su mejora.

Farinha de resíduos da filetagem de tilápia em rações para alevinos de piauçu (Leporinus macrocephalus Effects of feeding tilapia by-products flour for piauçu (Leporinus macrocephalus fingerlings

Directory of Open Access Journals (Sweden)

Wilson Rogério Boscolo

2005-12-01

Full Text Available Este experimento foi realizado com o objetivo de avaliar o efeito da inclusão de farinha de resíduos da industrialização de tilápia (FT na alimentação de alevinos de piauçu (Leporinus macrocephalus. Cento e vinte e cinco alevinos com peso e comprimento iniciais de 0,19 ± 0,004 g e 2,37 ± 0,2 cm foram distribuídos em delineamento inteiramente casualizado, com cinco tratamentos e cinco repetições. As rações testadas continham 0; 5; 10 e 15% de FT e 0% de FT suplementada com metionina. O arraçoamento foi de 10% da biomassa quatro vezes ao dia (8, 11, 14 e 17 h. As médias dos parâmetros físico-químicos da água foram 7,89 ± 0,05, 89,93 ± 0,42, 7,15 ± 0,10 e 27,10 ± 0,95 para pH, condutividade elétrica (µS.cm-1, oxigênio dissolvido (mg.L-1 e temperatura (ºC, respectivamente. Ao final do período experimental, foram avaliadas as médias de sobrevivência (SO, peso final (PF, comprimento final (CF, ganho de peso (GP, fator de condição (FC e conversão alimentar aparente (CA. Foram observadas diferenças quanto ao CF, CA e FC entre tratamentos, obtendo-se melhores resultados naqueles com inclusão de FT e suplementação de metionina. O CF apresentou aumento linear com platô em 8,56% de FT e a CA apresentou redução linear com platô de 8,19% de inclusão de FT. Os maiores teores de proteína bruta (PB na carcaça foram obtidos nos tratamentos com mais de 5% de FT e 0% de FT suplementado com metionina. Pode-se incluir até 15% de FT em rações para alevinos de piauçu, melhorando seu desempenho e deposição de PB na carcaça, o que torna a FT uma fonte protéica alternativa.This trial was carried out to evaluate the effects of feeding Tilapia fillet by-products meal (TF for piauçu (Leporinus macrocephalus fingerlings. One hundred and twenty-five fingerlings averaging weight of 0.19 ± 0.004 g and length of 2.37 ± 0.28 cm were assigned to a completely randomized design with five treatments of five replicates. The diets

Construction of a bimolecular fluorescence complementation (BiFC ...

African Journals Online (AJOL)

Protein–protein interactions are essential for signal transduction in cells. Bimolecular fluorescence complementation (BiFC) is a novel technology that utilises green fluorescent proteins to visualize protein–protein interactions and subcellular protein localisation. BiFC based on pSATN vectors are a good system for ...

Coordinate expression of activating Fc gamma receptors I and III and inhibiting Fc gamma receptor type II in the determination of joint inflammation and cartilage destruction during immune complex-mediated arthritis.

NARCIS (Netherlands)

Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Boross, P.; Roth, J.; Verbeek, S.; Lent, P.L.E.M. van; Berg, W.B. van den

2003-01-01

OBJECTIVE: To study the role of the activating Fc gamma receptor types I and III (Fc gamma RI and Fc gamma RIII, respectively) and the inhibiting Fc gamma receptor II (Fc gamma RII) in inflammation and in various aspects of cartilage destruction during arthritis that is solely induced by immune

Imprensa política e Separatismo no Sul de Minas Gerais, século XIX

Directory of Open Access Journals (Sweden)

Pérola Maria Goldfeder e Castro

2010-07-01

Full Text Available RESUMO:A cidade de Campanha afirmou-se durante o século XIX como importante localidade propagadora de idéias separatistas no Sul de Minas Gerais. Nela surgiram vários jornais e projetos parlamentares que tinham como aspiração comum a provincialização daquela região. Num primeiro momento, este texto identifica as transformações históricas no estatuto social e político da imprensa moderna. Em seguida, analisam-se os fatores de surgimento das idéias separatistas no Sul de Minas Gerais durante o século XIX, materializadas na imprensa local. Por fim, algumas considerações sobre o Movimento Separatista de 1892 e o posicionamento de setores da imprensa local quanto ao assunto.PALAVRAS-CHAVE: Imprensa; Separatismo; Sul de MinasABSTRACT: City Campaign was stated during the nineteenth century as important propagator town of separatist ideas in southern Minas Gerais. it there were several newspapers and parliamentary projects that had as common aspiration to provincializing that region. In a first Currently, this paper identifies the historical changes in status social and political development of modern press. Then we analyze the factors emergence of separatist ideas in the South of Minas Gerais during the nineteenth century, materialized in the local press. Finally, some considerations on the Separatist Movement of 1892 and the positioning sectors of the local media for that matter. KEYWORDS: Press, Separatism, southern Minas GeraisRecebido: 15/06/2010       Aceito: 14/07/2010

Identification of Fc Gamma Receptor Glycoforms That Produce Differential Binding Kinetics for Rituximab.

Science.gov (United States)

Hayes, Jerrard M; Frostell, Asa; Karlsson, Robert; Müller, Steffen; Martín, Silvia Míllan; Pauers, Martin; Reuss, Franziska; Cosgrave, Eoin F; Anneren, Cecilia; Davey, Gavin P; Rudd, Pauline M

2017-10-01

Fc gamma receptors (FcγR) bind the Fc region of antibodies and therefore play a prominent role in antibody-dependent cell-based immune responses such as ADCC, CDC and ADCP. The immune effector cell activity is directly linked to a productive molecular engagement of FcγRs where both the protein and glycan moiety of antibody and receptor can affect the interaction and in the present study we focus on the role of the FcγR glycans in this interaction. We provide a complete description of the glycan composition of Chinese hamster ovary (CHO) expressed human Fcγ receptors RI (CD64), RIIa Arg131/His131 (CD32a), RIIb (CD32b) and RIIIa Phe158/Val158 (CD16a) and analyze the role of the glycans in the binding mechanism with IgG. The interactions of the monoclonal antibody rituximab with each FcγR were characterized and we discuss the CHO-FcγRIIIa Phe158/Val158 and CHO-FcγRI interactions and compare them to the equivalent interactions with human (HEK293) and murine (NS0) produced receptors. Our results reveal clear differences in the binding profiles of rituximab, which we attribute in each case to the differences in host cell-dependent FcγR glycosylation. The glycan profiles of CHO expressed FcγRI and FcγRIIIa Phe158/Val158 were compared with the glycan profiles of the receptors expressed in NS0 and HEK293 cells and we show that the glycan type and abundance differs significantly between the receptors and that these glycan differences lead to the observed differences in the respective FcγR binding patterns with rituximab. Oligomannose structures are prevalent on FcγRI from each source and likely contribute to the high affinity rituximab interaction through a stabilization effect. On FcγRI and FcγRIIIa large and sialylated glycans have a negative impact on rituximab binding, likely through destabilization of the interaction. In conclusion, the data show that the IgG1-FcγR binding kinetics differ depending on the glycosylation of the FcγR and further support a

Identification of antibody glycosylation structures that predict monoclonal antibody Fc-effector function.

Science.gov (United States)

Chung, Amy W; Crispin, Max; Pritchard, Laura; Robinson, Hannah; Gorny, Miroslaw K; Yu, Xiaojie; Bailey-Kellogg, Chris; Ackerman, Margaret E; Scanlan, Chris; Zolla-Pazner, Susan; Alter, Galit

2014-11-13

To determine monoclonal antibody (mAb) features that predict fragment crystalizable (Fc)-mediated effector functions against HIV. Monoclonal antibodies, derived from Chinese hamster ovary cells or Epstein-Barr virus-immortalized mouse heteromyelomas, with specificity to key regions of the HIV envelope including gp120-V2, gp120-V3 loop, gp120-CD4(+) binding site, and gp41-specific antibodies, were functionally profiled to determine the relative contribution of the variable and constant domain features of the antibodies in driving robust Fc-effector functions. Each mAb was assayed for antibody-binding affinity to gp140(SR162), antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) and for the ability to bind to FcγRIIa, FcγRIIb and FcγRIIIa receptors. Antibody glycan profiles were determined by HPLC. Neither the specificity nor the affinity of the mAbs determined the potency of Fc-effector function. FcγRIIIa binding strongly predicted ADCC and decreased galactose content inversely correlated with ADCP, whereas N-glycolylneuraminic acid-containing structures exhibited enhanced ADCP. Additionally, the bi-antenary glycan arm onto which galactose was added predicted enhanced binding to FcγRIIIa and ADCC activity, independent of the specificity of the mAb. Our studies point to the specific Fc-glycan structures that can selectively promote Fc-effector functions independently of the antibody specificity. Furthermore, we demonstrated antibody glycan structures associated with enhanced ADCP activity, an emerging Fc-effector function that may aid in the control and clearance of HIV infection.

Sweat conductivity and coulometric quantitative test in neonatal cystic fibrosis screening

Directory of Open Access Journals (Sweden)

Mouseline Torquato Domingos

2015-11-01

Full Text Available Objective: To compare the results obtained with the sweat test using the conductivity method and coulometric measurement of sweat chloride in newborns (NBs with suspected cystic fibrosis (CF in the neonatal screening program. Methods: The sweat test was performed simultaneously by both methods in children with and without CF. The cutoff values to confirm CF were >50 mmol/L in the conductivity and >60 mmol/L in the coulometric test. Results: There were 444 infants without CF (185 males, 234 females, and 24 unreported submitted to the sweat test through conductivity and coulometric measurement simultaneously, obtaining median results of 32 mmol/L and 12 mmol/L, respectively. For 90 infants with CF, the median values of conductivity and coulometric measurement were 108 mmol/L and 97 mmol/L, respectively. The false positive rate for conductivity was 16.7%, and was higher than 50 mmol/L in all patients with CF, which gives this method a sensitivity of 100% (95% CI: 93.8–97.8, specificity of 96.2% (95% CI: 93.8–97.8, positive predictive value of 83.3% (95% CI: 74.4–91.1, negative predictive value of 100% (95% CI: 90.5–109.4, and 9.8% accuracy. The correlation between the methods was r = 0.97 (p > 0.001. The best suggested cutoff value was 69.0 mmol/L, with a kappa coefficient = 0.89. Conclusion: The conductivity test showed excellent correlation with the quantitative coulometric test, high sensitivity and specificity, and can be used in the diagnosis of CF in children detected through newborn screening. Resumo: Objetivo: Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos: O teste do suor foi realizado simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60�

Selection and Application of Sulfide Oxidizing Microorganisms Able to Withstand Thiols in Gas Biodesulfurization Systems.

Science.gov (United States)

Roman, Pawel; Klok, Johannes B M; Sousa, João A B; Broman, Elias; Dopson, Mark; Van Zessen, Erik; Bijmans, Martijn F M; Sorokin, Dimitry Y; Janssen, Albert J H

2016-12-06

After the first commercial applications of a new biological process for the removal of hydrogen sulfide (H 2 S) from low pressure biogas, the need arose to broaden the operating window to also enable the removal of organosulfur compounds from high pressure sour gases. In this study we have selected microorganisms from a full-scale biodesulfurization system that are capable of withstanding the presence of thiols. This full-scale unit has been in stable operation for more than 10 years. We investigated the microbial community by using high-throughput sequencing of 16S rRNA gene amplicons which showed that methanethiol gave a competitive advantage to bacteria belonging to the genera Thioalkalibacter (Halothiobacillaceae family) and Alkalilimnicola (Ectothiorhosdospiraceae family). The sulfide-oxidizing potential of the acclimatized population was investigated under elevated thiol loading rates (4.5-9.1 mM d -1 ), consisting of a mix of methanethiol, ethanethiol, and propanethiol. With this biomass, it was possible to achieve a stable bioreactor operation at which 80% of the supplied H 2 S (61 mM d -1 ) was biologically oxidized to elemental sulfur. The remainder was chemically produced thiosulfate. Moreover, we found that a conventionally applied method for controlling the oxygen supply to the bioreactor, that is, by maintaining a redox potential set-point value, appeared to be ineffective in the presence of thiols.

PRODUCCIÓN DE BIOMASA Y EXOPOLISACÁRIDOS DE Grifóla frondosa BAJO CULTIVO SUMERGIDO UTILIZANDO FUENTES DE CARBONO NO CONVENCIONALES

Directory of Open Access Journals (Sweden)

Paula Zapata

2007-06-01

Full Text Available Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3 con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC en la producción de biomasa y exopolisacári-dos (EPS, bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7 y medio (MB y MS. La máxima producción de biomasa micelial (21,10 ± 0,82 g/l y la máxima producción de EPS (6,53 ± 0,14 g/l se logró utilizando el medio MB suplementado con FC4. Además de lo anterior, se logró desarrollar un medio de cultivo que cumple con el objetivo de disminuir costos, de Col $18.455 a $656 por litro de medio, produciendo (14,14 ± 0,82 g/l de biomasa y (5,16 ± 0,14 g/l de EPS, utilizando el medio MS suplementando con FC4. Estos resultados abren nuevas alternativas y posibilidades en nuestro país para el desarrollo de productos a partir de esta especie con costos que estén al alcance de la población.Grifóla frondosa is a Basidiomycete fungus edible and medicinal, it produces polysaccharides such a glucans (β-1,6 and β-1,3 with anti-tumor and inmuno-stimulating activity. For this work, the aim was evaluate the incidence of different carbon sources (FC in biomass and exo-polymer (EPS production, under submerged culture conditions, by using a factorial statistical design with two factors: carbon source (FC(1-7 and medium (MB and MS. The maximal yield of mycelial biomass (21,10 ± 0,82 g/l and the maximal yield in EPS (6,53 ± 0,14 g/l was achieved by using the MB medium supplemented with FC4. Besides, it was possible to develop a medium that fulfills the objective of reducing costs from $18.455 to $656 Colombian pesos for each liter of medium used, which produces (14,14 ± 0,82 g/l of biomass and (5,16 ± 0,14 g/l of EPS, using the MS medium supplemented with FC4

40 CFR 97.288 - CAIR SO2 allowance allocations to CAIR SO2 opt-in units.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR SO2 allowance allocations to CAIR SO2 opt-in units. 97.288 Section 97.288 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS...

ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells

International Nuclear Information System (INIS)

Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep

2016-01-01

Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.

ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells

Energy Technology Data Exchange (ETDEWEB)

Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu

2016-09-09

Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.

DEFINICIÓN DE PIT FINAL CAPACITADO BAJO INCERTIDUMBRE

OpenAIRE

PEIRANO OPAZO, FERNANDO ANDRÉS

2011-01-01

El objetivo principal de este trabajo de tesis es desarrollar una metodología y una herramienta que permitan definir un pit final incorporando las restricciones de capacidad y las condiciones de incertidumbre asociadas al recurso geológico. El resultado metodológico consiste en un algoritmo de cálculo que incorpora heurísticas de definición de pit final como es la enunciada por Lerchs y Grossman (1964), en conjunto con heurísticas de secuenciamiento de bloques como son enunciadas por Gersh...

Qualidade da carne de marreco pequim branco (Anas Platyrhynchos platyrhynchos L. 1758 comparado a frango de corte Meat quality in white peking mallard (Anas Platyrhynchos platyrhynchos L. 1758 compared to broiler chicken

Directory of Open Access Journals (Sweden)

Peter Bitencourt Faria

2008-02-01

Full Text Available O total de 20 carcaças resfriadas (10 Marrecos Pequim Branco e 10 de frangos de corte foi submetido às análises de composição centesimal, colesterol, cor (sistema CIE L*a*b*, perda de peso por cozimento (PPC e força de cisalhamento (FC. A carne de marreco apresenta (PTwenty refrigerated carcasses (10 Peking mallard and 10 broiler chicken were submitted to analyses of chemical composition, cholesterol, colour (CIE L*a*b* system, weight loss by cooking (PPC and shear force (FC. Mallard meat had lower (P<0.05 humidity in both leg and breast (71.77 and 74.53%, respectively when compared with chicken meat (74.73 and 76.07%, respectively. When different cuts were compared, the breast had a higher (P<0.05 humidity and protein content than the leg in both species. Mallard leg and breast had lower (P<0.05 lightness (37.59 and 35.75, respectively and higher red content (18.48 and 20.67, respectively, than the lightness (40.98 and 45.18, respectively and red content (10.02 and 5.52, respectively observed in chicken. The FC was higher (P<0.05 in mallard breast (4.90 kgf than in chicken breast (2.63 kgf. Meat from White Peking mallard is darker and with a stronger red pigment than meat from broiler chicken. Even though it is less tender than meat from broiler chicken, mallard meat still has an acceptable tenderness.

As idéias psicopedagógicas e a espiritualidade no karate-do segundo a obra de Gichin Funakoshi

Directory of Open Access Journals (Sweden)

Barreira Cristiano Roque Antunes

2003-01-01

Full Text Available O karate é uma forma de luta com origens remotas, pouco conhecidas e marcado desenvolvimento na ilha de Okinawa do arquipélago japonês. Outrora praticado às escondidas, no século XX Gichin Funakoshi tornou-o público e o difundiu. Partiu de Funakoshi a denominação karate-do, "o caminho das mãos vazias", que dá um caráter doutrinário à arte que deveria servir, mais do que como mera forma de luta, ao desenvolvimento da personalidade. Procura-se fazer um resgate teórico das idéias psicopedagógicas e da espiritualidade próprias do karate sob a luz dos paradigmas culturais de maior influência no pensamento de Funakoshi. Observa-se claramente a influência e complementaridade entre confucionismo e zen-budismo além da herança prática do bushidô que permitem compreender o pensamento de Funakoshi acerca da espiritualidade e transmissão do conhecimento.

Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.

Science.gov (United States)

Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J H M; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C Ellen; Vidarsson, Gestur

2015-03-01

RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with FcγRIII, with less Fc-fucosylation strengthening the interaction. Anti-D IgG1 Fc-glycosylation patterns in 93 plasma samples from 28 male and 28 female Dutch HIDs and RhIG were analyzed with mass spectrometry. The Fc-glycosylation profiles of HIDs were evaluated with regard to their immunization history. HID sera demonstrated clearly lowered anti-D Fc-fucosylation compared to normal IgG fucosylation (93%); this was more pronounced for female than for male HIDs (47% vs. 65%, p = 0.001). RhIG preparations from seven manufacturers varied greatly in the level of Fc-fucosylation (56%-91%). The level of fucosylation slightly increased upon repeated immunization, although it remained fairly constant over time. The RhIG from the different manufacturers all demonstrated increased Fc-galactosylation (64%-82%) compared to total IgG (38%-51%). RhIG preparations vary in Fc-fucosylation and all demonstrate increased galactosylation. Despite not knowing the exact working mechanism, immunoprophylaxis could perhaps be optimized by selection of donors whose anti-D have low amounts of Fc-fucose, to increase the clearance activity of anti-D preparations, as well as high amounts of galactosylation, for anti-inflammatory effects. Implementing a biologic assay in the standardization of RhIG preparations might be considered. © 2014 AABB.

Desenvolvimento e avaliação de um teste ELISA indireto para o diagnóstico sorológico do mormo em equídeos

Directory of Open Access Journals (Sweden)

José Andreey A. Teles

2012-09-01

Full Text Available O mormo é uma enfermidade infecto-contagiosa de caráter agudo ou crônico que acomete principalmente os equídeos, causando enormes prejuízos na cadeia produtiva do cavalo. Para controlar a enfermidade o Ministério da Agricultura, Pecuária e Abastecimento (MAPA instituiu medidas sanitárias obrigatórias em todo território nacional que incluem o diagnóstico oficial pela fixação do complemento (FC, maleinização e sacrifício dos animais positivos. Os kits atuais utilizados no diagnóstico da doença são importados, dificultando e encarecendo sua aplicação na rotina. Objetivou-se com este estudo padronizar um teste de ELISA indireto utilizando o extrato protéico de Burkholderia mallei isolada a partir de equídeo portador no estado de Pernambuco. As amostras foram cultivadas em ágar sangue 10%, incubada por 48h a 37°C; posteriormente caracterizou-se fenotípica e genotipicamente uma das colônias isoladas, e em seguida a cultivou em BHI para enriquecimento; logo após, esta foi repicada para o meio Dor-set Henley o qual foi incubado a 37ºC sob 60rpm por oito semanas. Para padronização do teste utilizou-se o Conjugado Proteína G Peroxidase Sigma na diluição de 1:90.000, com soros diluídos em 1:100 e o antígeno em 1:400. Utilizou-se 60 soros como controle negativo testados frente à FC para determinação do ponto de corte o qual ficou em 0,042nm. Feitas as padronizações, foram testadas 300 amostras, onde 99% (297 foram concordantes com os resultados obtidos na FC. Ao final, o ensaio apresentou 100% de sensibilidade e 98,2% de especificidade com valores preditivo positivo e negativo de 97,7% e 100%, respectivamente. O teste de concordância kappa foi 0,98 e a repetibilidade intra e interplaca ficaram em 8,8 e 10,3%, respectivamente. Diante dos resultados obtidos durante os ensaios, conclui-se que o teste de ELISA indireto pode ser utilizado como uma ferramenta de diagnóstico eficiente. Entretanto, mais ensaios devem ser

Developing a Roadmap for US Divertor and PMI Research in the ITER Era

Science.gov (United States)

Hill, D. N.; Lipschultz, B.; Whyte, D. G.; Garofalo, A. M.; Leonard, A. W.; Maingi, R.

2013-10-01

The role of existing and candidate future facilities for developing driven core, boundary plasma and plasma-facing components (PFCs) solutions for burning plasma experiments will be discussed in light of scientific and technical challenges, testing capabilities, scheduling implications, and cost. Present experiments point to likely integrated core-edge solutions which may enable steady-state high-gain, high power density operation; focused research on existing tokamak facilities could strengthen confidence significantly. In parallel, both existing and new candidate materials suitable for testing under high neutron fluence can be developed and qualified. We will also discuss the potential role of new facilities in closing the knowledge gaps to a Fusion Nuclear Science Facility (FNSF), and what form the final step of integrating core and edge solutions will be (separate, or as part of an FNSF) in terms of size, goals and cost. Supported by the US DOE under DE-AC52-07NA27344, DE-FC02-99ER54512, DE-SC00-02060, DE-FG02-04ER54762, DE-FC-02-04ER54698, and DE-AC02-09CH11466.

Detection of serpentine in exogenic carbonaceous chondrite material on Vesta from Dawn FC data

Science.gov (United States)

Nathues, Andreas; Hoffmann, Martin; Cloutis, Edward A.; Schäfer, Michael; Reddy, Vishnu; Christensen, Ulrich; Sierks, Holger; Thangjam, Guneshwar Singh; Le Corre, Lucille; Mengel, Kurt; Vincent, Jean-Baptist; Russell, Christopher T.; Prettyman, Tom; Schmedemann, Nico; Kneissl, Thomas; Raymond, Carol; Gutierrez-Marques, Pablo; Hall, Ian; Büttner, Irene

2014-09-01

The Dawn mission’s Framing Camera (FC) observed Asteroid (4) Vesta in 2011 and 2012 using seven color filters and one clear filter from different orbits. In the present paper we analyze recalibrated HAMO color cubes (spatial resolution ∼60 m/pixel) with a focus on dark material (DM). We present a definition of highly concentrated DM based on spectral parameters, subsequently map the DM across the Vestan surface, geologically classify DM, study its spectral properties on global and local scales, and finally, compare the FC in-flight color data with laboratory spectra. We have discovered an absorption band centered at 0.72 μm in localities of DM that show the lowest albedo values by using FC data as well as spectral information from Dawn’s imaging spectrometer VIR. Such localities are contained within impact-exposed outcrops on inner crater walls and ejecta material. Comparisons between spectral FC in-flight data, and laboratory spectra of meteorites and mineral mixtures in the wavelength range 0.4-1.0 μm, revealed that the absorption band can be attributed to the mineral serpentine, which is typically present in CM chondrites. Dark material in its purest form is rare on Vesta’s surface and is distributed globally in a non-uniform manner. Our findings confirm the hypothesis of an exogenic origin of the DM by the infall of carbonaceous chondritic material, likely of CM type. It further confirms the hypothesis that most of the DM was deposited by the Veneneia impact.

Análise da tendência temporal de dano renal agudo entre pacientes graves conforme polimorfi smos I/D e -262A > T da enzima conversora da angiotensina Temporal trends in acute renal dysfunction among critically ill patients according to I/D and -262A > T ACE polymorphisms

Directory of Open Access Journals (Sweden)

José Alberto Rodrigues Pedroso

2010-06-01

Full Text Available A síndrome de disfunção de múltiplos órgãos e sistemas (DMOS e a disfunção renal aguda compartilham muitos dos fatores fisiológicos envolvidos em seu desenvolvimento. Estudos recentes correlacionam suscetibilidades individuais, determinadas geneticamente, à disfunção de órgãos em pacientes criticamente enfermos, situação em que o gene da enzima conversora da angiotensina (ECA poderia ser um candidato para elucidar predisposição ou risco genético. Nosso objetivo foi examinar os efeitos da presença de dois polimorfismos, I/D e -262A > T, na disfunção renal em pacientes agudamente graves do Sul do Brasil. O escore SOFA (sequential organ failure assessment à admissão e a tendência da função renal (medida pelo escore renal diário do SOFA foram determinados em pacientes de unidade de terapia intensiva (UTI. Um total de 153 pacientes adultos (79 homens foi incluído no estudo. Houve monitoração diária da função renal durante toda a permanência na UTI e também pós-UTI. Observou-se a progressão para insuficiência renal (SOFA 3 e 4 nos primeiros sete dias de internação em UTI, bem como necessidade de diálise. As frequências genotípicas gerais em nossa amostra foram II = 0,17; ID = 0,46; DD = 0,37; e AA = 0,30; AT = 0,55; TT = 0,15; e as frequências alélicas foram I = 0,40, D = 0,60; e A = 0,56; T = 0,44. Este é o primeiro estudo para verificar a influência de polimorfismos I/D e -262A > T da ECA em disfunção renal aguda em pacientes críticos. Nenhuma associação significativa foi encontrada entre os genótipos ou as frequências alélicas e a evolução da função renal. Os polimorfismos I/D e -262A > T da ECA não têm impacto significativo sobre a evolução da função renal durante a primeira semana de internação na UTI nem exercem qualquer influência sobre a mortalidade em pacientes graves.Multiple organ failure syndrome and acute renal dysfunction share many of physiologic factors involved in

Group-ID based RFID Mutual Authentication

Directory of Open Access Journals (Sweden)

LEE, Y.

2013-11-01

Full Text Available For passive type RFID tags, EPCglobal Class 1 Generation-2 Revision is used widely as a de facto standard. As it was designed for low cost, it is quite vulnerable to security issues, such as privacy concerns. This paper presents a new RFID mutual authentication protocol, which is designed to be configured on EPC Gen2 platform and to meet various security requirements while providing efficiency using PRNG (Pseudo Random Number Generator. Group-ID is used to minimize the authentication time. Security analysis of the proposed protocol is discussed.

Influencia de la relación velocidad de corte-avance en la calidad superficial de muestras taladradas de fibra de carbono

Directory of Open Access Journals (Sweden)

Álvarez, M.

2005-12-01

Full Text Available The industrial applications of Carbon Fiber (CF have increased in the last years. Particularly, in the aerospace industry, these materials are usually drilled because of the assembly requirements of the structural elements of airships. However, drilling of CF can be accompanied of troubles such as delaminations, lost of surface quality and quick wear of cutting tool. In this work, a study on the surface quality of CF drilled samples as a function of the cutting parameters has been achieved.

En los últimos años, la fibra de carbono (FC encuentra, cada vez, más aplicaciones en los distintos sectores industriales. En el caso particular de la industria aeronáutica, este tipo de materiales se somete frecuentemente a operaciones de taladrado formando parte de estructuras híbridas PC/substrato metálico, debido a las necesidades de montaje en los elementos estructurales de una aeronave. Sin embargo, en el taladrado de FC se puede presentar una serie de problemas como las delaminaciones, la pérdida de calidad en el acabado superficial o el desgaste rápido y excesivo de la herramienta de corte. En este trabajo se lleva a cabo un primer estudio de la calidad de acabado superficial obtenida en muestras de FC taladradas en función de las condiciones de corte impuestas.

Determination of Trace Elements in Uranium by HPLC-ID-ICP-MS: NTNFC Final Report

Energy Technology Data Exchange (ETDEWEB)

Manard, Benjamin Thomas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wylie, Ernest Miller II [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Xu, Ning [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Tandon, Lav [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-10-19

This report covers the FY 16 effort for the HPLC-ID-ICP-MS methodology 1) sub-method validation for the group I&II elements, 2) sub-method stood-up and validation for REE, 3) sub-method development for the transition element, and 4) completion of a comprehensive SOP for three families of elements.

Microbial desulfurization of coal

International Nuclear Information System (INIS)

Bos, P.; Boogerd, F.C.; Kuenen, J.G.

1992-01-01

In recent years, studies have been initiated to explore the possibilities of the use of biological systems in coal technology. This chapter discusses the principles behind the bioprocessing of coal, the advantages and disadvantages, and the economic feasibility of the process. For large-scale, coal-using, energy-producing plants, stack gas cleaning should be the treatment of choice. Biodesulfurization is preferable with industrial, small-scale, energy-producing plants. Treatment of the stack gases of these plants is not advisable because of high investment costs. Finally, it should be realized that biodesulfurization produces a waste stream that needs further treatment. 91 refs

Efecto del estiramiento estático de 15, 30 y 60 segundos sobre el rango de movimiento de la flexión de cadera con rodilla extendida

Directory of Open Access Journals (Sweden)

Claudia Lucía Ariza-García

2014-06-01

Full Text Available Objetivo: Evaluar el efecto de tres duraciones de estiramiento estático pasivo, 15, 30 y 60 segundos (s para aumentar el rango de movimiento de la flexión de cadera (ROM-FC. Metodología: Ensayo Clínico Controlado Aleatorizado. Nueve estudiantes mujeres (21,7 ± 4,3 años fueron asignadas aleatoriamente a tres grupos, 15 (G15, 30 (G30 y 60 (G60 s; n = 3 en cada grupo. El estiramiento de la musculatura isquitotibial se realizó en decúbito supino, máxima flexión de cadera, rodilla extendida y dorsiflexión de pie con ayuda de una banda elástica; dos veces consecutivas en ambos miembros inferiores, tres veces/semana, por tres semanas. El resultado principal fue el cambio del ROM-FC izquierda y derecha al finalizar la intervención. Se usó la prueba t de student y el análisis ANOVA. Resultados:  Las diferencias entre evaluaciones en G15 y G30 fueron estadísticamente significativas para el miembro inferior derecho. No se encontraron diferencias significativas en el grupo G60 del hemicuerpo derecho ni en grupo alguno del hemicuerpo izquierdo. Tampoco para el aumento de ROM-FC entre los tres grupos ni entre hemicuerpos. Conclusión: El estiramiento estático pasivo de 15 y 30 s de duración fue efectivo para aumentar el ROM-FC derecho. Se requieren futuros estudios con un tamaño de muestra adecuado para detectar diferencias en el aumento del ROM-FC según duración del estiramiento y hemicuerpos.

Clinical accuracy of a PLEX-ID flu device for simultaneous detection and identification of influenza viruses A and B.

Science.gov (United States)

Tang, Yi-Wei; Lowery, Kristin S; Valsamakis, Alexandra; Schaefer, Virginia C; Chappell, James D; White-Abell, Jill; Quinn, Criziel D; Li, Haijing; Washington, Cicely A; Cromwell, Jenna; Giamanco, Chantel M; Forman, Michael; Holden, Jeffery; Rothman, Richard E; Parker, Michelle L; Ortenberg, Elaine V; Zhang, Lei; Lin, Yea-Lin; Gaydos, Charlotte A

2013-01-01

Respiratory tract infections caused by influenza A and B viruses often present nonspecifically, and a rapid, high-throughput laboratory technique that can identify influenza viruses is clinically and epidemiologically desirable. The PLEX-ID Flu assay (Abbott Molecular Inc., Des Plaines, IL) incorporates multilocus PCR and electrospray ionization-mass spectrometry to detect and differentiate influenza A 2009 H1N1 (H1N1-p), seasonal H1N1 (H1N1-s), influenza A H3N2, and influenza B viruses in nasopharyngeal swab (NPS) specimens. The clinical performance characteristics of the PLEX-ID Flu assay in symptomatic patients were determined in this multicenter trial. A total of 2,617 prospectively and retrospectively collected NPS specimens from patients with influenza-like illness between February 2008 and 28 May 2010 were eligible for inclusion in the study. Each specimen was tested in parallel by the PLEX-ID Flu assay and by the Prodesse ProFLU+ assay (Prodesse Inc., Madison, WI), to detect influenza A and B viruses. Specimens testing positive for influenza A virus by ProFLU+ were subtyped as H1N1-p, H1N1-s, or H3N2 by using the ProFAST+ assay (Gen-Probe Prodesse Inc.). The reproducibility of the PLEX-ID Flu assay ranged from 98.3 to 100.0%, as determined by testing a nine-specimen panel at three clinical sites on each of 5 days. Positive percent agreements (PPAs) and negative percent agreements (NPAs) of the PLEX-ID Flu assay were 94.5% and 99.0% for influenza A virus and 96.0% and 99.9% for influenza B virus, respectively. For the influenza A virus subtyping characterization, the PLEX-ID Flu assay had PPAs and NPAs of 98.3% and 97.5% for H1N1-p, 88.6% and 100.0% for H1N1-s, and 98.0% and 99.9% for H3N2, respectively. The overall agreements between the PLEX-ID and Prodesse ProFLU+/ProFAST+ assays were 97.1 to 100.0%. Bidirectional Sanger sequencing analysis revealed that 87.5% of 96 discrepant results between the PLEX-ID Flu and ProFLU+/ProFAST+ assays were found upon

Antigen-Specific IgG ameliorates allergic airway inflammation via Fcγ receptor IIB on dendritic cells

Directory of Open Access Journals (Sweden)

Karasuyama Hajime

2011-04-01

Full Text Available Abstract Background There have been few reports on the role of Fc receptors (FcRs and immunoglobulin G (IgG in asthma. The purpose of this study is to clarify the role of inhibitory FcRs and antigen presenting cells (APCs in pathogenesis of asthma and to evaluate antigen-transporting and presenting capacity by APCs in the tracheobronchial mucosa. Methods In FcγRIIB deficient (KO and C57BL/6 (WT mice, the effects of intratracheal instillation of antigen-specific IgG were analysed using the model with sensitization and airborne challenge with ovalbumin (OVA. Thoracic lymph nodes instilled with fluorescein-conjugated OVA were analysed by fluorescence microscopy. Moreover, we analysed the CD11c+ MHC class II+ cells which intaken fluorescein-conjugated OVA in thoracic lymph nodes by flow cytometry. Also, lung-derived CD11c+ APCs were analysed by flow cytometry. Effects of anti-OVA IgG1 on bone marrow dendritic cells (BMDCs in vitro were also analysed. Moreover, in FcγRIIB KO mice intravenously transplanted dendritic cells (DCs differentiated from BMDCs of WT mice, the effects of intratracheal instillation of anti-OVA IgG were evaluated by bronchoalveolar lavage (BAL. Results In WT mice, total cells and eosinophils in BAL fluid reduced after instillation with anti-OVA IgG1. Anti-OVA IgG1 suppressed airway inflammation in hyperresponsiveness and histology. In addition, the number of the fluorescein-conjugated OVA in CD11c+ MHC class II+ cells of thoracic lymph nodes with anti-OVA IgG1 instillation decreased compared with PBS. Also, MHC class II expression on lung-derived CD11c+ APCs with anti-OVA IgG1 instillation reduced. Moreover, in vitro, we showed that BMDCs with anti-OVA IgG1 significantly decreased the T cell proliferation. Finally, we demonstrated that the lacking effects of anti-OVA IgG1 on airway inflammation on FcγRIIB KO mice were restored with WT-derived BMDCs transplanted intravenously. Conclusion Antigen-specific IgG ameliorates

Alternatives of Treatment and Final Disposition of the Solid Hospital residuals; Alternativas de Tratamiento y Disposicion Final de los Residuos Solidos Hospitalarios

Energy Technology Data Exchange (ETDEWEB)

Meza Monge, K

1998-07-01

The current handling, treatment and final disposition of the hospital solid waste in Costa Rica are considered inadequate or at least insufficient. This situation represents a serious danger for the population's health and the environment, because they are exposed to infectious agents, toxic substances and even radioactive products that are generated among the residuals of the centers of health. This work, alternatives propose for the treatment and adequate final disposition of the solid waste produced in the hospitals of the country. They take into consideration the characteristics that present these residuals, the advantages and disadvantages of each one of the existent techniques and the technical and economic possibilities of the country. For this purpose, in first instance, a revision about the properties, the quality and the quantity of the solid waste produced by the national hospital centers was carried out. Also, a diagnostic of the current situation of the treatment and final disposition of these residuals in some of the most important hospitals of the country, as well as of the possibilities of physical space with that they count on was carried out. Then, the existent different treatment techniques and final disposition for the solid waste that comes from the centers of health are described, as well as their advantages and disadvantages and a comparative analysis of the same ones is carried out. The objective is completed, since alternatives of treatment and final disposition that are considered appropriate for this type of residuals are planned. Nevertheless, in the future, more detailed investigations and studies of feasibility, with the purpose of developing handling programs and elimination of the solid waste for each one of the hospital centers in Costa Rica should be carried out. (Author) [Spanish] El actual manejo, tratamiento y disposicion final de los desechos solidos hospitalarios en Costa Rica se considera inadecuado o cuando menos

Syk-dependent tyrosine phosphorylation of 3BP2 is required for optimal FcRγ-mediated phagocytosis and chemokine expression in U937 cells.

Science.gov (United States)

Chihara, Kazuyasu; Kato, Yuji; Yoshiki, Hatsumi; Takeuchi, Kenji; Fujieda, Shigeharu; Sada, Kiyonao

2017-09-13

The adaptor protein c-Abl SH3 domain binding protein-2 (3BP2) is tyrosine phosphorylated by Syk in response to cross-linking of antigen receptors, which in turn activates various immune responses. Recently, a study using the mouse model of cherubism, a dominant inherited disorder caused by mutations in the gene encoding 3BP2, showed that 3BP2 is involved in the regulation of phagocytosis mediated by Fc receptor for IgG (FcγR) in macrophages. However, the molecular mechanisms underlying 3BP2-mediated regulation of phagocytosis and the physiological relevance of 3BP2 tyrosine phosphorylation remains elusive. In this study, we established various gene knockout U937 cell lines using the CRISPR/Cas9 system and found that 3BP2 is rapidly tyrosine phosphorylated by Syk in response to cross-linking of FcγRI. Depletion of 3BP2 caused significant reduction in the Fc receptor γ chain (FcRγ)-mediated phagocytosis in addition to the FcγRI-mediated induction of chemokine mRNA for IL-8, CCL3L3 and CCL4L2. Syk-dependent tyrosine phosphorylation of 3BP2 was required for overcoming these defects. Finally, we found that the PH and SH2 domains play important roles on FcγRI-mediated tyrosine phosphorylation of 3BP2 in HL-60 cells. Taken together, these results indicate that Syk-dependent tyrosine phosphorylation of 3BP2 is required for optimal FcRγ-mediated phagocytosis and chemokine expression.

Comparative studies on Fc receptors for IgG on resting and activated T lymphocytes

International Nuclear Information System (INIS)

Hueckel, C.; Jensen, H.L.; Rychly, J.; Sandor, M.; Erdei, A.; Gergely, J.

1986-01-01

Fc-receptors for IgG (FcγR) on resting (i.e. freshly prepared) and mitogen (Con A) or alloantigen-activated mouse spleen T cells were compared using binding of different markers such as 125 I-labelled immune complexes, 125 I-labelled anti FcγR monoclonal antibody, FITC-labelled aggr. IgG and sheep erythrocytes covered with specific antibody (EA rosetting). C3b receptors were detected by rosetting with sheep erythrocytes covered with antibody and complement (EAC rosetting). The electrophoretic mobility of the cells without or after binding of aggr. IgG was also tested. Differences between resting and activated T cells were found: (1) After activation of T cells by mitogen or alloantigen, a proportion of FcγR-positive cells increased two to four times. (2) FcγR number per FcγR-positive cell seemed to be higher on activated then on resting cells. (3) FcγR-positive resting cells did not shed their FcγR upon incubation at 4 0 C followed by incubation at 37 0 C, but FcγR-positive activated cells shed a remarkable proportion of their FcγR on the same conditions. (4) Binding of aggr. IgG caused a decrease of electrophoretic mobility of activated but not resting cells. (5) FcγR-positive resting cells were also C3b receptor-positive, whereas FcγR-positive activated cells had no detectable C3b receptors. (author)

Perfil de los usuarios activos y finales de clubes deportivos de Bogotá D. C.

Directory of Open Access Journals (Sweden)

Billy Crissien

2010-08-01

hacia los clubes en las diferentes disciplinas deportivas y analizar el caso particular de los hinchas de equipos profesionales. Para esto, se desarrolló una investigación descriptiva con encuestas a 336 usuarios activos y finales de clubes deportivos en la ciudad de Bogotá. Los resultados muestran un perfil diferencial para jugadores y espectadores a nivel de estilo de vida, hábitos saludables y patrón de interacción con los eventos deportivos. Los hinchas de los equipos profesionales de fútbol poseen un perfil similar al de los usuarios finales de los clubes de otras disciplinas, pero evidencian un nivel de involucramiento mucho más alto.

Transtorno de ansiedade na infância como preditor de psicopatologia em adultos

OpenAIRE

Gonçalves, Débora Hexsel; Heldt, Elizeth Paz da Silva

2009-01-01

O objetivo deste trabalho foi realizar uma revisão sistemática sobre os transtornos de ansiedade na infância como fatores de risco para psicopatologias na idade adulta. Para isso, foram utilizadas as bases de dados SciELO, LILACS, Adolec e PubMed, com busca de estudos publicados nos últimos 10 anos. Dez artigos preencheram plenamente os critérios de inclusão para o aceite final. Todos os trabalhos sustentam a idéia de que os transtornos de ansiedade na infância são preditores e podem atuar co...

40 CFR 86.612-97 - Suspension and revocation of certificates of conformity.

Science.gov (United States)

2010-07-01

... Heavy-Duty Vehicles § 86.612-97 Suspension and revocation of certificates of conformity. (a) The... individual vehicles after suspension of a certificate, the certificate is reinstated for any vehicle actually... 40 Protection of Environment 19 2010-07-01 2010-07-01 false Suspension and revocation of...

Biodesulfurization of dibenzothiophene in Escherichia coli is enhanced by expression of a Vibrio harveyi oxidoreductase gene

Energy Technology Data Exchange (ETDEWEB)

Reichmuth, D.S.; Hittle, J.L.; Blanch, H.W.; Keasling, J.D.

2000-01-05

One possible alternative to current fuel hydrodesulfurization methods is the use of microorganisms to remove sulfur compounds. Biodesulfurization requires much milder processing conditions, gives higher specificity, and does not require molecular hydrogen. In the present work the authors have produced two compatible plasmids: pDSR3, which allows Escherichia coli to convert dibenzothiophene (DBT) to hydroxybiphenyl (HBP), and pDSR2, which produces a Vibrio harveyi flavin oxidoreductase. The authors show that the flavin oxidoreductase enhances the rate of DBT removal when co-expressed in vivo with the desulfurization enzymes. The plasmids pDSR2 and pDSR3 were co-expressed in growing cultures. The expression of oxidoreductase caused an increase in the rate of DBT removal but a decrease in the rate of HBP production. The maximum rate of DBT removal was 8 mg/h {center{underscore}dot} g dry cell weight. Experiments were also conducted using resting cells with the addition of various carbon sources. It was found that the addition of glucose or glycerol to cultures with oxidoreductase expression produced the highest DBT removal rate. The culture with acetate and no oxidoreductase expression had the highest level of HBP production. For all carbon sources, the DBT removal rate was faster and the HBP generation rate slower with the expression of the oxidoreductase. Analysis of desulfurization intermediates indicates that the last enzyme in the pathway may be limiting.

21 CFR 866.5530 - Immunoglobulin G (Fc fragment specific) immunological test system.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Immunoglobulin G (Fc fragment specific... Test Systems § 866.5530 Immunoglobulin G (Fc fragment specific) immunological test system. (a) Identification. An immunoglobulin G (Fc fragment specific) immunological test system is a device that consists of...

The production of KIR-Fc fusion proteins and their use in a multiplex HLA class I binding assay.

Science.gov (United States)

Hilton, Hugo G; Moesta, Achim K; Guethlein, Lisbeth A; Blokhuis, Jeroen; Parham, Peter; Norman, Paul J

2015-10-01

Soluble recombinant proteins that comprise the extracellular part of a surface expressed receptor attached to the Fc region of an IgG antibody have facilitated the determination of ligand specificity for an array of immune system receptors. Among such receptors is the family of killer cell immunoglobulin-like receptors (KIR) that recognize HLA class I ligands. These receptors, expressed on natural killer (NK) cells and T cells, play important roles in both immune defense and placental development in early pregnancy. Here we describe a method for the production of two domain KIR-Fc fusion proteins using baculovirus infected insect cells. This method is more scalable than traditional mammalian cell expression systems and produces efficiently folded proteins that carry posttranslational modifications found in native KIR. We also describe a multiplex binding assay using the Luminex platform that determines the avidity and specificity of two domain KIR-Fc for a panel of microbeads, each coated with one of 97 HLA class I allotypes. This assay is simple to perform, and represents a major improvement over the assays used previously, which were limited in the number of KIR and HLA class I combinations that could be assayed at any one time. The results obtained from this assay can be used to predict the response of NK cell and T cells when their KIR recognize HLA class I. Copyright © 2015 Elsevier B.V. All rights reserved.

Estimación de la oferta de frutos en el gradiente vertical de un bosque del medio Caquetá, Amazonía colombiana

OpenAIRE

Nicolás Castaño Arboleda

2003-01-01

Se estimó id="normalb" class="text3">la id="normalb" class="text3">oferta id="normalb" class="text3">de id="normalb" class="text3">frutos id="normalb" class="text3">en id="normalb" class="text3">un id="normalb" class="text3">bosque id="normalb" class="text3">de tierra firme id="normalb" ...

A proposed HTTP service based IDS

Directory of Open Access Journals (Sweden)

Mohamed M. Abd-Eldayem

2014-03-01

Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.

40 CFR 97.286 - Withdrawal from CAIR SO2 Trading Program.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Withdrawal from CAIR SO2 Trading... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR SO2 Opt-in Units § 97.286 Withdrawal from CAIR SO2 Trading Program. Except as provided under paragraph (g) of...

40 CFR 97.83 - Applying for NOX Budget opt-in permit.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Applying for NOX Budget opt-in permit... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Individual Unit Opt-ins. § 97.83 Applying for NOX Budget opt-in permit. (a) Applying for initial NO X Budget opt...

77 FR 16556 - Kootenai National Wildlife Refuge, Boundary County, ID; Final Comprehensive Conservation Plan and...

Science.gov (United States)

2012-03-21

...: Dianna Ellis, Refuge Manager, Kootenai National Wildlife Refuge, 287 Westside Road, Bonners Ferry, ID..., wildlife observation and photography, and environmental education and interpretation. We will review and... safety. Allowing big game and upland game (grouse) hunting on the 295 acres of timber on the west side of...

Incentivos y desincentivos de la industria farmacéutica privada para la I+D de nuevos medicamentos Incentives and disincentives for research and development of new drugs by the pharmaceutical industry

Directory of Open Access Journals (Sweden)

Pasqualina Curcio Curcio

2008-10-01

Full Text Available En el trabajo se desarrolló un modelo con los factores que influyen sobre la decisión de I+D de la industria farmacéutica. Los factores son el riesgo de contagio y la posibilidad de controlarlo; la letalidad y la presencia de curas o tratamientos; el ingreso; el número de personas que demandan y los costos de oportunidad de la empresa. Las empresas invertirán en mercados con demandas más inelásticas (enfermedades muy contagiosas sin posibilidad de controlar la transmisión y/o muy letales sin curas o tratamientos y/o donde los demandantes tienen elevados ingresos y/o son numerosos. No invertirá en mercados donde sus costos marginales son superiores a sus ingresos marginales, particularmente cuando sus costos incrementan permanentemente como consecuencia del aumento del costo de oportunidad generado por lo que dejaría de ganar en otros mercados. Para estos casos, las políticas de subsidio de la I+D no son efectivas, por lo tanto, éstas deben orientarse al fortalecimiento de las investigaciones, tanto básica como aplicada, realizadas por las instituciones públicas o sin fines de lucro.The authors present a model with factors that influence research and development decisions by the pharmaceutical industry: risk of disease transmission and possibility of control; case-fatality and the presence of cure or treatments; income; number of persons who demand the medicine; and opportunity costs for the company. Companies tend to invest in markets with inelastic demand (highly contagious diseases with no possibility of controlling transmission and/or very lethal diseases without treatment and/or where there is a large population or high per capita income. Companies tend not to invest in markets where marginal costs exceed marginal income, particularly when costs increase permanently as a consequence of rising opportunity costs generated by foregoing profit in other markets. In such cases, policies to subsidize R&D are not effective, and

Fc receptor gamma subunit polymorphisms and systemic lupus erythematosus

International Nuclear Information System (INIS)

Al-Ansari, Aliya; Ollier, W.E.; Gonzalez-Gay, Miguel A.; Gul, Ahmet; Inanac, Murat; Ordi, Jose; Teh, Lee-Suan; Hajeer, Ali H.

2004-01-01

To investigate the possible association between Fc receptor gamma polymorphisms and systemic lupus erythematosus (SLE). We have investigated the full FcR gamma gene for polymorphisms using polymerase chain reaction (PCR)-single strand confirmational polymorphisms and DNA sequencing .The polymorphisms identified were genotype using PCR-restriction fragment length polymorphism. Systemic lupus erythematosus cases and controls were available from 3 ethnic groups: Turkish, Spanish and Caucasian. The study was conducted in the year 2001 at the Arthritis Research Campaign, Epidemiology Unit, Manchester University Medical School, Manchester, United Kingdom. Five single nucleotide polymorphisms were identified, 2 in the promoter, one in intron 4 and, 2 in the 3'UTR. Four of the 5 single nucleotide polymorphisms (SNPs) were relatively common and investigated in the 3 populations. Allele and genotype frequencies of all 4 investigated SNPs were not statistically different cases and controls. fc receptor gamma gene does not appear to contribute to SLE susceptibility. The identified polymorphisms may be useful in investigating other diseases where receptors containing the FcR gamma subunit contribute to the pathology. (author)

Nestor Capdevila, Le concept d’idéologie, Paris, PUF, 2004, 326 pages, 25 euros.

Directory of Open Access Journals (Sweden)

Marie GAILLE-NIKODIMOV

2005-09-01

Full Text Available Que la philosophie puisse se pratiquer dans toute sa rigueur conceptuelle en s’appliquant à des notions politiques, voilà qui n’a pas été et n’est pas toujours évident pour tous. Le concept d’idéologie de Nestor Capdevila est une lecture tout indiquée pour les sceptiques. Le pari n’est pourtant pas gagné a priori : ce terme, forgé en 1798 par Destutt de Tracy pour désigner la science des idées prises au sens général de perceptions, est on ne peut plus fuyant. S’il n’a pas, à l’origine, la con...

Rapid polyclonal desensitization with antibodies to IgE and FcεRIα.

Science.gov (United States)

Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Lewkowich, Ian; Morris, Suzanne C; Finkelman, Fred D

2013-06-01

Rapid desensitization, a procedure in which persons allergic to an antigen are treated at short intervals with increasing doses of that antigen until they tolerate a large dose, is an effective, but risky, way to induce temporary tolerance. We wanted to determine whether this approach can be adapted to suppress all IgE-mediated allergies in mice by injecting serially increasing doses of monoclonal antibodies (mAbs) to IgE or FcεRIα. Active and passive models of antigen- and anti-IgE mAb-induced IgE-mediated anaphylaxis were used. Mice were desensitized with serially increasing doses of anti-IgE mAb, anti-FcεRIα mAb, or antigen. Development of shock (hypothermia), histamine and mast cell protease release, cytokine secretion, calcium flux, and changes in cell number and FcεRI and IgE expression were evaluated. Rapid desensitization with anti-IgE mAb suppressed IgE-mediated immediate hypersensitivity; however, some mice developed mild anaphylaxis during desensitization. Rapid desensitization with anti-FcεRIα mAb that only binds FcεRI that is not occupied by IgE suppressed both active and passive IgE-mediated anaphylaxis without inducing disease. It quickly, but temporarily, suppressed IgE-mediated anaphylaxis by decreasing mast cell signaling through FcεRI, then slowly induced longer lasting mast cell unresponsiveness by removing membrane FcεRI. Rapid desensitization with anti-FcεRIα mAb was safer and longer lasting than rapid desensitization with antigen. A rapid desensitization approach with anti-FcεRIα mAb safely desensitizes mice to IgE-mediated anaphylaxis by inducing mast cell anergy and later removing all mast cell IgE. Rapid desensitization with an anti-human FcεRIα mAb may be able to prevent human IgE-mediated anaphylaxis. Copyright © 2013 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.

Análisis de crecimiento y absorción de nutrimentos de frutos de mango, cultivares Tommy Atkins y Keith

Directory of Open Access Journals (Sweden)

Róger Fallas

2010-01-01

y se detalla información para adaptarlas a diferentes localidades. Se determinó que cada kg de fruta fresca de Tommy Atkins y Keith, respectivamente, consume 1,54 y 1,59 g de K; 1,07 y 1,06 g de N; 0,20 y 0,12 g de P; 0,29 y 0,14 g de Ca; 0,19 y 0,15 g de Mg; 0,07 y 0,09 g de S; 8,5 y 2,5 mg de Fe; 3,5 y 2,1 mg de Mn; 0,7 y 1,6 mg de B; 1,2 y 0,97 mg de Zn; y 1,1 y 0,9 mg de Cu. Se sugieren etapas adecuadas para realizar fertilizaciones foliares y se encontró que algunos elementos no deben aplicarse simultáneamente, por posibles antagonismos. Para obtener frutos de Tommy Atkins con peso fresco entre 400 y 500 g se debe cosechar cuando el diámetro fluctúe entre 8,7 y 9,0 cm, o el largo entre 10,7 y 11,2 cm. Para obtener frutos de Keith con un peso entre 600 y 750 g, se debe colectar cuando el diámetro varíe entre 9,4 y 9,8 cm o el largo entre 13,5 y 14,0 cm, según el análisis de regresión.

Suplementação oral de L-carnitina associada ao treinamento físico e muscular respiratório na doença pulmonar obstrutiva crônica: estudo preliminar Oral supplementation of L-carnitine combined with exercise and respiratory training in patients with chronic obstructive pulmonary disease: preliminary study

Directory of Open Access Journals (Sweden)

Matheus Guedes Fernandes Silva

2012-12-01

Full Text Available Avaliar os efeitos da suplementação oral de L-carnitina associada ao treinamento físico e muscular respiratório na doença pulmonar obstrutiva crônica (DPOC. Participaram 14 voluntários com idade de 65±10,4 anos e diagnóstico clínico de DPOC moderado, classificados de acordo com a espirometria prévia. Os voluntários foram divididos em grupo treino esteira (GTE e grupo treino muscular respiratório (GTMR. Realizaram o teste de caminhada de seis minutos (TC6', teste de caminhada com carga progressiva (TCP, avaliação nutricional do índice de massa corpórea (IMC, dose diária recomendada de L-carnitina, pressões inspiratórias (PImáx e expiratórias máximas (PEmáx. Fizeram 30 min de caminhada em esteira, 3 vezes/semana por 10 semanas, e o GTMR realizou, ainda, 10 min de treinamento muscular inspiratório (Threshold® IMT e 10 min de treinamento muscular expiratório (Threshold® PEP à 50% da PImáx e PEmáx ajustados semanalmente. Após 10 semanas, foram reavaliados. No TC6' pré e pós-programa de treinamento físico, as variáveis alteradas foram: distância percorrida (DP, frequência cardíaca (FC final, pressão arterial sistólica (PAS final, pressão arterial diastólica (PAD final e Borg final no GTMR, no GTE as variáveis alteradas foram FC repouso, FC final, PAS final, Borg repouso e DP. Comparando os grupos no TC6, o GTE apresentou FC final, PAD final e Borg final maiores do que o GTMR na reavaliação; já no TCP, a FC final, PAS final, Borg final foram maiores no GTE, e DP foi maior no GTMR. Na avaliação respiratória, a PEmáx foi maior no GTMR na reavaliação. O treino aeróbio e suplementação de L-carnitina na DPOC otimizou a performance, a capacidade física e a tolerância ao esforço.To evaluate the effects of oral supplementation of L-carnitine associated with physical and respiratory muscles training in chronic obstructive pulmonary disease (COPD. Participated 14 COPD volunteers (65±10.4 years, divided

Enhanced antibody-dependent cellular phagocytosis by chimeric monoclonal antibodies with tandemly repeated Fc domains.

Science.gov (United States)

Nagashima, Hiroaki; Ootsubo, Michiko; Fukazawa, Mizuki; Motoi, Sotaro; Konakahara, Shu; Masuho, Yasuhiko

2011-04-01

We previously reported that chimeric monoclonal antibodies (mAbs) with tandemly repeated Fc domains, which were developed by introducing tandem repeats of Fc domains downstream of 2 Fab domains, augmented binding avidities for all Fcγ receptors, resulting in enhanced antibody (Ab)-dependent cellular cytotoxicity. Here we investigated regarding Ab-dependent cellular phagocytosis (ADCP) mediated by these chimeric mAbs, which is considered one of the most important mechanisms that kills tumor cells, using two-color flow cytometric methods. ADCP mediated by T3-Ab, a chimeric mAb with 3 tandemly repeated Fc domains, was 5 times more potent than that by native anti-CD20 M-Ab (M-Ab hereafter). Furthermore, T3-Ab-mediated ADCP was resistant to competitive inhibition by intravenous Ig (IVIG), although M-Ab-mediated ADCP decreased in the presence of IVIG. An Fcγ receptor-blocking study demonstrated that T3-Ab mediated ADCP via both FcγRIA and FcγRIIA, whereas M-Ab mediated ADCP exclusively via FcγRIA. These results suggest that chimeric mAbs with tandemly repeated Fc domains enhance ADCP as well as ADCC, and that Fc multimerization may significantly enhance the efficacy of therapeutic Abs. Copyright © 2010 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

FcεRI γ-Chain Negatively Modulates Dectin-1 Responses in Dendritic Cells

Directory of Open Access Journals (Sweden)

Yi-Gen Pan

2017-10-01

Full Text Available The inhibitory effect of immunoreceptor tyrosine-based activation motif (ITAM-containing adapters DAP12 and FcεRI γ-chain (FcRγ has been found in many immune functions. Herein, we have further explored the role of these adapters in C-type lectin receptors response. We identified that FcRγ, but not DAP12, could negatively regulate the Dectin-1 responses in dendritic cells (DCs. Loss of FcRγ or both DAP12 and FcRγ enhanced the maturation and cytokine production in DCs upon Dectin-1 activation compared to normal cells, whereas DCs lacking only DAP12 showed little changes. In addition, increments of T cell activation and T helper 17 polarization induced by FcRγ-deficient DCs were observed both in vitro and in vivo. Examining the Dectin-1 signaling, we revealed that the activations of several signaling molecules were augmented in FcRγ-deficient DCs stimulated with Dectin-1 ligands. Furthermore, we demonstrated that the association of phosphatases SHP-1 and PTEN with FcRγ may contribute to the negative regulation of FcRγ in Dectin-1 activation in DCs. These results extend the inhibitory effect of ITAM-containing adapters to Dectin-1 response in immune functions, even though Dectin-1 contains an ITAM-like intracellular domain. According to the role of Dectin-1 in responding to microbes and tumor cells, our finding may have applications in the development of vaccine and cancer therapy.

Genetic characterization of Venezuelan equine encephalitis virus from Bolivia, Ecuador and Peru: identification of a new subtype ID lineage.

Science.gov (United States)

Aguilar, Patricia V; Adams, A Paige; Suárez, Victor; Beingolea, Luis; Vargas, Jorge; Manock, Stephen; Freire, Juan; Espinoza, Willan R; Felices, Vidal; Diaz, Ana; Liang, Xiaodong; Roca, Yelin; Weaver, Scott C; Kochel, Tadeusz J

2009-09-15

Venezuelan equine encephalitis virus (VEEV) has been responsible for hundreds of thousands of human and equine cases of severe disease in the Americas. A passive surveillance study was conducted in Peru, Bolivia and Ecuador to determine the arboviral etiology of febrile illness. Patients with suspected viral-associated, acute, undifferentiated febrile illness of Peru, and more recently (2005), in Madre de Dios, Peru. We performed phylogenetic analyses with VEEV from Bolivia, Ecuador and Peru and compared their relationships to strains from other parts of South America. We found that VEEV subtype ID Panama/Peru genotype is the predominant one circulating in Peru. We also demonstrated that VEEV subtype ID strains circulating in Ecuador belong to the Colombia/Venezuela genotype and VEEV from Madre de Dios, Peru and Cochabamba, Bolivia belong to a new ID genotype. In summary, we identified a new major lineage of enzootic VEEV subtype ID, information that could aid in the understanding of the emergence and evolution of VEEV in South America.

Building Stronger State Energy Partnerships with the U.S. Department of Energy

Energy Technology Data Exchange (ETDEWEB)

Marks, Kate

2011-09-30

This final technical report details the results of total work efforts and progress made from October 2007 – September 2011 under the National Association of State Energy Officials (NASEO) cooperative agreement DE-FC26-07NT43264, Building Stronger State Energy Partnerships with the U.S. Department of Energy. Major topical project areas in this final report include work efforts in the following areas: Energy Assurance and Critical Infrastructure, State and Regional Technical Assistance, Regional Initiative, Regional Coordination and Technical Assistance, and International Activities in China. All required deliverables have been provided to the National Energy Technology Laboratory and DOE program officials.

Chicken IgY Fc expressed by Eimeria mitis enhances the immunogenicity of E. mitis.

Science.gov (United States)

Qin, Mei; Tang, Xinming; Yin, Guangwen; Liu, Xianyong; Suo, Jingxia; Tao, Geru; Ei-Ashram, Saeed; Li, Yuan; Suo, Xun

2016-03-21

Eimeria species are obligate intracellular apicomplexan parasites, causing great economic losses in the poultry industry. Currently wild-and attenuated- type anticoccidial vaccines are used to control coccidiosis. However, their use in fast growing broilers is limited by vaccination side effects caused by medium and/or low immunogenic Eimeria spp. There is, therefore, a need for a vaccine with high immunogenicity for broilers. The avian yolk sac IgY Fc is the avian counterpart of the mammalian IgG Fc, which enhances immunogenicity of Fc-fusion proteins. Here, we developed a stable transgenic Eimeria mitis expressing IgY Fc (Emi.chFc) and investigated whether the avian IgY Fc fragment enhances the immunogenicity of E. mitis. Two-week-old broilers were immunized with either Emi.chFc or wild type Eimeria and challenged with wild type E. mitis to analyze the protective properties of transgenic Emi.chFc. Chickens immunized with Emi.chFc had significantly lower oocyst output, in comparison with PBS, mock control (transgenic E. mitis expressing HA1 from H9N2 avian influenza virus) and wildtype E. mitis immunized groups after challenge, indicating that IgY Fc enhanced the immunogenicity of E. mitis. Our findings suggest that IgY Fc-expressing Eimeria may be a better coccidiosis vaccine, and transgenic Eimeria expressing Fc-fused exogenous antigens may be used as a novel vaccine-delivery vehicle against a wide variety of pathogens.

Tinjauan Desain Website Kemlu.Go.Id

OpenAIRE

Danu Widhyatmoko

2013-01-01

Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...

Effects of altered FcγR binding on antibody pharmacokinetics in cynomolgus monkeys

Science.gov (United States)

Leabman, Maya K; Meng, Y Gloria; Kelley, Robert F; DeForge, Laura E; Cowan, Kyra J; Iyer, Suhasini

2013-01-01

Antibody interactions with Fcγ receptors (FcγRs), like FcγRIIIA, play a critical role in mediating antibody effector functions and thereby contribute significantly to the biologic and therapeutic activity of antibodies. Over the past decade, considerable work has been directed towards production of antibodies with altered binding affinity to FcγRs and evaluation of how the alterations modulate their therapeutic activity. This has been achieved by altering glycosylation status at N297 or by engineering modifications in the crystallizable fragment (Fc) region. While the effects of these modifications on biologic activity and efficacy have been examined, few studies have been conducted to understand their effect on antibody pharmacokinetics (PK). We present here a retrospective analysis in which we characterize the PK of three antibody variants with decreased FcγR binding affinity caused by amino acid substitutions in the Fc region (N297A, N297G, and L234A/L235A) and three antibody variants with increased FcγRIIIA binding affinity caused by afucosylation at N297, and compare their PK to corresponding wild type antibody PK in cynomolgus monkeys. For all antibodies, PK was examined at a dose that was known to be in the linear range. Since production of the N297A and N297G variants in Chinese hamster ovary cells results in aglycosylated antibodies that do not bind to FcγRs, we also examined the effect of expression of an aglycosylated antibody, without sequence change(s), in E. coli. All the variants demonstrated similar PK compared with that of the wild type antibodies, suggesting that, for the six antibodies presented here, altered FcγR binding affinity does not affect PK. PMID:24492343

A intersubjetividade no contexto da família de pessoas com fibrose cística

Directory of Open Access Journals (Sweden)

Geisa Santos Luz

2012-04-01

Full Text Available Trata-se de uma investigação qualitativa, com aproximação fenomenológica, que objetivou desvelar os processos intersubjetivos no contexto da família de pessoas com Fibrose Cística (FC. Desenvolveu-se entrevista com 14 famílias com portadores de FC, cadastrados na Associação Paranaense de Assistência à Mucoviscidose (AAMPR, residentes nas regiões Norte e Noroeste do estado do Paraná (PR, Brasil. Das suas falas foram apreendidas unidades de significado, agrupadas em três categorias: Família, portador de FC e o outro; Aspectos religiosos na vivência da FC na família; Portador de FC na vida escolar, afetiva e profissional. Os resultados evidenciaram que a experiência das famílias compartilhada com o outro foi crucial para o enfrentamento da doença. Conhecer os processos intersubjetivos que perpassam o âmago da família de pessoas acometidas pela FC possibilita um novo modo de atuar em Enfermagem.

Avaliação da remoção de cromo (III por materiais compósitos porosos adsorventes de PE-g-MA, fibra de coco e quitosana, usando planejamento experimental

Directory of Open Access Journals (Sweden)

Dilma Alves Costa

2017-04-01

Full Text Available RESUMO Os processos de adsorção podem ser empregados no tratamento de efluentes líquidos contendo metais pesados visando a reduzir os danos ambientais. Porém, o alto custo dos materiais adsorventes justifica a aplicação de adsorventes alternativos, como a fibra de coco (FC e a quitosana (Q. Assim, este trabalho teve como objetivo desenvolver compósitos porosos adsorventes a partir da mistura de polietileno graftizado com anidrido maleico/FC/Q/NaCl, como agente porogênico (PE-g-MA/FC/Q/NaCl, e avaliar estatisticamente a capacidade de adsorção do cromo (III em solução, com auxílio do software Statistica 5.0®. Os resultados mostraram que a eficiência do processo sofreu influência das dimensões da FC, do teor de Q e do pH da solução contendo Cr (III. A capacidade máxima de remoção de Cr (III por unidade de massa do compósito foi de 42,28 mg.g-1.

Tinjauan Desain Website Kemlu.Go.Id

Directory of Open Access Journals (Sweden)

Danu Widhyatmoko

2013-04-01

Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.  

Comercialização no ensino superior: é possível manter a idéia de bem público?

Directory of Open Access Journals (Sweden)

Dias Marco Antonio Rodrigues

2003-01-01

Full Text Available O autor, um dos promotores do debate no Brasil sobre o impacto na educação de medidas tomadas pela OMC, indaga se é possível manter a idéia de que o ensino superior é um bem público preconizada pela Conferência Mundial sobre o Ensino Superior, em Paris, em 1998. A comunidade acadêmica perdeu a oportunidade de reagir eficazmente, quando, em 1994, foi aprovado o Acordo Geral sobre Comércio e Serviços (AGCS. No entanto, a existência de provedores privados não torna um serviço comercial. Persistem as figuras da concessão, delegação ou autorização, mantidos, sob regulamentação, os princípios básicos que protegem os bens públicos. Na OMC, os países anglo-saxônicos agem de forma incoerente, mantendo fechadas as portas que pedem aos demais para abrir. O grande perigo, no momento, está na tentativa de se criar um sistema internacional de acreditação, sem participação da América Latina.

Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge

Science.gov (United States)

Konduru, Krishnamurthy; Shurtleff, Amy C.; Bradfute, Steven B.; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

2016-01-01

Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105−106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

Science.gov (United States)

Konduru, Krishnamurthy; Shurtleff, Amy C; Bradfute, Steven B; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

2016-01-01

Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

Directory of Open Access Journals (Sweden)

Krishnamurthy Konduru

Full Text Available Ebola virus (EBOV, a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data

Idékatalog Appetit på maden

DEFF Research Database (Denmark)

Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie

2015-01-01

Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....

A strategy for bacterial production of a soluble functional human neonatal Fc receptor

DEFF Research Database (Denmark)

Andersen, Jan Terje; Justesen, Sune; Berntzen, Gøril

2008-01-01

The major histocompatibility complex (MHC) class I related receptor, the neonatal Fc receptor (FcRn), rescues immunoglobulin G (IgG) and albumin from lysosomal degradation by recycling in endothelial cells. FcRn also contributes to passive immunity by mediating transport of IgG from mother to fetus...

Alimentação de juvenis de carpa capim com dietas à base de farelos vegetais e forragem - doi: 10.4025/actascianimsci.v32i3.9052 Feeding grass carp juveniles with plant-protein diets and forage - doi: 10.4025/actascianimsci.v32i3.9052

Directory of Open Access Journals (Sweden)

Fernando Strohschein Maschke

2010-09-01

Full Text Available Para avaliar o potencial dos ingredientes de origem vegetal como substitutos da farinha de carne suína em dietas para Ctenopharyngodon idella Valenciennes, (1844 (carpa capim, 180 juvenis (15 por tanque foram criados durante 60 dias em sistema de recirculação de água. Foi avaliada a substituição da farinha de carne suína (FCS por farelo de canola (FC, farelo de girassol (FG e a mistura dos farelos de canola e girassol (FCG. As dietas também continham farelo de soja como fonte proteica. O consumo diário de forragem (1,24 a 2,11% do peso vivo não diferiu entre os tratamentos. Peso final, ganho em peso, taxa de crescimento específico e conversão alimentar aparente não diferiram estatisticamente entre as dietas. O rendimento de filé foi maior nos tratamentos FC e FCG, enquanto o índice digestivossomático foi maior nos tratamentos FG e FCG. Maior teor de gordura e menores teores de proteína no peixe inteiro e de cinzas no filé foram obtidos no tratamento FCG. Os filés dos tratamentos FCS e FCG apresentaram maior valor de luminosidade. Os peixes da dieta FCS apresentaram maiores valores de proteínas, triglicerídeos e colesterol total no soro. Conclui-se que os farelos de canola e girassol podem ser utilizados em dietas para recria da carpa capim.To evaluate the potential of plant-protein sources to replace porcine meat meal in diets for grass carp juveniles, 180 fish (15 per tank were reared for 60 days in a re-use water system. We evaluated the replacement of porcine meat meal (FCS for canola meal (FC, sunflower meal (FG or a mixture of canola and sunflower meal (FCG. The diets were also composed of soybean meal as a protein source. Daily forage intake ranged from 1.24 to 2.11% body weight and did not differ among treatments. Final weight, weight gain, specific growth rate and feed conversion rate did not differ statistically among diets. The fillet yield was higher in FC and FCG diets, while the digestive-somatic index was

The metalloid arsenite induces nuclear export of Id3 possibly via binding to the N-terminal cysteine residues

International Nuclear Information System (INIS)

Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi

2013-01-01

Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite

Supervisory control system based on PC applied to substations automatization of and to regional operation centers of distribution networks; Sistema de control supervisorio basado en PC aplicado en automatizacion de subestaciones y centros de operacion regional de redes de distribucion