Chemistry of berkelium: a review
International Nuclear Information System (INIS)
Hobart, D.E.; Peterson, J.R.
1985-01-01
Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity
Berkelium (4) and cerium (4) extraction with tertiary amines
International Nuclear Information System (INIS)
Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.
1978-01-01
Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Department of Defense DD Form 254, Contract Security Classification Specification. 53.303-DD-254 Section 53.303-DD-254 Federal... Illustrations of Forms 53.303-DD-254 Department of Defense DD Form 254, Contract Security Classification...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK254 (Link to dictyBase) - - - Contig-U16260-1 VHK254P (Link to Original site) VHK2...54F 616 VHK254Z 744 VHK254P 1340 - - Show VHK254 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK254Q.Seq.d/ Representative seq. ID VHK2...54P (Link to Original site) Representative DNA sequence >VHK254 (VHK254Q) /CSM/VH/VHK2-C/VHK2...BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3' ... 1455 0.0 1 ( BJ446732 ) Dictyostelium discoi
7 CFR 254.1 - General purpose.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose. 254.1 Section 254.1 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.1 General purpose. This part sets the requirement under which...
20 CFR 632.254 - Program startup.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program startup. 632.254 Section 632.254 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.254 Program startup...
27 CFR 44.254 - Shipping containers.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Definitions. 254.2 Section 254.2 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... (25 CFR part 81 et. seq.). (b) FNS service area means the areas over which FNS has approved the food...
4 CFR 25.4 - Preservation of property.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Preservation of property. 25.4 Section 25.4 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.4 Preservation of property. The improper disposal of rubbish in the GAO...
36 CFR 254.42 - Valuation of tracts.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Valuation of tracts. 254.42 Section 254.42 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.42 Valuation of tracts. (a) Approximately equal value shall be...
36 CFR 254.10 - Bargaining; arbitration.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bargaining; arbitration. 254.10 Section 254.10 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... determine values. Bargaining or any other process must be based on an objective analysis of the valuation in...
29 CFR 1910.254 - Arc welding and cutting.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Arc welding and cutting. 1910.254 Section 1910.254 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.254 Arc welding and cutting. (a... following limits shall not be exceeded: (i) Alternating-current machines (A) Manual arc welding and cutting...
36 CFR 254.6 - Segregative effect.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Segregative effect. 254.6... ADJUSTMENTS Land Exchanges § 254.6 Segregative effect. (a) If a proposal is made to exchange Federal lands... segregative effect terminates as follows: (1) Automatically, upon issuance of a patent or other document of...
7 CFR 254.4 - Application by an ITO.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Application by an ITO. 254.4 Section 254.4 Agriculture... INDIAN HOUSEHOLDS IN OKLAHOMA § 254.4 Application by an ITO. (a) Application to FNS Regional Office. An ITO which desires to participate in the Food Distribution Program shall file an application with the...
7 CFR 254.3 - Administration by an ITO.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration by an ITO. 254.3 Section 254.3... FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.3 Administration by an ITO. (a) Applicability of part 253. All... any claim and to settle and adjust any claim against an ITO. (d) ITO administration. The ITO, acting...
36 CFR 254.11 - Exchanges at approximately equal value.
2010-07-01
... equal value. 254.11 Section 254.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.11 Exchanges at approximately equal value. (a) The authorized officer may exchange lands which are of approximately equal value upon a determination that: (1...
36 CFR 254.4 - Agreement to initiate an exchange.
2010-07-01
... exchange. 254.4 Section 254.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.4 Agreement to initiate an exchange. (a) Exchanges may be proposed by the Forest Service or by any person, State, or local government. Initial exchange proposals...
40 CFR 52.254 - Organic solvent usage.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Organic solvent usage. 52.254 Section...) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.254 Organic solvent usage. (a) This... (d) of this section and the architectural coatings and solvent disposal emission limitations...
36 CFR 254.34 - Mineral survey fractions.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Mineral survey fractions. 254... LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.34 Mineral survey fractions. (a) Mineral survey fractions subject to conveyance under this subpart are limited to those tracts which: (1) Cannot be...
30 CFR 254.41 - Training your response personnel.
2010-07-01
... procedures; (3) Oil-spill trajectory analysis and predicting spill movement; and (4) Any other... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Training your response personnel. 254.41 Section 254.41 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL...
47 CFR 1.254 - Nature of the hearing; burden of proof.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Nature of the hearing; burden of proof. 1.254 Section 1.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Hearing Proceedings Hearing and Intermediate Decision § 1.254 Nature of the hearing; burden of proof. Any hearing upon...
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254... greatest extent practicable, adverse impacts on marine mammal species and stocks and their habitats. When...
Susceptibility to Stress Corrosion Cracking of 254SMO SS
Directory of Open Access Journals (Sweden)
De Micheli Lorenzo
2002-01-01
Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.
Koika, Vasiliki; Varnavas, Petros; Valavani, Helen; Sidis, Yisrael; Plummer, Lacey; Dwyer, Andrew; Quinton, Richard; Kanaka-Gantenbein, Christine; Pitteloud, Nelly; Sertedaki, Amalia; Dacou-Voutetakis, Catherine; Georgopoulos, Neoklis A
2013-03-01
FGFR1 mutations have been identified in both Kallmann syndrome and normosmic HH (nIHH). To date, few mutations in the FGFR1 gene have been structurally or functionally characterized in vitro to identify molecular mechanisms that contribute to the disease pathogenesis. We attempted to define the in vitro functionality of two FGFR1 mutants (R254W and R254Q), resulting from two different amino acid substitutions of the same residue, and to correlate the in vitro findings to the patient phenotypes. Two unrelated GnRH deficient probands were found to harbor mutations in FGFR1 (R254W and R254Q). Mutant signaling activity and expression levels were evaluated in vitro and compared to a wild type (WT) receptor. Signaling activity was determined by a FGF2/FGFR1 dependent transcription reporter assay. Receptor total expression levels were assessed by Western blot and cell surface expression was measured by a radiolabeled antibody binding assay. The R254W maximal receptor signaling capacity was reduced by 45% (p<0.01) while R254Q activity was not different from WT. However, both mutants displayed diminished total protein expression levels (40 and 30% reduction relative to WT, respectively), while protein maturation was unaffected. Accordingly, cell surface expression levels of the mutant receptors were also significantly reduced (35% p<0.01 and 15% p<0.05, respectively). The p.R254W and p.R254Q are both loss-of-function mutations as demonstrated by their reduced overall and cell surface expression levels suggesting a deleterious effect on receptor folding and stability. It appears that a tryptophan substitution at R254 is more disruptive to receptor structure than the more conserved glutamine substitution. No clear correlation between the severity of in vitro loss-of-function and phenotypic presentation could be assigned. Copyright © 2012 Elsevier B.V. All rights reserved.
37 CFR 2.54 - Requirements for drawings submitted on paper.
2010-07-01
... submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... drawings submitted on paper. The drawing must meet the requirements of § 2.52. In addition, in a paper submission, the drawing should: (a) Be on non-shiny white paper that is separate from the application; (b) Be...
cdc-25.4, a Caenorhabditis elegans Ortholog of cdc25, Is Required for Male Mating Behavior
Directory of Open Access Journals (Sweden)
Sangmi Oh
2016-12-01
Full Text Available Cell division cycle 25 (cdc25 is an evolutionarily conserved phosphatase that promotes cell cycle progression. Among the four cdc25 orthologs in Caenorhabditis elegans, we found that cdc-25.4 mutant males failed to produce outcrossed progeny. This was not caused by defects in sperm development, but by defects in male mating behavior. The cdc-25.4 mutant males showed various defects during male mating, including contact response, backing, turning, and vulva location. Aberrant turning behavior was the most prominent defect in the cdc-25.4 mutant males. We also found that cdc-25.4 is expressed in many neuronal cells throughout development. The turning defect in cdc-25.4 mutant males was recovered by cdc-25.4 transgenic expression in neuronal cells, suggesting that cdc-25.4 functions in neurons for male mating. However, the neuronal morphology of cdc-25.4 mutant males appeared to be normal, as examined with several neuronal markers. Also, RNAi depletion of wee-1.3, a C. elegans ortholog of Wee1/Myt1 kinase, failed to suppress the mating defects of cdc-25.4 mutant males. These findings suggest that, for successful male mating, cdc-25.4 does not target cell cycles that are required for neuronal differentiation and development. Rather, cdc-25.4 likely regulates noncanonical substrates in neuronal cells.
High transfer cross sections from reactions with 254Es
International Nuclear Information System (INIS)
Schaedel, M.; Bruechle, W.; Bruegger, M.; Gaeggeler, H.; Moody, J.; Schardt, D.; Suemmerer, K.; Hulet, E.K.; Dougan, A.D.; Dougan, R.J.; Landrum, J.H.; Lougheed, R.W.; Wild, J.F.; O'Kelly, G.D.
1985-08-01
We report radiochemically determined cross sections for the heaviest known actinides produced in transfer reactions of 101 MeV 16 O, 98 MeV 18 O and 127 MeV 22 Ne with 254 Es as a target. A comparison with data for similar transfers from 248 Cm targets is made. Transfer cross sections are extrapolated for the production of unknown, neutron-rich isotopes of elements 101 through 105, and the unique potential of 254 Es as a target to make these exotic nuclei accessible is demonstrated. (orig.)
36 CFR 254.15 - Title standards.
2010-07-01
...) Conveyances of lands from the United States are made by patent, quitclaim deed, or deed and without express or implied warranties, except as to hazardous substances pursuant to § 254.3 of this subpart. (c) Title... of the existing use(s) authorized under the terms of the grant, permit, easement, or lease. The non...
Structure and formation mechanism of the transfermium isotope 254No
International Nuclear Information System (INIS)
Reiter, P.
1998-01-01
The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, β = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin
17 CFR 230.254 - Solicitation of interest document for use prior to an offering statement.
2010-04-01
... subject to the antifraud provisions of the federal securities laws. No solicitation or acceptance of money... document for use prior to an offering statement. 230.254 Section 230.254 Commodity and Securities Exchanges...-Conditional Small Issues Exemption § 230.254 Solicitation of interest document for use prior to an offering...
de Oliveira, Dirce Martins; Cavalcante, Rodrigo Pereira; da Silva, Lucas de Melo; Sans, Carme; Esplugas, Santiago; de Oliveira, Silvio Cesar; Junior, Amilcar Machulek
2018-02-09
This paper reports the degradation of 10 mg L -1 Ametryn solution with different advanced oxidation processes and by ultraviolet (UV 254 ) irradiation alone with the main objective of reducing acute toxicity and increase biodegradability. The investigated factors included Fe 2+ and H 2 O 2 concentrations. The effectiveness of the UV 254 and UV 254 /H 2 O 2 processes were investigated using a low-pressure mercury UV lamp (254 nm). Photo-Fenton process was explored using a blacklight blue lamp (BLB, λ = 365 nm). The UV 254 irradiation process achieved complete degradation of Ametryn solution after 60 min. The degradation time of Ametryn was greatly improved by the addition of H 2 O 2 . It is worth pointing out that a high rate of Ametryn removal was attained even at low concentrations of H 2 O 2 . The kinetic constant of the reaction between Ametryn and HO ● for UV 254 /H 2 O 2 was 3.53 × 10 8 L mol -1 s -1 . The complete Ametryn degradation by the Fenton and photo-Fenton processes was observed following 10 min of reaction for various combinations of Fe 2+ and H 2 O 2 under investigation. Working with the highest concentration (150 mg L -1 H 2 O 2 and 10 mg L -1 Fe 2+ ), around 30 and 70% of TOC removal were reached within 120 min of treatment by Fenton and photo-Fenton processes, respectively. Although it did not obtain complete mineralization, the intermediates formed in the degradation processes were hydroxylated and did not promote acute toxicity of Vibrio fischeri. Furthermore, a substantial improvement of biodegradability was obtained for all studied processes.
24 CFR 221.254 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... Cost Homes § 221.254 Mortgage insurance premiums. (a) All of the provisions of §§ 203.260 through 203.295 of this chapter relating to mortgage insurance premiums shall apply to mortgages insured under...
40 CFR 264.254 - Monitoring and inspection.
2010-07-01
... Waste Piles § 264.254 Monitoring and inspection. (a) During construction or installation, liners (except in the case of existing portions of piles exempt from § 264.251(a)) and cover systems (e.g... increase in the permeability of the liner or cover. (b) While a waste pile is in operation, it must be...
48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).
2010-10-01
... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)), Contract...
Structure and formation mechanism of the transfermium isotope {sup 254}No.
Energy Technology Data Exchange (ETDEWEB)
Reiter, P.
1998-12-17
The ground-state band of the Z=102 isotope {sup 254}No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, {beta} = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of {sup 254}No up to spin 14 means that its fission barrier persists at least up to that spin.
36 CFR 254.33 - Road rights-of-way.
2010-07-01
... parcels subject to conveyance under this subpart are limited to those which are substantially surrounded by lands not owned by the United States. (b) Forest Service officials shall consider public road... Section 254.33 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP...
75 FR 18047 - Amendment of Low Altitude Area Navigation Route T-254; Houston, TX
2010-04-09
...-254; Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends low altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by... Houston, TX, terminal area. DATES: Effective Dates: 0901 UTC, June 3, 2010. The Director of the Federal...
In-beam spectroscopy of 253,254No
International Nuclear Information System (INIS)
Herzberg, R.D.; Amzal, N.; Bastin, J.E.; Brew, P.M.T.; Butler, P.A.; Chewter, A.J.C.; Hammond, N.J.; Humphreys, R.D.; Jones, G.D.; Becker, F.; Hauschild, K.; Houry, M.; Huerstel, A.; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Eskola, K.; Gerl, J.; Hessberger, F.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Khoo, T.L.; Korten, W.; Kuusiniemi, P.; Le Coz, Y.; Leino, M.; Leppaenen, C.J.; Lister, A.P.; Lucas, R.; Muikku, M.; Nieminen, P.; Page, R.D.; Page, T.; Rahkila, P.; Reiter, P.; Schlegel, Ch.; Scholey, C.; Sletten, G.; Stezowski, O.; Theisen, Ch.; Trzaska, W.H.; Uusitalo, J.; Wollersheim, H.J.
2002-01-01
In-beam conversion electron spectroscopy experiments have been performed on the transfermium nuclei 253, 254 No using the conversion electron spectrometer SACRED in nearly collinear geometry in conjunction with the gas-filled separator RITU at the University of Jyvaeskylae. The experimental setup is discussed and the spectra are compared to Monte Carlo simulations. The implications for the ground-state configuration of 253 No are discussed. (orig.)
Ground-State Band and Deformation of the Z = 102 Isotope N 254
International Nuclear Information System (INIS)
Reiter, P.; Khoo, T.L.; Lister, C.J.; Seweryniak, D.; Ahmad, I.; Alcorta, M.; Carpenter, M.P.; Cizewski, J.A.; Davids, C.N.; Gervais, G.; Greene, J.P.; Henning, W.F.; Janssens, R.V.; Lauritsen, T.; Siem, S.; Sonzogni, A.A.; Sullivan, D.; Uusitalo, J.; Wiedenhoever, I.; Amzal, N.; Butler, P.A.; Chewter, A.J.; Greenlees, P.T.; Herzberg, R.; Jones, G.D.; Cizewski, J.A.; Ding, K.Y.; Fotiades, N.; Fox, J.D.; Korten, W.; Leino, M.; Vetter, K.; Siem, S.
1999-01-01
The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadrupole deformation, β=0.27 , is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin. copyright 1999 The American Physical Society
75 FR 6319 - Proposed Amendment of Low Altitude Area Navigation Route T-254; Houston, TX
2010-02-09
... Amendment of Low Altitude Area Navigation Route T-254; Houston, TX AGENCY: Federal Aviation Administration... altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by eliminating the segment... safety and the efficient use of the navigable airspace in the Houston, TX, terminal area. DATES: Comments...
37 CFR 254.2 - Definition of coin-operated phonorecord player.
2010-07-01
...-OPERATED PHONORECORD PLAYERS § 254.2 Definition of coin-operated phonorecord player. As used in this part..., currency, tokens, or other monetary units or their equivalent; (b) Is located in an establishment making no...
36 CFR 254.12 - Value equalization; cash equalization waiver.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Value equalization; cash... AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.12 Value equalization; cash equalization waiver. (a..., either with or without adjustments of relative values as compensation for various costs, the parties to...
3C 254: the alignment effect and unification schemes
Bremer, M. N.
1997-01-01
3C 254 is a radio-loud quasar at z=0.734. Optical line and continuum emission from the underlying galaxy is clearly extended and aligned with the radio axis; the object shows the so-called `alignment effect' which is often seen in powerful radio galaxies. This is the clearest case yet of the continuum alignment effect in a radio-loud quasar. The object is one of the most lobe-dominated 3C quasars; the significance of the aligned emission in this source is discussed in terms of orientation-based unification schemes for radio-loud quasars and radio galaxies. 3C 254 is a very asymmetric radio source and it is shown that the radio structure on the side with the shortest nucleus-hotspot distance is interacting with the emission-line gas surrounding the quasar. It is also shown that the quasar is surrounded by an overdensity of faint objects, consistent with a cluster or group of galaxies around the object.
6 CFR 25.4 - Designation of qualified anti-terrorism technologies.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Designation of qualified anti-terrorism... REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.4 Designation of qualified anti-terrorism technologies. (a) General. The Under Secretary may Designate as a Qualified Anti-Terrorism...
Trabesinger, Andreas
2017-09-01
The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for ancillary terrestrial components operating in the 1610-1626.5 MHz/2483.5-2500 MHz bands. 25.254 Section 25.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical...
Liu, H L; Walker, P M
2012-01-01
Total Routhian surface calculations have been performed to investigate rapidly rotating transfermium nuclei, the heaviest nuclei accessible by detailed spectroscopy experiments. The observed fast alignment in $^{252}$No and slow alignment in $^{254}$No are well reproduced by the calculations incorporating high-order deformations. The different rotational behaviors of $^{252}$No and $^{254}$No can be understood for the first time in terms of $\\beta_6$ deformation that decreases the energies of the $\
International Nuclear Information System (INIS)
Bartels, U.
1988-01-01
Organic compounds are mostly neglected within deposition measurement programs because their determination is expensive and complicated. A very simple and rapid estimation of total organic carbon (TOC) is possible by determination of the spectral absorption coefficient in the range of ultraviolet radiation at 254 nm wave-length (SAC 254 ): TOC (mg/1) = 0,5 SAC 254 (m −1 ) - 0,15 (author) [de
Ferric ion mediated photochemical decomposition of perfluorooctanoic acid (PFOA) by 254 nm UV light
International Nuclear Information System (INIS)
Wang Yuan; Zhang Pengyi; Pan Gang; Chen Hao
2008-01-01
The great enhancement of ferric ion on the photochemical decomposition of environmentally persistent perfluorooctanoic acid (PFOA) under 254 nm UV light was reported. In the presence of 10 μM ferric ion, 47.3% of initial PFOA (48 μM) was decomposed and the defluorination ratio reached 15.4% within 4 h reaction time. While the degradation and defluorination ratio greatly increased to 80.2% and 47.8%, respectively, when ferric ion concentration increased to 80 μM, and the corresponding half-life was shortened to 103 min. Though the decomposition rate was significantly lowered under nitrogen atmosphere, PFOA was efficiently decomposed too. Other metal ions like Cu 2+ and Zn 2+ also slightly improved the photochemical decomposition of PFOA under irradiation of 254 nm UV light. Besides fluoride ion, other intermediates during PFOA decomposition including formic acid and five shorter-chain perfluorinated carboxylic acids (PFCAs) with C7, C6, C5, C4 and C3, respectively, were identified and quantified by IC or LC/MS. The mixture of PFOA and ferric ion had strong absorption around 280 nm. It is proposed that PFOA coordinates with ferric ion to form a complex, and its excitation by 254 nm UV light leads to the decomposition of PFOA in a stepwise way
2010-04-01
... up costs” incurred after the effective date of rescission? Yes. ... 25 Indians 2 2010-04-01 2010-04-01 false May the contractor be reimbursed for actual and reasonable âwind up costsâ incurred after the effective date of rescission? 900.254 Section 900.254 Indians...
International Nuclear Information System (INIS)
Dubois, J.; Chapman, S.K.; Mathews, F.S.; Reid, G.A.; Lederer, F.
1990-01-01
A role for Tyr254 in L-lactate dehydrogenation catalyzed by flavocytochrome b2 has recently been proposed on the basis of the known active-site structure and of studies that had suggested a mechanism involving the initial formation of a lactate carbanion. This role is now examined after replacement of Tyr254 with phenylalanine. The kcat is decreased about 40-fold, Km for lactate appears unchanged, and the mainly rate-limiting step is still alpha-hydrogen abstraction, as judged from the steady-state deuterium isotope effect. Modeling studies with lactate introduced into the active site indicate two possible substrate conformations with different hydrogen-bonding partners for the substrate hydroxyl. If the hydrogen bond is formed with Tyr254, as was initially postulated, the mechanism must involve removal by His373 of the C2 hydrogen, with carbanion formation. If, in the absence of the Tyr254 phenol group, the hydrogen bond is formed with His373 N3, the substrate is positioned in such a way that the reaction must proceed by hydride transfer. Therefore the mechanism of the Y254F enzyme was investigated so as to distinguish between the two mechanistic possibilities. 2-Hydroxy-3-butynoate behaves with the mutant as a suicide reagent, as with the wild-type enzyme. Similarly, the mutant protein also catalyzes the reduction and the dehydrohalogenation of bromopyruvate under transhydrogenation conditions
International Nuclear Information System (INIS)
Obi, C.M.
2000-01-01
The Area 25 Reactor Maintenance, Assembly, and Disassembly Decontamination Facility is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Unit (CAU) 254. CAU 254 is located in Area 25 of the Nevada Test Site and consists of a single Corrective Action Site CAS 25-23-06. CAU 254 will be closed, in accordance with the FFACO of 1996. CAU 254 was used primarily to perform radiological decontamination and consists of Building 3126, two outdoor decontamination pads, and surrounding soil within an existing perimeter fence. The site was used to decontaminate nuclear rocket test-car hardware and tooling from the early 1960s through the early 1970s, and to decontaminate a military tank in the early 1980s. The site characterization results indicate that, in places, the surficial soil and building materials exceed clean-up criteria for organic compounds, metals, and radionuclides. Closure activities are expected to generate waste streams consisting of nonhazardous construction waste. petroleum hydrocarbon waste, hazardous waste, low-level radioactive waste, and mixed waste. Some of the wastes exceed land disposal restriction limits and will require off-site treatment before disposal. The recommended corrective action was revised to Alternative 3- ''Unrestricted Release Decontamination, Verification Survey, and Dismantle Building 3126,'' in an addendum to the Correction Action Decision Document
Enhanced escape rate for Hg 254 nm resonance radiation in fluorescent lamps
International Nuclear Information System (INIS)
Lawler, James E; Raizen, Mark G
2013-01-01
The potential of the low-cost MAGIS isotopic separation method to improve fluorescent lamp efficacy is explored using resonance radiation transport simulations. New Hg isotopic mixes are discovered that yield escape rates for 254 nm Hg I resonance radiation equal to 117% to 122% of the rate for a natural isotopic mix under the same lamp conditions. (paper)
Coulomb dissociation of {sup 8}B at 254 A MeV
Energy Technology Data Exchange (ETDEWEB)
Suemmerer, K; Boue, F; Baumann, T; Geissel, H; Hellstroem, M; Koczon, P; Schwab, E; Schwab, W; Senger, P; Surowiecz, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N; Ozawa, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B; Czajkowski, S; Marchand, C; Pravikoff, M S [Centre d` Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A; Lauer, F; Oeschler, H; Speer, J; Sturm, C; Uhlig, F; Wagner, A [Technische Univ. Darmstadt (Germany); Gai, M [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R; Walus, W [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)
1998-06-01
As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)
Coulomb dissociation of 8B at 254 MeV/u
International Nuclear Information System (INIS)
Surowka, G.; Iwasa, N.; Boue, F.
1999-01-01
As an alternative method to determine the cross section of 7 Be (p, γ) 8 B, the Coulomb dissociation reaction 8 B → 7 Be + p at E inc = 254 MeV/u was measured. Our preliminary results show the dominant role of the dipole excitation in the Coulomb break-up process. The extracted astrophysical S 17 factor is consistent with the lower-value results both of the direct-capture studies, and the RIKEN Coulomb-dissociation experiment at ∼ 50 MeV/u. (author)
International Nuclear Information System (INIS)
Turner, M.A.; Webb, R.B.
1981-01-01
Comparative mutagenesis and possible synergistic interaction between broad-spectrum (313- to 405-nm) near-ultraviolet (black light bulb [BLB]) radiation and 254-nm radiation were studied in Escherichia coli strains WP2 (wild type), WP2s (uvrA), WP10 (recA), WP6 (polA), WP6s (polA uvrA), WP100 (uvrA recA), and WP5 (lexA). With BLB radiation, strains WP2s and WP6s demonstrated a high level of mutagenesis, whereas strains WP2, WP5, WP6, WP10, and WP100 did not demonstrate significant mutagenesis. In contrast, 254-nm radiation was mutagenic in strains WP2, WP2s, WP6, and WP6s, but strains WP5, WP10, and WP100 were not significantly mutated. The absence of mutagenesis by BLB radiation in lexA and recA strains WP10, WP5, and WP100 suggests that lex + rec + repair may play a major role in mutagenesis by both BLB and 254-nm radiation. The hypothesis that BLB radiation selectively inhibits rec + lex + repair was tested by sequential BLB-254 nm radiation. With strain WP2, a fluence of 30 J/m 2 at 254 nm induced trp + revertants at a frequency of 15 x 10 -6 . However, when 10 5 J/m 2 or more BLB radiation preceded the 254-nm exposure, no trp + revertants could be detected. A similar inhibition of 254-nm mutagenesis was observed with strain WP6 (polA). However, strains WP2s (uvrA) and WP6s (polA uvrA) showed enhanced 254-nm mutagenesis when a prior exposure to BLB radiation was given
Optical and near-infrared study of the AM Herculis-type binary CW 1103 + 254
Energy Technology Data Exchange (ETDEWEB)
Bailey, J [Anglo-Australian Observatory, Epping (Australia); Watts, D J [Tasmania Univ., Sandy Bay (Australia). Dept. of Physics; Sherrington, M R [Leicester Univ. (UK). Dept. of Astronomy
1985-07-15
The AM Herculis-type binary CW 1103+254 has been observed using optical and near-infrared photometry and polarimetry, and optical spectroscopy and spectropolarimetry. It is found that from such a set of observations it is relatively easy to distinguish all the main components of the system.
Energy Technology Data Exchange (ETDEWEB)
Watanabe, Masaki; Takahashi, Akira (Nagoya Univ. (Japan). Faculty of Medicine); Arahata, Yutaka; Motegi, Yoshimasa; Furuse, Masahiro
1993-11-01
A total of 254 patients who were proved to have pontine high intensity areas on T[sub 2]-weighted magnetic resonance imaging (MRI) were analyzed in relation to brain stem semiology. A comparative study on MRI and MR angiography was made between 254 patients with pontine high signals and 276 control cases showing no abnormality either on T[sub 1] or T[sub 2]-weighted images. Of the 254 patients, 62 had transient subjective complaints such as vertigo-dizziness. Supratentorial high signals, basilar artery tortuousness and vertebral artery asymmetry on MR angiography were seen more frequently in patients with pontine high signals than in the controls. In conclusion, pontine high signals may result from diffuse arteriosclerosis and MR angiography is considered to be a useful screening method. (author).
Crítica textual y estilo: nota a Farsalia I 254
Directory of Open Access Journals (Sweden)
Antonio Holgado Redondo
1981-12-01
Full Text Available Almost every Lucan's manuscript has in Pharsalia I 254 the variant furentem (only one gives ruentem, but almost every one of the editors prefers ruentem. The acceptance of ruentem is due to the nearby presence of a furentum and a furoris. Here we maintain furentem as the right reading, on grounds of Lucan's familiar stylistic procedure of repetition of the key terms of a passage. The poetic value of this repetition is endorsed in modern times by R. Jakobson and S. R. Levin.
Study of the average charge states of 188Pb and 252,254No ions at the gas-filled separator TASCA
International Nuclear Information System (INIS)
Khuyagbaatar, J.; Ackermann, D.; Andersson, L.-L.; Ballof, J.; Brüchle, W.; Düllmann, Ch.E.; Dvorak, J.; Eberhardt, K.; Even, J.; Gorshkov, A.; Graeger, R.; Heßberger, F.-P.; Hild, D.; Hoischen, R.; Jäger, E.; Kindler, B.
2012-01-01
The average charge states of 188 Pb and 252,254 No ions in dilute helium gas were measured at the gas-filled recoil separator TASCA. Hydrogen gas was also used as a filling gas for measurements of the average charge state of 254 No. Helium and hydrogen gases at pressures from 0.2 mbar to 2.0 mbar were used. A strong dependence of the average charge state on the pressure of the filling gases was observed for both, helium and hydrogen. The influence of this dependence, classically attributed to the so-called “density effect”, on the performance of TASCA was investigated. The average charge states of 254 No ions were also measured in mixtures of helium and hydrogen gases at low gas pressures around 1.0 mbar. From the experimental results simple expressions for the prediction of average charge states of heavy ions moving in rarefied helium gas, hydrogen gas, and in their mixture were derived.
Decay and Fission Hindrance of Two- and Four-Quasiparticle K Isomers in ^{254}Rf.
David, H M; Chen, J; Seweryniak, D; Kondev, F G; Gates, J M; Gregorich, K E; Ahmad, I; Albers, M; Alcorta, M; Back, B B; Baartman, B; Bertone, P F; Bernstein, L A; Campbell, C M; Carpenter, M P; Chiara, C J; Clark, R M; Cromaz, M; Doherty, D T; Dracoulis, G D; Esker, N E; Fallon, P; Gothe, O R; Greene, J P; Greenlees, P T; Hartley, D J; Hauschild, K; Hoffman, C R; Hota, S S; Janssens, R V F; Khoo, T L; Konki, J; Kwarsick, J T; Lauritsen, T; Macchiavelli, A O; Mudder, P R; Nair, C; Qiu, Y; Rissanen, J; Rogers, A M; Ruotsalainen, P; Savard, G; Stolze, S; Wiens, A; Zhu, S
2015-09-25
Two isomers decaying by electromagnetic transitions with half-lives of 4.7(1.1) and 247(73) μs have been discovered in the heavy ^{254}Rf nucleus. The observation of the shorter-lived isomer was made possible by a novel application of a digital data acquisition system. The isomers were interpreted as the K^{π}=8^{-}, ν^{2}(7/2^{+}[624],9/2^{-}[734]) two-quasineutron and the K^{π}=16^{+}, 8^{-}ν^{2}(7/2^{+}[624],9/2^{-}[734])⊗8^{-}π^{2}(7/2^{-}[514],9/2^{+}[624]) four-quasiparticle configurations, respectively. Surprisingly, the lifetime of the two-quasiparticle isomer is more than 4 orders of magnitude shorter than what has been observed for analogous isomers in the lighter N=150 isotones. The four-quasiparticle isomer is longer lived than the ^{254}Rf ground state that decays exclusively by spontaneous fission with a half-life of 23.2(1.1) μs. The absence of sizable fission branches from either of the isomers implies unprecedented fission hindrance relative to the ground state.
Human Factors evaluation of LCS 254 and 255
International Nuclear Information System (INIS)
Goffe, L.; Held, J.E.
1993-01-01
This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report
Stability of trans-fermium elements at high spin: Measuring the fission barrier of 254No
International Nuclear Information System (INIS)
Henning, Greg
2012-01-01
Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E*. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence B f (I), which gives information on the shell energy E(shell)(I). Theoretical calculations predict different fission barrier heights from B f (I = 0) = 6.8 MeV for a macro-microscopic model to 8.7 MeV for Density Functional Theory calculations using the Gogny or Skyrme interactions. Hence, a measurement of B f provides a test for theories.To investigate the fission barrier, an established method is to measure the rise of fission with excitation energy, characterized by the ratio of decay widths Γ(fission)/Γ(total), using transfer reactions. However, for heavy elements such as 254 No, there is no suitable target for a transfer reaction. We therefore rely on the complementary decay widths ratio Γ γ /Γ(fission) and its spin dependence, deduced from the entry distribution (I, E*).Measurements of the gamma-ray multiplicity and total energy for 254 No have been performed with beam energies of 219 and 223 MeV in the reaction 208 Pb( 48 Ca,2n) at ATLAS (Argonne Tandem Linac Accelerator System). The 254 No gamma rays were detected using the Gammasphere array as a calorimeter - as well as the usual high resolution γ-ray detector. Coincidences with evaporation residues at the Fragment Mass Analyzer focal plane separated 254 No gamma rays from those from fission fragments, which are ≥ 10 6 more intense. From this measurement, the entry distribution - i.e. the initial distribution of I and E* - is constructed. Each point (I,E*) of the entry distribution is a point where gamma decay wins over fission and, therefore, gives information on the fission barrier. The measured entry distributions show an increase in the maximum spin and excitation energy from 219 to 223 Me
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standards for coal processing and conveying equipment, coal storage systems, transfer and loading systems, and open storage piles. 60.254... (CONTINUED) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Coal Preparation...
Photooxidation of polystyrene: irradiation at 254 and 365 nm
International Nuclear Information System (INIS)
Otocka, E.P.; Curran, S.; Porter, R.S.
1983-01-01
Studies have been made of the near surface photooxidation of atactic polystyrene films prepared in the absence of air. The samples were photooxidized on exposure to air at two frequencies, 254 and 365 nm, using a calibrated mercury irradiation source with filters. Most studies were made at 40 0 C and as a function of irradiation time with the reactions characterized by changes in molecular weight and composition. The former was evaluated by gel permeation chromatography and the latter by transmission Fourier transform infrared ir spectroscopy and by multiple-internal-reflectance ir spectra using different angles and different crystals to evaluate compositions as a function of film depth. Species identified in photooxidation include the generation of hydroperoxides and the appearance of carbonyl bands with the latter identified by the spectral shift associated with the exposure of the photooxidized polystyrene surface to ammonia. These results suggest that principal products of near-surface oxidation of polystyrene are carboxylic acids. 6 figures, 1 table
30 CFR 254.26 - What information must I include in the “Worst case discharge scenario” appendix?
2010-07-01
... and environmental importance, if any, specified in the appropriate Area Contingency Plan(s). (d) A... COAST LINE Oil-Spill Response Plans for Outer Continental Shelf Facilities § 254.26 What information... Control Systems for Use on Water, and ASTM F818-93, Standard Definitions Relating to Spill Response...
Kwon, Minhwan; Yoon, Yeojoon; Kim, Seonbaek; Jung, Youmi; Hwang, Tae-Mun; Kang, Joon-Wun
2018-05-15
The aim of this study is to evaluate the micropollutant removal capacity of a 275 nm light-emitting diode (LED)-UV/chlorine system. The sulfamethoxazole, ibuprofen, and nitrobenzene removal efficiencies of this system were compared with those of a conventional 254 nm low-pressure (LP)-UV system as a function of the UV dose. In a direct photolysis system, the photon reactivity of sulfamethoxazole is higher than that of nitrobenzene and ibuprofen at both wavelengths. The molar absorption coefficients and quantum yields of each micropollutant were as follows: sulfamethoxazole (ε SMX, 275 nm protonated = 17,527 M -1 cm -1 , Φ SMX, 275 nm protonated = 0.239, ε SMX, 275 nm deprotonated = 8430 M -1 cm -1 , and Φ SMX, 275 nm deprotonated = 0.026), nitrobenzene (ε NB, 275 nm = 7176 M -1 cm -1 and Φ NB, 275 nm = 0.057), and ibuprofen (ε NB, 275 nm = 200 M -1 cm -1 and Φ IBF, 275 nm = 0.067). The photon reactivity of chlorine species, i.e., HOCl and OCl-, were determined at 275 nm (ε HOCl, 275 nm = 28 M -1 cm -1 , Φ HOCl, 275 nm = 1.97, ε OCl-, 275 nm = 245 M -1 cm -1 , and Φ OCl-, 275 nm = 0.8), which indicate that the decomposition rate of OCl - is higher and that of HOCl is lower by 275 nm photolysis than that by 254 nm photolysis (ε HOCl, 254 nm = 60 M -1 cm -1 , Φ HOCl, 254 nm = 1.46, ε OCl-, 254 nm = 58 M -1 cm -1 , and Φ OCl-, 254 nm = 1.11). In the UV/chlorine system, the removal rates of ibuprofen and nitrobenzene were increased by the formation of OH and reactive chlorine species. The 275-nm LED-UV/chlorine system has higher radical yields at pH 7 and 8 than the 254 nm LP-UV/chlorine system. Copyright © 2018 Elsevier B.V. All rights reserved.
Uretritis masculina Estudio prospectivo de 254 casos
Directory of Open Access Journals (Sweden)
Federico Diaz G.
1983-06-01
Full Text Available La uretritis no gonocócica (UNG fue la forma predominante (78,0% en una serie de 254 hombres con síndrome de uretritis, estudiados prospectivamente en 1982. La Trichomonas vaginalis estuvo presente en el 4.0% de los casos de UNG. Con base en la comparación entre los pacientes de uretritis gonocócica (UG y los de UNO, puede proponerse un perfil de los segundo que oriente al médico en su sospecha diagnóstica: mayor probabilidad de no hallar secreción uretral o de que Ésta sea escasa y de las modalidades acuosa, mucoide o mixta; también mayor probabilidad de un período de incubación por encima de 9 días y de una evolución superior a un mes. A pesar de tales indicios hay mucha superposición clínica entre las dos formas de uretritis por lo que sigue siendo valedera la recomendación de recurrir al Gram como procedimiento confiable y económico para establecer el diagnóstico diferencial. Se llama la atención hacia la necesidad de disponer de datos sobre uretritis en otros grupos socioeconómicos y de investigar aspectos como la frecuencia en nuestro medio del síndrome de uretritis postgonocócica (U PG.
Alimentation impact of treatments of 254 oropharyngeal cancers (1998-2003).
Buiret, Guillaume; Daveau, Clémentine; Landry, Guillaume; Colin, Carole; Pignat, Jean-Christian; Poupart, Marc
2011-01-01
Objective. To analyze the functional impact of the various possible treatments of oropharyngeal squamous cell carcinomas to find the main prognostic factors of dysphagia induced by these treatments. Patients. Clinical data from 254 patients treated for squamous cell carcinoma of the oropharynx between 1998 and 2003 were retrospectively analyzed. A multivariate model enabled us to evaluate the role of each potentially harmful factor on swallowing. Main Outcome Measures. The significant factors influencing the consumption of liquid, pasty, and normal food were the same: the initial T stage and the type of treatment. Conclusion. Whatever the possible and selected treatment was, the impact on the functional capacities, and thus, the quality of life of the patients was considerable. Even though we could not significantly demonstrate exclusive radiotherapy caused more long-term undesirable effects than surgery followed by radiotherapy, our daily practice has shown that we should favour the latter.
Badalamenti, Jonathan P; Erickson, Joshua D; Salomon, Christine E
2016-04-14
We sequenced and annotated the complete 7,170,504-bp genome of a novel secondary metabolite-producingStreptomycesstrain,Streptomyces albusSM254, isolated from copper-rich subsurface fluids at ~220-m depth within the Soudan Iron Mine (Soudan, MN, USA). Copyright © 2016 Badalamenti et al.
The O-GlcNAc Transferase Intellectual Disability Mutation L254F Distorts the TPR Helix.
Gundogdu, Mehmet; Llabrés, Salomé; Gorelik, Andrii; Ferenbach, Andrew T; Zachariae, Ulrich; van Aalten, Daan M F
2018-05-17
O-linked β-N-acetyl- D -glucosamine (O-GlcNAc) transferase (OGT) regulates protein O-GlcNAcylation, an essential post-translational modification that is abundant in the brain. Recently, OGT mutations have been associated with intellectual disability, although it is not understood how they affect OGT structure and function. Using a multi-disciplinary approach we show that the L254F OGT mutation leads to conformational changes of the tetratricopeptide repeats and reduced activity, revealing the molecular mechanisms contributing to pathogenesis. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.
Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D
2016-03-15
Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (kobs) was found to be the highest at near neutral pH conditions (pH 5.5-8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu(2+). Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO4(-) reaction including hydroxylation (+16Da), demethylation (-14Da), decarbonylation (-28Da) and dehydration (-18Da). This study suggests that UV-254nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC. Copyright © 2015 Elsevier B.V. All rights reserved.
Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics
International Nuclear Information System (INIS)
Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G
2012-01-01
This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 µm. The whole process is easy to perform without the requirement for any microfabrication facilities. (technical note)
Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics
Fan, Yiqiang
2012-01-13
This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
Nuclear structure data from in beam and decay studies around 254No
International Nuclear Information System (INIS)
Jones, P.
2005-01-01
The study of trans-fermium nuclei, the heaviest nuclei for which in-beam spectroscopy studies are possible has provided over recent years a rich tapestry of data. These have enhanced the mean field theories important for the prediction of nuclear properties at the limits of the nuclear chart. Developments in spectrometer and data-acquisition techniques at the Department of Physics, University of Jyvaskyla have further enhanced the studies. Utilising the RITU gas-filled spectrometer, the GREAT focal plane spectrometer, the identification recoils and their subsequent decay modes (alpha-, fission-, and gamma-ray decay) have been studied. The JUROGAM gamma-ray array of 43 Compton-suppressed HPGe detectors has been employed in the in-beam spectroscopy of the trans-fermium region. In-beam gamma-ray spectroscopy studies of trans-fermium nuclei 253 No, 254 No, 250 Fm, 251 Md, 253 No and 255 Lr have been performed, as well as detailed focal plane spectroscopy. Selected highlights of the work will be presented
International Nuclear Information System (INIS)
Skoutelis, Charalambos G.; Vlastos, Dimitris; Kortsinidou, Marianna C.; Theodoridis, Ioannis T.; Papadaki, Maria I.
2011-01-01
Highlights: ► 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. ► We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. ► 2-HPY was found to be genotoxic. ► Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. ► Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5–400 μg ml −1 . 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.
Daraiseh, Susan I; Kassardjian, Ari; Alexander, Karen E; Rizkallah, Raed; Hurt, Myra M
2018-05-25
Yin Yang 1 (YY1) is a multifunctional transcription factor that can activate or repress transcription depending on the promotor and/or the co-factors recruited. YY1 is phosphorylated in various signaling pathways and is critical for different biological functions including embryogenesis, apoptosis, proliferation, cell-cycle regulation and tumorigenesis. Here we report that YY1 is a substrate for c-Abl kinase phosphorylation at conserved residue Y254 in the spacer region. Pharmacological inhibition of c-Abl kinase by imatinib, nilotinib and GZD824, knock-down of c-Abl using siRNA, and the use of c-Abl kinase-dead drastically reduces tyrosine phosphorylation of YY1. Both radioactive and non-radioactive in vitro kinase assays, as well as co-immunoprecipitation in different cell lines, show that the target of c-Abl phosphorylation is tyrosine residue 254. c-Abl phosphorylation has little effect on YY1 DNA binding ability or cellular localization in asynchronous cells. However, functional studies reveal that c-Abl mediated phosphorylation of YY1 regulates YY1's transcriptional ability in vivo. In conclusion, we demonstrate the novel role of c-Abl kinase in regulation of YY1's transcriptional activity, linking YY1 regulation with c-Abl tyrosine kinase signaling pathways. Copyright © 2018. Published by Elsevier B.V.
Energy Technology Data Exchange (ETDEWEB)
Liu, Yiqing [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Fu, Yongsheng [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)
2016-03-15
Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC{sup −} had the highest second-order rate constant with SO{sub 4}·{sup −}. • Presence of HCO{sub 3}{sup −} or Cu{sup 2+} enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k{sub obs}) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu{sup 2+}. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO{sub 4}·{sup −} reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.
International Nuclear Information System (INIS)
Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D.
2016-01-01
Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC"− had the highest second-order rate constant with SO_4·"−. • Presence of HCO_3"− or Cu"2"+ enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k_o_b_s) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu"2"+. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO_4·"− reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.
Cold valleys in the radioactive decay of 248-254Cf isotopes
International Nuclear Information System (INIS)
Biju, R.K.; Sahadevan, Sabina; Santhosh, K.P.; Joseph, Antony
2008-01-01
Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254 Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46 Ar, 48,50 Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132 Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts. (author)
Clofibric acid degradation in UV254/H2O2 process: effect of temperature.
Li, Wenzhen; Lu, Shuguang; Qiu, Zhaofu; Lin, Kuangfei
2010-04-15
The degradation of clofibric acid (CA) in UV(254)/H(2)O(2) process under three temperature ranges, i.e. T1 (9.0-11.5 degrees C), T2 (19.0-21.0 degrees C) and T3 (29.0-30.0 degrees C) was investigated. The effects of solution constituents including NO(3)(-) and HCO(3)(-) anions, and humic acid (HA) on CA degradation were evaluated in Milli-Q waters. CA degradation behaviors were simulated with the pseudo-first-order kinetic model and the apparent rate constant (k(ap)) and half-life time (t(1/2)) were calculated. The results showed that higher temperature would favor CA degradation, and CA degradation was taken place mostly by indirect oxidation through the formation of OH radicals in UV(254)/H(2)O(2) process. In addition, the effects of both NO(3)(-) and HCO(3)(-) anions at two selected concentrations (1.0x10(-3) and 0.1 mol L(-1)) and HA (20 mg L(-1)) on CA degradation were investigated. The results showed that HA had negative effect on CA degradation, and this effect was much more apparent under low temperature condition. On the other hand, the inhibitive effect on CA degradation at both lower and higher concentrations of bicarbonate was observed, and this inhibitive effect was much more apparent at higher bicarbonate concentration and lower temperature condition. While, at higher nitrate concentration the inhibitive effect on CA degradation under three temperature ranges was observed, and with the temperature increase this negative effect was apparently weakened. However, at lower nitrate concentration a slightly positive effect on CA degradation was found under T2 and T3 conditions. Moreover, when using a real wastewater treatment plant (WWTP) effluent spiked with CA over 99% of CA removal could be achieved under 30 degrees C within only 15 min compared with 40 and 80 min under 20 and 10 degrees C respectively, suggesting a significant promotion in CA degradation under higher temperature condition. Therefore, it can be concluded that temperature plays an
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).
2010-10-01
... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...
Radiochemical search for neutron-rich isotopes of nielsbohrium in the (16)O + (254)Es reaction
International Nuclear Information System (INIS)
Schaedel, M.; Jaeger, E.; Bruechle, W.; Suemmerer, K.; Hulet, E.K.; Wild, J.F.; Lougheed, R.W.; Dougan, R.J.; Moody, K.J.
1994-09-01
We have used on-line gas chromatography to search for new isotopes of element 107 near the deformed sub-shell at N = 162 and Z = 108. Enhanced nuclear stability is predicted for this region. 254g Es was irradiated with 16 O at barrier energies to minimize the fusion hindrance in the entrance channel and to reduce the excitation energy of the compound nucleus to a minimum value. For half-lives between roughly two seconds and two minutes no signal for a positive identification of a new isotope of element 107 was detected. Consequently, only an upper cross-section limit of a few nanobarns was obtained. While this cross-section limit was too high to probe the influence of the predicted enhanced nuclear ground-state stability on the survival probability in the fission/evaporation competition, a very large cross-section enhancement would have been detectable. (orig.)
A prospective study on time to recovery in 254 injured novice runners.
Directory of Open Access Journals (Sweden)
Rasmus Oestergaard Nielsen
Full Text Available Describe the diagnoses and the time to recovery of running-related injuries in novice runners.Prospective cohort study on injured runners.This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered.A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87% recovering from their injury, the median time to recovery was 71 days (minimum = 9 days, maximum = 617 days.Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.
Critical pitting temperature for Type 254 SMO stainless steel in chloride solutions
International Nuclear Information System (INIS)
Abd El Meguid, E.A.; Abd El Latif, A.A.
2007-01-01
The variation with time of the open circuit potential of high molybdenum containing stainless steel (Type 254 SMO) was measured in 4% sodium chloride solution in the temperatures range 30-100 deg. C. The plot of steady state potentials as function of temperature showed an inflection at 50 deg. C, attributed to the decrease of oxygen solubility in test solution above 50 deg. C. Potentiodynamic cycling anodic polarization technique was used to determine the critical pitting potential (E pit ) and the critical protection potential (E prot ) of the steel in 4-30% NaCl solutions at temperatures between 30 and 100 deg. C. By plotting the two values versus solution temperature, the corresponding critical pitting (CPT) and the critical protection (CPrT) temperatures were determined. Both parameters decreased with increasing chloride content. Above the CPT, E pit and E prot decreased linearly with log[Cl - ]. The addition of bromide ions to the solution shifted both E pit and E prot towards positive values. In 4% NaCl, E pit increased linearly with pH in the range 1-10. The combined effect of chloride ion concentration and pH on the morphology of the pits was examined by scanning electron microscopy (SEM) following potentiodynamic cycling anodic polarization
Czech Academy of Sciences Publication Activity Database
Sysalová, J.; Kučera, Jan; Fikrle, Marek; Drtinová, B.
2013-01-01
Roč. 110, SEP (2013), s. 691-694 ISSN 0026-265X R&D Projects: GA ČR GAP503/12/0682; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : Mercury * contaminated soils * AMA-254 * RNAA Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.583, year: 2013
Martignac, Marion; Balayssac, Stéphane; Gilard, Véronique; Benoit-Marquié, Florence
2015-06-18
We have investigated the removal of bortezomib, an anticancer drug prescribed in multiple myeloma, using the photochemical advanced oxidation process of V-UV/UV (185/254 nm). We used two complementary analytical techniques to follow the removal rate of bortezomib. Nuclear magnetic resonance (NMR) is a nonselective method requiring no prior knowledge of the structures of the byproducts and permits us to provide a spectral signature (fingerprinting approach). This untargeted method provides clues to the molecular structure changes and information on the degradation of the parent drug during the irradiation process. This holistic NMR approach could provide information for monitoring aromaticity evolution. We use liquid chromatography, coupled with high-resolution mass spectrometry (LC-MS), to correlate results obtained by (1)H NMR and for accurate identification of the byproducts, in order to understand the mechanistic degradation pathways of bortezomib. The results show that primary byproducts come from photoassisted deboronation of bortezomib at 254 nm. A secondary byproduct of pyrazinecarboxamide was also identified. We obtained a reliable correlation between these two analytical techniques.
Energy Technology Data Exchange (ETDEWEB)
G. N. Doyle
2002-02-01
Corrective Action Unit (CAU) 254 is located in Area 25 of the Nevada Test Site (NTS), approximately 100 kilometers (km) (62 miles) northwest of Las Vegas, Nevada. The site is located within the Reactor Maintenance, Assembly and Disassembly (R-MAD) compound and consists of Building 3126, two outdoor decontamination pads, and surrounding areas within an existing fenced area measuring approximately 50 x 37 meters (160 x 120 feet). The site was used from the early 1960s to the early 1970s as part of the Nuclear Rocket Development Station program to decontaminate test-car hardware and tooling. The site was reactivated in the early 1980s to decontaminate a radiologically contaminated military tank. This Closure Report (CR) describes the closure activities performed to allow un-restricted release of the R-MAD Decontamination Facility.
International Nuclear Information System (INIS)
Calkins, J.; Wheeler, J.S.; Keller, C.I.; Colley, E.; Hazle, J.D.
1988-01-01
The action spectra of five eukaryotic organisms and the prokaryote, Escherichia coli, were examined over the wavelength range, 254-320 nm. Both the repair competent and three repair defective strains (E. coli, Caenorhabditis elegans, Saccharomyces) were examined. Tetrahymena pyriformis action spectra were performed with and without the excision repair inhibitor caffeine present. Others have observed that lethality, mutation, and the production of pyrimidine dimers show much the same wavelength dependence as DNA absorption. The results presented here demonstrate several action spectra which deviate from the DNA absorption spectra. Ultraviolet sensitization ratios (repair competent/repair defective) were also examined and were shown to change over the wavelength range. These findings suggest that DNA may not be the only important chromophore leading to cell death in the uv wavelength range studied. Since uv-B is of major importance in solar uv damage, these findings may also yield important implications for solar uv studies
International Nuclear Information System (INIS)
Kamchatova, I.E.; Chunaev, A.S.; Bronnikov, V.A.
1987-01-01
In experiments on related Chlamidomonas reinhardii strains of similar mating type a study was made of sensitivity of cells with different carotenoid content to UV-radiation of 254 nm. Mutants having a lower, as opposed to the wild type strain, content of carotenoids exhibited an increased radiosensitivity. A carotenoid-free mutant was found to possess a higher sensitivity to UV-radiation which was typical of the strain with the impaired excision repair system. The studied subclone of the UV-radiosensitive strain CC-888 was unable to photoreactivate the UV-induced damages which was typical of the wild-type strain. The content of carotenoids in cells of this subnuclone exceeded that in cells of mutants with the reduced pigmentation
Projecto 254 - Produção de suínos ao ar livre : unidade de demonstração Programa AGRO
Marinho, M.C.; Dias, S.F.; Rodrigues, J.P.V.
2006-01-01
A produção de suínos ao ar livre pode contribuir para a preservação e valorização das raças autóctones e dos produtos delas derivados, evitando assim a sua extinção. O projecto, Produção de suínos ao ar livre – Unidade de demonstração, cujo período de execução vai de setembro de 2004 a dezembro de 2006, tem como principal objectivo demonstrar a tecnologia de produção de leitões ao ar livre. Programa AGRO - Projecto 254, Medida 8.1.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
International Nuclear Information System (INIS)
Drakakis, E.; Karabourniotis, D.
2012-01-01
For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.
Energy Technology Data Exchange (ETDEWEB)
Drakakis, E. [Technological Educational Institute, Department of Electrical Engineering, 71004 Heraklion (Greece); Karabourniotis, D. [Institute of Plasma Physics, Department of Physics, University of Crete, 71003 Heraklion (Greece)
2012-09-01
For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.
International Nuclear Information System (INIS)
2000-01-01
This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Chelation and stabilization of berkelium in oxidation state +IV
Czech Academy of Sciences Publication Activity Database
Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.
2017-01-01
Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016
International Nuclear Information System (INIS)
Tarvainen, A.-M.
2011-08-01
Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Directory of Open Access Journals (Sweden)
Emrah Peşman
2011-04-01
Full Text Available ABSTRACT As it is known, mechanical pulp papers include significant amount of lignin and carbohydrates as well as cellulose. Thus, when these lignin reach papers irradiated with short wave UV light they could not protect their color. In this study, bleaching of ONP/OMG recycled pulps with hydrogen peroxide, sodium percarbonate, sodium dithyonite, sodium borohydride and formamidin sulfunic acid were performed. Then the test papers of these pulps were irradiated with 254-366nm UV light and changes in the ISO Brightness, CIE L*a*b*, yellowness (YI and whiteness (WI values were observed. At the result of study, all bleaching agents were determined as insufficient in the respect of color stability. But if they compared with each other, the two stages sodium percarbonate-sodium borohydride bleaching sequence was gave the best results against to color reversion. Keywords: Old news/old magazine papers (ONP/OMG, Bleaching, Color Stability, UV Irradiation
International Nuclear Information System (INIS)
Hoffman, D.C.
1976-01-01
Recent measurements have shown that 259 Fm gives the highest total kinetic energy release and the most symmetric mass division so far observed for spontaneous fission. These results continue the trends observed previously in the fermium isotopes toward higher total kinetic energies and more symmetric mass division with increasing mass of the fermium isotopes. The transition from asymmetric mass division ( 254 Fm) to highly favored symmetric mass division ( 259 Fm) now appears to have been completed. These features are consistent with the simple postulate that the more neutron-rich fermium isotopes show an increase in the yield of symmetric fragments and in the total kinetic energy because symmetric mass division of fermium (Z = 100) nuclei results in two fragments which have the magic proton number of 50 and are close to the magic neutron number of 82. The proximity of the fragments to the doubly magic configuration seems to have a profound effect on the mass division and total kinetic energy release in fission
Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition
International Nuclear Information System (INIS)
Henderson, R.A.
2009-01-01
This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update
International Nuclear Information System (INIS)
Gurzadyan, G.G.; Goerner, H.
1994-01-01
Photoreactions, such as base release and decomposition of the base moeity, induced by either 20 ns laser pulses at 193 nm or continuous 254 nm irradiation, were studied for a series of uracil and adenine derivatives in neutral aqueous solution. The quantum yield of chromophore loss (Φ cl ) depends significantly on the nature of the nucleic acid constituent and the saturating gas (Ar, N 2 O or O 2 ). In the case of polynucleotides the destruction of nucleotides was measured by high-performance liquid chromatography after hydrolysis; the quantum yields (Φ dn ) are comparable to those of chromophore loss or larger. The Φ cl and Φ dn of 0.04-0.1 for poly(U) and poly(dU), obtained for both wavelengths of irradiation, are due to processes originating from the lowest excited singlet state, i.e. formation of photohydrates and photodimers, and a second part from photoionization using λ irr = 193 nm. Irradiation at 193 nm effectively splits pyrimidine dimers and thus reverts them into monomers. (author)
Directory of Open Access Journals (Sweden)
Asha V. Chate
2012-01-01
Full Text Available A series of novel 2-(5-(4-(allyloxy-3-methoxyphenyl-1H-pyrazol-3-ylphenols derivatives have been synthesized via the ring opening of 2-(4-(allyloxy-3-methoxyphenyl-4H-chromen-4-ones in ethanol and hydrazine hydrate under reflux condition. The synthesized compounds were screened for antibacterial and antifungal activity against bacteria Staphylococcus aureus (MRSA E710 and Escherichia coli (ATCC 25922 and fungi Candida albicans and Aspergillus fumigates respectively. Some of the tested compounds showed significant antimicrobial activity. 1H NMR, IR, Mass spectral data and elemental analysis elucidated the structures of the all newly synthesized compounds.
Bialy, C; Horne, K; Dendle, C; Kanellis, J; Littlejohn, G; Ratnam, I; Woolley, I
2015-06-01
Our primary aim was to determine the rate of overseas travel in immunocompromised individuals attending appropriate clinics at an Australian tertiary care hospital. We also aimed to characterise health-seeking behaviour prior to travel and investigated sources of pre-travel advice, compared travel patterns and activities between three specific immunosuppressed groups, and examined pre-immunosuppression patient serology. We implemented a cross-sectional survey of patients between February and August 2012. This survey was implemented among three outpatient populations at Monash Medical Centre, an Australian tertiary care hospital. We recruited 254 immunosuppressed adults from three patient populations: human immunodeficiency virus-positive individuals, renal transplant patients and rheumatology patients requiring immunosuppressive therapy. No clinical intervention was performed. In the 10 years preceding the survey, 153 (60.2%) participants reported international travel. Of these, 105 (68.6%) were immunosuppressed at the time of travel. These patients were 47.6% male and 60% Australian born. Forty per cent were visiting friends and relatives as part of their travel. Fifty-four per cent of those immunocompromised at the time of travel were going to high-risk destinations. Pathology files indicated that serological screening was frequently not performed prior to immunosuppression in the renal transplant and rheumatology groups. Immunocompromised patients often travel to high-risk destinations with limited or inadequate pre-travel preparations. Doctors caring for the immunocompromised should be aware of travel risks, suitable vaccination protocols and when to refer to specialist travel clinics. © 2015 Royal Australasian College of Physicians.
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
Directory of Open Access Journals (Sweden)
Miguel Tolosa Igualada
2016-05-01
Full Text Available http://dx.doi.org/10.5007/2175-7968.2016v36n2p291 Daniel Gallego Hernández (Ed.. Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.
Energy Technology Data Exchange (ETDEWEB)
Abdelraheem, Wael H.M. [Chemistry Department, Faculty of Science, Sohag University, Sohag 82524 (Egypt); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang; Duan, Xiaodi [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus)
2015-01-23
Graphical abstract: - Highlights: • UV-254 nm/H{sub 2}O{sub 2} AOP was utilized for the degradation and mineralization of PBSA and BSA. • Promotion of k{sub obs} with [H{sub 2}O{sub 2}]{sub 0} ≤ 4 mM and inhibition at higher [H{sub 2}O{sub 2}]{sub 0} were observed. • The S and N were released and monitored as SO{sub 4}{sup 2−} and NH{sub 4}{sup +}, respectively. • Br{sup −} inhibited both the degradation and mineralization much more significantly than Cl{sup −}. • There was an increase in [NH{sub 4}{sup +}] at higher [H{sub 2}O{sub 2}]{sub 0} and its further destruction at higher UV fluence. - Abstract: Various studies have revealed the non-biodegradable and endocrine disrupting properties of sulfonated organic UV absorbers, directing people's attention toward their risks on ecological and human health and hence their removal from water. In this study, UV-254 nm/H{sub 2}O{sub 2} advanced oxidation process (AOP) was investigated for degrading a model UV absorber compound 2-phenylbenzimidazole-5-sulfonic acid (PBSA) and a structurally similar compound 1H-benzimidazole-2-sulfonic acid (BSA), with a specific focus on their mineralization. At 4.0 mM [H{sub 2}O{sub 2}]{sub 0}, a complete removal of 40.0 μM parent PBSA and 25% decrease in TOC were achieved with 190 min of UV irradiation; SO{sub 4}{sup 2−} was formed and reached its maximum level while the release of nitrogen as NH{sub 4}{sup +} was much lower (around 50%) at 190 min. Sulfate removal was strongly enhanced by increasing [H{sub 2}O{sub 2}]{sub 0} in the range of 0–4.0 mM, with slight inhibition in 4.0–12.0 mM. Faster and earlier ammonia formation was observed at higher [H{sub 2}O{sub 2}]{sub 0}. The presence of Br{sup −} slowed down the degradation and mineralization of both compounds while a negligible effect on the degradation was observed in the presence of Cl{sup −}. Our study provides important technical and fundamental results on the HO{sup ·} based degradation and
Miguel Tolosa Igualada
2016-01-01
Daniel Gallego-Hernández (ed.). Current Approaches to Business and Institutional Translation. Proceedings of the International Conference on Economic, Business, Financial and Institutional Translation / Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suíça: Peter Lang, 2015, 254 páginas. ISBN 978-3-0343-1656-9.
International Nuclear Information System (INIS)
Nasuhoglu, Deniz; Yargeau, Viviane; Berk, Dimitrios
2011-01-01
In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation (λ = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L -1 of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO 2 photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L -1 of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.
Energy Technology Data Exchange (ETDEWEB)
Corringer, P J; Durieux, C; Ruiz-Gayo, M; Roques, B P [UA498 CNRS, U266 INSERM, UFR des Sciences Pharmaceutiques et Biologiques, 75 - Paris (France)
1992-06-01
Among the CCK-B receptor agonists reported to date, the two modified peptides BC 264 and BC 254 display a high affinity and selectivity for this binding site and are highly protected from enzymatic degradation. Recently, we reported the biological properties of a tritiated analog of this agonist, [[sup 3]H]pBC 264, which fullfils all the criteria required for in vitro as well as in vivo studies of the CCK-B receptor. On the other hand, BC 254 displays a high affinity for the CCK-B binding sites in the guinea-pig (K[sub i] = 0.56 nM) while its affinity in the rat is more than 60-fold lower, a difference which could be due to the occurrence of CCK-B receptor subtypes. In the present paper, we report the synthesis of [[sup 3]H]pBC 264 and of the new tritiated ligand [[sup 3]H]pBC 254 using [[sup 3]H] NPS (N-succinimidyl[2,3-[sup 3]H]propionate) as labelling agent. These two probes have high specific activity (70-100 Ci/mmol) and will enable extensive studies of the CCK-B receptors to be carried out. (author).
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Energy Technology Data Exchange (ETDEWEB)
Nasuhoglu, Deniz; Yargeau, Viviane [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada); Berk, Dimitrios, E-mail: dimitrios.berk@mcgill.ca [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada)
2011-02-15
In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation ({lambda} = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L{sup -1} of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO{sub 2} photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L{sup -1} of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.
Diwaker
2014-07-01
The electronic, NMR, vibrational, structural properties of a new pyrazoline derivative: 2-(5-(4-Chlorophenyl)-3-(pyridine-2-yl)-4,5-dihydropyrazol-1-yl)benzo[d]thiazole has been studied using Gaussian 09 software package. Using VEDA 4 program we have reported the PED potential energy distribution of normal mode of vibrations of the title compound. We have also reported the 1H and 13C NMR chemical shifts of the title compound using B3LYP level of theory with 6-311++G(2d,2p) basis set. Using time dependent (TD-DFT) approach electronic properties such as HOMO and LUMO energies, electronic spectrum of the title compound has been studied and reported. NBO analysis and MEP surface mapping has also been calculated and reported using ab initio methods.
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
2010-07-01
... dangerous or impossible to respond to a spill. Area Contingency Plan means an Area Contingency Plan prepared... Contingency Plan means the National Oil and Hazardous Substances Pollution Contingency Plan prepared and... Comprehensive Environmental Response Compensation and Liability Act (42 U.S.C. 9605). National Contingency Plan...
2010-07-01
... of fish and wildlife habitats, cultural resources, watersheds, and wilderness and aesthetic values... use of the conveyed Federal land will not substantially conflict with established management... human health and the environment with respect to any such substances remaining on the property has been...
2010-01-01
... corporate charter to operate or license to do business as a school and should not be used unless the represented “approval” has been affirmatively required or authorized by State or Federal law. (c) Industry...
2010-07-01
..., use, physical characteristics, and other amenities. Arbitration is a process to resolve a disagreement... public domain for national forest purposes and the Geothermal Steam Act of 1970 (30 U.S.C. 1001 et seq.... Resource values means any of the various commodity values or non-commodity values, such as wildlife habitat...
2010-07-01
....9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP... contributory value of any interest in land such as water rights, minerals, or timber, to the extent they are... the physical characteristics of the land being appraised; a statement of all encumbrances; title...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium
Identification of the new isotope sup 2 sup 4 sup 1 Bk
Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M
2003-01-01
A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Quici, Natalia; Vera, Maria L.; Choi, Hyeok; Puma, Gianluca Li; Dionysiou, Dionysios D.; Litter, Marta I.; Destaillats, Hugo
2009-07-01
The effect of key experimental parameters on the removal of toluene under 254 + 185 nm irradiation was investigated using a benchtop photocatalytic flow reactor. Toluenewas introduced at low concentrations between 10 and 500 ppbv, typical of indoorenvironments, and reacted on TiO2-coated Raschig rings. Two different TiO2-coated rings were prepared: in one case, by dip-coating using a P25 aqueous suspension and, on the other, using an organic/inorganic sol-gel method that produced thin films of mesoporous anatase. Flow rates in the photoreactor varied between 4 L min-1 and 125 mL min-1, leading to residence times in the range 100 ms< tau< 2 s. For these conditions, toluene removal efficiencies were between 30 and 90percent, indicating that the system did not achieve total conversion in any case. For each air flow rate, the conversion oftoluene was significantly higher when the reactor length was 10 cm, as compared with 5 cm; however, only marginal increases in conversions were achieved in the two reactor lengths at equal residence time and different concentration of toluene, suggesting that that the reactor is effectively behaving as an ideal reactor and that the reaction is first-order in the concentration of toluene. Experiments were carried out between 0 and 66percent relative humidity (RH), the fastest reaction rate being observed at moderately low humidity conditions (10percent RH), with respect to both dry air and higher humidity levels. Formaldehyde was formed as a partial oxidation byproduct at low and at high residence times (240 and 960 ms), although higher formaldehyde molar yields (up to 20percent) were observed at low tau (240 ms) and moderate humidity conditions (10 and 33percent), suggesting that both tau and RH can be optimized toreduce the formation of harmful intermediates. Toluene removal efficiency increased with the TiO2 thickness (i.e., mass) until a maximum value of 500 nm, beyond which the removal efficiency decreased. This should be
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
Publications | Page 254 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Madagascar, the world's fourth largest island, is home to an astonishing range of life forms found nowhere else on the planet. Much of this biodiversity is highly vulnerable to climate change. So too are ... Blood on the Stone Ian Smillie in his own words. Below, Ian Smillie traces his involvement in the struggle to halt conflict ...
Reference: 254 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available plant cell growth and identify a plant S-acyl transferase, an essential research tool if we are to unders...tand how this important, reversible lipid modification operates in plant cells. The
Publications | Page 254 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
restricted access). India''s trade policy has seen a marked shift towards regional trade agreements (RTAs). However, results of this survey show that a Generalized Scheme of Preferences (GSP) is a better preference-giving scheme than all of India''s ...
7 CFR 1944.254 - Program costs.
2010-01-01
... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... supplies (including food) necessary to provide services; (iv) Operational costs of a transportation service... development of the application and plan of operations before the effective date of CHSP grant award; (vi...
Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol
International Nuclear Information System (INIS)
Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.
1983-01-01
Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe
Indian Academy of Sciences (India)
Specialization: Magnetism & Superconductivity, Vortex State Studies in Superconductors, Strongly Correlated Systems Address: Vice Chancellor, Panjab University, Chandigarh 160 014, U.T.. Contact: Office: (0172) 254 1945. Residence: (0172) 254 1428. Fax: (0172) 254 1022. Email: vc@pu.ac.in, arunkgrover@gmail.com.
He, Xuexiang; de la Cruz, Armah A; Hiskia, Anastasia; Kaloudis, Triantafyllos; O'Shea, Kevin; Dionysiou, Dionysios D
2015-05-01
Hepatotoxic microcystins (MCs) are the most frequently detected group of cyanobacterial toxins. This study investigated the degradation of common MC variants in water, MC-LR, MC-RR, MC-YR and MC-LA, by UV-254 nm-based processes, UV only, UV/H2O2, UV/S2O8(2-) and UV/HSO5(-). Limited direct photolysis of MCs was observed, while the addition of an oxidant significantly improved the degradation efficiency with an order of UV/S2O8(2-) > UV/HSO5(-) > UV/H2O2 at the same initial molar concentration of the oxidant. The removal of MC-LR by UV/H2O2 appeared to be faster than another cyanotoxin, cylindrospermopsin, at either the same initial molar concentration or the same initial organic carbon concentration of the toxin. It suggested a faster reaction of MC-LR with hydroxyl radical, which was further supported by the determined second-order rate constant of MCs with hydroxyl radical. Both isomerization and photohydration byproducts were observed in UV only process for all four MCs; while in UV/H2O2, hydroxylation and diene-Adda double bond cleavage byproducts were detected. The presence of a tyrosine in the structure of MC-YR significantly promoted the formation of monohydroxylation byproduct m/z 1061; while the presence of a second arginine in MC-RR led to the elimination of a guanidine group and the absence of double bond cleavage byproducts. It was therefore demonstrated in this study that the variable amino acids in the structure of MCs influenced not only the degradation kinetics but also the preferable reaction mechanisms. Copyright © 2015 Elsevier Ltd. All rights reserved.
Polarimetry of ST LMi (CW1103+254)
Energy Technology Data Exchange (ETDEWEB)
Cropper, M
1986-10-15
White-light simultaneous photometry and linear and circular polarimetry is presented for the AM Her type variable ST LMi. Linear polarization evident throughout the faint phase is tentatively attributed to electron scattering from gas in the accretion column at heights greater than 5 Rsub(wd) above the surface. The values of inclination and magnetic dipole offset are revised to take into account the height and extent of the cyclotron emission regions which are also determined. A model of two closely connected emitting regions is proposed to account for the asymmetries observed in the light curve and polarization data for this and other AM Her systems. The size of the soft X-ray pole cap is calculated. Various parameters such as masses, accretion rates and luminosities are calculated for the system.
16 CFR 254.0 - Scope and application.
2010-01-01
..., business, or clerical skills, or that is for the purpose of enabling a person to improve his appearance..., marketing, and sale of courses or programs of instruction offered by private vocational or distance...
36 CFR 254.20 - Purpose and scope.
2010-07-01
..., needed by a community, may be sold under the Townsite Act, for fair market value if those lands would serve indigenous community objectives that outweigh the public objectives and values of retaining the... projects that would change the character of the local community. ...
42 CFR 403.254 - Calculation of premiums.
2010-10-01
... rate credits. (4) Unearned premium reserve means the portion of gross premiums due that provide for...) Written premiums for the period; plus— (ii) The total premium reserve at the beginning of the period; less— (iii) The total premium reserve at the end of the period. (2) Written premiums in a period means— (i...
42 CFR 422.254 - Submission of bids.
2010-10-01
... principles. (i) A qualified actuary must certify the plan's actuarial valuation (which may be prepared by others under his or her direction or review). (ii) To be deemed a qualified actuary, the actuary must be a member of the American Academy of Actuaries. (iii) Applicants may use qualified outside actuaries...
da Costa, Marianges Zadrozny Gouvêa; Pires, Júlia Glória Lucatelli; Nasser, Paulo Dominguez; Ferreira, Camila da Silva; Teixeira, Ana Cristina de Sá; Paranaguá-Vezozzo, Denise Cerqueira; Guarita, Dulce Reis; Carrilho, Flair José; Ono, Suzane Kioko
2016-10-01
This study aimed to investigate the association between chronic pancreatitis and smoking or genetic mutations. The study sample comprised 148 patients with chronic pancreatitis, 110 chronic alcoholic subjects without pancreatic disease, and 297 volunteer blood donors. Of the patients with chronic pancreatitis, 74% had alcoholic etiology and 26% had idiopathic pancreatitis. The frequency of smoking was 91.4% in patients with alcoholic pancreatitis, higher than 73.3% in alcoholic subjects without pancreatitis (P pancreatitis and blood donors. The N34S mutation of serine peptidase inhibitor, Kazal type 1 (SPINK1) was found in 2.7% of patients with chronic alcoholic pancreatitis, in 5.3% of patients with idiopathic pancreatitis, and in 0.4% of blood donors (P = 0.02). The P55S mutation of SPINK1 was found in 2.7% of patients with alcoholic pancreatitis and in 0.7% of blood donors (P = 0.12). The R254W mutation of chymotrypsin C was found in 0.9% of patients with alcoholic pancreatitis, in 0.9% of chronic alcoholic subjects without pancreatitis, and in 0.4% of blood donors (P = 0.75). In all cases, the mutations were heterozygous. Smoking and the N34S mutation of SPINK1 were positively correlated with chronic pancreatitis.
International Nuclear Information System (INIS)
Behrens, R.G.; Roth, S.B.; Jones, S.R.
1991-01-01
Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig
Directory of Open Access Journals (Sweden)
Víctor Alfonso Solarte
Full Text Available Oral squamous cell carcinoma is the fifth most common epithelial cancer in the world, and its current clinical treatment has both low efficiency and poor selectivity. Cationic amphipathic peptides have been proposed as new drugs for the treatment of different types of cancer. The main goal of the present work was to determine the potential of LfcinB(20-254, a tetrameric peptide based on the core sequence RRWQWR of bovine lactoferricin LfcinB(20-25, for the treatment of OSCC. In brief, OSCC was induced in the buccal pouch of hamsters by applying 7,12-Dimethylbenz(aanthracene, and tumors were treated with one of the following peptides: LfcinB(20-254, LfcinB(20-25, or vehicle (control. Lesions were macroscopically evaluated every two days and both histological and serum IgG assessments were conducted after 5 weeks. The size of the tumors treated with LfcinB(20-254 and LfcinB(20-25 was smaller than that of the control group (46.16±4.41 and 33.92±2.74 mm3 versus 88.77±10.61 mm3, respectively. Also, LfcinB(20-254 caused acellularity in the parenchymal tumor compared with LfcinB(20-25 and vehicle treatments. Furthermore, our results demonstrated that both LfcinB(20-254 and LfcinB(20-25 induced higher degree of apoptosis relative to the untreated tumors (75-86% vs 8%, respectively. Moreover, although the lowest inflammatory response was achieved when LfcinB(20-254 was used, this peptide appeared to induce higher levels of IgG antibodies relative to the vehicle and LfcinB(20-25. In addition the cellular damage and selectivity of the LfcinB(20-254 peptide was evaluated in vitro. These assays showed that LfcinB(20-254 triggers a selective necrotic effect in the carcinoma cell line. Cumulatively, these data indicate that LfcinB(20-254 could be considered as a new therapeutic agent for the treatment of OSCC.
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available YYWRICASKGVKILLLGEYVLNLFFKEIENLPSNMVAEQSE 60 ... Query: 121 FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSAS...TFDSLNR 180 ... FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSASTFD...SLNR Sbjct: 121 FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSASTFDSLNR 180 ... Query: 241 XXXXXXXXXIRRSW 254 ... IRRSW Sbjct: 241 ELDQGYLEEIRRSW 254
2016-09-01
excitation of a sensor by independently calculable means may be possible. For example, pistonphones and electrostatic actuators are common devices for...the model RE-254, shown in Figure 17, which is manufactured by Audio Components DIY in Latvia. The RE-254 employs an aluminum foil, 2.5 microns thick...Aug. 7, 2016. [8] RE-254 ribbon microphone motor for DIY mic project. (n.d.); DiY Audio Components. [Online]. Available: http
Pagès, Jean; Torréton, Jean-Pascal; Sempéré, Richard
1997-06-01
Two surveys were carried out on ten atolls in the Tuamotu archipelago (French Polynesia, Pacific Ocean). In vitro UV (250-400 nm) spectra of water samples gave absorption at 254 nm, A 254, and spectrum slope, S ⋆ (computed from In A λ versus λ).These two descriptors are negatively correlated, and data points are arrayed along a hyperbola spanned between an oceanic pole (high S ⋆, low A 254) and a confined pole (low 5 ⋆, high A 254). Dissolved organic carbon (DOC) concentrations, [C], as assessed by HTCO, exhibit a narrow range (0.7-1.0 mg C.L -1 for most lagoons) contrasting with the wide diversity of optical characteristics. [C] and A 254 are positively correlated, with a significant intercept (0.5 mg C.L -1) representing non-chromophoric DOC. Carbon-specific absorption, ɛ 254 increases (from 0.4 to 1.3 m 2.g -1) with increasing [C], mainly according to the literature) owing to increased average molecular weight (MW) of the chromophoric DOC fraction, which also lowers S ⋆. Our optical data thus illustrate a gradient of confinement (or residence time) that corresponds to a continuum in DOC nature, especially in MW and hence in bioavailability. Optical methods are confirmed as quick and effective means of assessing DOM distribution.
International Nuclear Information System (INIS)
He, Xuexiang; Mezyk, Stephen P.; Michael, Irene; Fatta-Kassinos, Despo; Dionysiou, Dionysios D.
2014-01-01
Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S 2 O 8 2− . • 1.84 × 10 −14 M [HO • ] ss and 3.10 × 10 −13 M [SO 4 • − ] ss in UV/S 2 O 8 2− were estimated. • HO • reacted faster with the β-lactams than SO 4 • − but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H 2 O 2 and S 2 O 8 2− photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S 2 O 8 2− system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO 4 2− and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H 2 O 2 and UV/S 2 O 8 2− advanced oxidation processes (AOPs) are capable of degrading β-lactam antibiotics decreasing consequently the antibiotic activity of treated waters
Adaptive changes in NAD+ metabolism in ultraviolet light-irradiated murine lymphoma cells
International Nuclear Information System (INIS)
Kleczkowska, H.E.; Szumiel, I.; Althaus, F.R.
1990-01-01
We have determined the ability of UV254nm-irradiated murine lymphoma cells to adapt their NAD+ metabolism to the increased NAD+ consumption for the poly ADP-ribosylation of chromatin proteins. Two murine lymphoma sublines with differential UV-sensitivity and poly(ADP-ribose) turnover were used as a model system. The first subline, designated LY-R is UV254nm-sensitive and tumorigenic in DBA/2 mice. The second subline, LY-S is UV254nm-resistant and nontumorigenic. Following treatment of these cells with 2 mM benzamide, an inhibitor of the NAD(+)-utilizing enzyme poly(ADP-ribose) polymerase, NAD+ levels slowly increased up to about 160% of control levels after 3 hours. When benzamide was added to these cultures 20 min after UV254nm irradiation, a dramatic transient increase of NAD+ levels was observed within 4 min in LY-R cells and more moderately in LY-S cells. At later times after UV254nm irradiation, the NAD+ levels increased in both sublines reaching up to 200% of the concentrations prior to benzamide treatment. These results demonstrate an adaptative response of NAD+ metabolism to UV254nm irradiation. In parallel, we observed a differential repartitioning of ADP-ribosyl residues between the NAD+ and poly(ADP-ribose) pools of LY-R and LY-S cells that correlates with the differential UV sensitivity of these cells
Dimeric Structure of the Blue Light Sensor Protein Photozipper in the Active State.
Ozeki, Kohei; Tsukuno, Hiroyuki; Nagashima, Hiroki; Hisatomi, Osamu; Mino, Hiroyuki
2018-02-06
The light oxygen voltage-sensing (LOV) domain plays a crucial role in blue light (BL) sensing in plants and microorganisms. LOV domains are usually associated with the effector domains and regulate the activities of effector domains in a BL-dependent manner. Photozipper (PZ) is monomeric in the dark state. BL induces reversible dimerization of PZ and subsequently increases its affinity for the target DNA sequence. In this study, we report the analyses of PZ by pulsed electron-electron double resonance (PELDOR). The neutral flavin radical was formed by BL illumination in the presence of dithiothreitol in the LOV-C254S (without the bZIP domain) and PZ-C254S mutants, where the cysteine residue responsible for adduct formation was replaced with serine. The magnetic dipole interactions of 3 MHz between the neutral radicals were detected in both LOV-C254S and PZ-C254S, indicating that these mutants are dimeric in the radical state. The PELDOR simulation showed that the distance between the radical pair is close to that estimated from the dimeric crystal structure in the "light state" [Heintz, U., and Schlichting, I. (2016) eLife 5, e11860], suggesting that in the radical state, LOV domains in PZ-C254S form a dimer similar to that of LOV-C254S, which lacks the bZIP domain.
Czech Academy of Sciences Publication Activity Database
Uzagalieva, Ainura
-, č. 254 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : seigniorage * monetary integration * transition economies Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp254.pdf
Lifescience Database Archive (English)
Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x
Lifescience Database Archive (English)
Full Text Available IXIXIIX*xfyxilk*lviivshs lxpyisxxckgyd*ixxklfitrfmmvvxvhgqinhchlvvrasqvwwcfxsclqcxxcs gkecxiqrllvvfvkrygflkx...iihn**lllh*hnnkliq*lyhh *enqmllkhgwkl*ecv--- ---XLXPVQVXEPNFQMXXFHFXLXLETXFXXDFRRIXIXIIX*xfyxilk*lviivshs lxpyisxxc
40 CFR 180.254 - Carbofuran; tolerances for residues.
2010-07-01
...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances... than 1 ppm is carbamates) 2 12/31/09 Pumpkin (of which not more than 0.6 ppm is carbamates) 0.8 12/31...
7 CFR 1710.254 - Alternative sources of power.
2010-01-01
... proposals on an economic, present-value basis, giving consideration to cost-effectiveness, reliability of... reliability problems. (Approved by the Office of Management and Budget under control number 0572-0032) [57 FR...
Swelling of cross-linked polymers: interpretations and misinterpretations
Czech Academy of Sciences Publication Activity Database
Dušek, Karel; Dušková-Smrčková, Miroslava
2017-01-01
Roč. 254, 20 August (2017), s. 102 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : swelling * cross-linked polymer Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
Smart ampholytic ABC block copolypeptide
Czech Academy of Sciences Publication Activity Database
Schlaad, H.; Sun, J.; Černoch, Peter; Ruokolainen, J.
2017-01-01
Roč. 254, 20 August (2017), s. 79 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : block copolypeptide * smart ampholytic Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Characterization of a Viking Blade Fabricated by Traditional Forging Techniques
Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.
2016-12-01
A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
Czech Academy of Sciences Publication Activity Database
Dušková-Smrčková, Miroslava; Sadakbayeva, Zhansaya; Steinhart, Miloš; Šturcová, Adriana; Pfleger, Jiří; Dušek, Karel
2017-01-01
Roč. 254, 20 August (2017), s. 40 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : IPN * poly(2-hydroxyethyl methacrylate) * hydrogel Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
Fu, Jie; Lee, Wan-Ning; Coleman, Clark; Meyer, Melissa; Carter, Jason; Nowack, Kirk; Huang, Ching-Hua
2017-01-01
A pilot study employing two parallel trains of two-stage biofiltration, i.e., a sand/anthracite (SA) biofilter followed by a biologically-active granular activated carbon (GAC) contactor, was conducted to test the efficiency, feasibility and stability of biofiltration for removing natural organic matter (NOM) after coagulation in a drinking water treatment plant. Results showed the biofiltration process could effectively remove turbidity (24% of dissolved organic carbon (DOC), >57% of UV 254 , and >44% of SUVA 254 ), where the SA biofilters showed a strong capacity for turbidity removal, while the GAC contactors played the dominant role in NOM removal. The vertical profile of water quality in the GAC contactors indicated the middle-upper portion was the critical zone for the removal of NOM, where relatively higher adsorption and enhanced biological removal were afforded. Fluorescence excitation-emission matrix (EEM) analysis of NOM showed that the GAC contactors effectively decreased the content of humic-like component, while protein-like component was refractory for the biofiltration process. Nutrients (NH 4 -N and PO 4 -P) supplementation applied upstream of one of the two-stage biofiltration trains (called engineered biofiltration) stimulated the growth of microorganisms, and showed a modest effect on promoting the biological removal of small non-aromatic compositions in NOM. Redundancy analysis (RDA) indicated influent UV 254 was the most explanatory water quality parameter for GAC contactors' treatment performance, and a high load of UV 254 would result in significantly reduced removals of UV 254 and SUVA 254 . Copyright © 2016 Elsevier Ltd. All rights reserved.
78 FR 9056 - Agency Information Collection Activities: Proposed Collection; Comment Request
2013-02-07
... agent/brokers provided during training will be used to record their training history through CMS LMS... small business health options plan (SHOP) employers/employees through the Exchange. Additionally, CMS...: Private Sector: Business or other for-profits; Number of Respondents: 254,095; Total Annual Responses: 254...
International Nuclear Information System (INIS)
1994-01-01
The Director General received notes verbales dated 15 and 22 March 1994 from the Permanent Mission of South Africa providing information on the nuclear export policies and practices of the Government of South Africa. These notes verbales contain, in their attachments, copies of the relevant legislation and other documentation pertaining to South Africa's policy to act in accordance with the provisions of INFCIRC/254/Rev.1/Part 1 and INFCIRC/254/Rev.1/Part 1/Mod.1 and INFCIRC/254/Rev.1/Part 2 as amended. The documents are available on request from the Secretariat of the IAEA
Directory of Open Access Journals (Sweden)
Robert D Lagow
2007-04-01
Full Text Available Both constitutive secretion and Ca(2+-regulated exocytosis require the assembly of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE complexes. At present, little is known about how the SNARE complexes mediating these two distinct pathways differ in structure. Using the Drosophila neuromuscular synapse as a model, we show that a mutation modifying a hydrophobic layer in syntaxin 1A regulates the rate of vesicle fusion. Syntaxin 1A molecules share a highly conserved threonine in the C-terminal +7 layer near the transmembrane domain. Mutation of this threonine to isoleucine results in a structural change that more closely resembles those found in syntaxins ascribed to the constitutive secretory pathway. Flies carrying the I254 mutant protein have increased levels of SNARE complexes and dramatically enhanced rate of both constitutive and evoked vesicle fusion. In contrast, overexpression of the T254 wild-type protein in neurons reduces vesicle fusion only in the I254 mutant background. These results are consistent with molecular dynamics simulations of the SNARE core complex, suggesting that T254 serves as an internal brake to dampen SNARE zippering and impede vesicle fusion, whereas I254 favors fusion by enhancing intermolecular interaction within the SNARE core complex.
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium
Anumol, Tarun; Sgroi, Massimiliano; Park, Minkyu; Roccaro, Paolo; Snyder, Shane A
2015-06-01
This study investigated the applicability of bulk organic parameters like dissolved organic carbon (DOC), UV absorbance at 254 nm (UV254), and total fluorescence (TF) to act as surrogates in predicting trace organic compound (TOrC) removal by granular activated carbon in water reuse applications. Using rapid small-scale column testing, empirical linear correlations for thirteen TOrCs were determined with DOC, UV254, and TF in four wastewater effluents. Linear correlations (R(2) > 0.7) were obtained for eight TOrCs in each water quality in the UV254 model, while ten TOrCs had R(2) > 0.7 in the TF model. Conversely, DOC was shown to be a poor surrogate for TOrC breakthrough prediction. When the data from all four water qualities was combined, good linear correlations were still obtained with TF having higher R(2) than UV254 especially for TOrCs with log Dow>1. Excellent linear relationship (R(2) > 0.9) between log Dow and the removal of TOrC at 0% surrogate removal (y-intercept) were obtained for the five neutral TOrCs tested in this study. Positively charged TOrCs had enhanced removals due to electrostatic interactions with negatively charged GAC that caused them to deviate from removals that would be expected with their log Dow. Application of the empirical linear correlation models to full-scale samples provided good results for six of seven TOrCs (except meprobamate) tested when comparing predicted TOrC removal by UV254 and TF with actual removals for GAC in all the five samples tested. Surrogate predictions using UV254 and TF provide valuable tools for rapid or on-line monitoring of GAC performance and can result in cost savings by extended GAC run times as compared to using DOC breakthrough to trigger regeneration or replacement. Copyright © 2015 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Strange, Michael Stewart
2009-01-01
Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...
Czech Academy of Sciences Publication Activity Database
Filippov, Sergey K.; Kaberov, Leonid; Zhang, X.; Niebuur, B.-J.; Chytil, Petr; Etrych, Tomáš; Wieland, F.; Velychkivska, Nadiia; Starovoytova, Larisa; Svergun, D.; Papadakis, C.
2017-01-01
Roč. 254, 20 August (2017), s. 455 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : HPMA * human serum albumin * SAXS Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry
Learning Preference Models for Autonomous Mobile Robots in Complex Domains
2010-12-01
templates,” in IEEE/RSJ International Conference on Intelligent Robots and Systems, pp. 167–172, 2009. 128, 153 [254] J. Z. Kolter , P. Abbeel, and A. Y...92] Knepper, R. A. [246] Koller, D. [234] Kolter , J. Z. [254] Konolige, K. [148] Koutsougeras, C. [32] Krotkov, E. [96, 123, 178] Kuffner, J. [252
Czech Academy of Sciences Publication Activity Database
Kaberov, Leonid; Verbraeken, B.; Riabtseva, Anna; Brus, Jiří; Štěpánek, Petr; Hoogenboom, R.; Filippov, Sergey K.
2017-01-01
Roč. 254, 20 August (2017), s. 304 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : poly-2-oxazolines * triblocks * fluorinated Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry
The pin pixel detector--neutron imaging
Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Rhodes, N J; Schooneveld, E M; Simmons, J E; Stephenson, R
2002-01-01
The development and testing of a neutron gas pixel detector intended for application in neutron diffraction studies is reported. Using standard electrical connector pins as point anodes, the detector is based on a commercial 100 pin connector block. A prototype detector of aperture 25.4 mmx25.4 mm has been fabricated, giving a pixel size of 2.54 mm which matches well to the spatial resolution typically required in a neutron diffractometer. A 2-Dimensional resistive divide readout system has been adapted to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics. The timing properties of the device match well to the requirements of the ISIS-pulsed neutron source.
7 CFR 1220.254 - Patents, copyrights, inventions, and publications.
2010-01-01
...) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit of...
All projects related to | Page 254 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-02-10
related Violence in Mexico. Project. Violent conflict related to drug trafficking in Mexico has had a profound impact on the quality of life and health of affected communities. Start Date: February 10, 2012. End Date: May 10, 2014. Topic: NARCOTICS ...
24 CFR 92.254 - Qualification as affordable housing: Homeownership.
2010-04-01
... residents, percentage of owner-occupants) in relation to housing and incomes in the housing market area. An... public facilities and services. If a participating jurisdiction in preparing a neighborhood revitalization strategy under § 91.215(e)(2) of its consolidated plan or Empowerment Zone or Enterprise Community...
40 CFR 25.4 - Information, notification, and consultation responsibilities.
2010-07-01
... participation in all significant decisions covered by § 25.2(a), particularly where alternative courses of... shall highlight significant issues that will be the subject of decision-making. Whenever possible... distribution of information and must occur sufficiently in advance of decision-making to allow the agency to...
18 CFR 367.2540 - Account 254, Other regulatory liabilities.
2010-04-01
... accounts, imposed on the service company by the ratemaking actions of regulatory agencies. (See Definitions § 367.1(a)(38).) (b) The amounts included in this account are to be established by those credits which... authorized to charge for its services; or refunds to customers, not provided for in other accounts, will be...
40 CFR 98.254 - Monitoring and QA/QC requirements.
2010-07-01
...) Standard Test Method for Heat of Combustion of Liquid Hydrocarbon Fuels by Bomb Calorimeter (incorporated... methods. (1) ASTM D4809-06 Standard Test Method for Heat of Combustion of Liquid Hydrocarbon Fuels by Bomb...) Method 18 at 40 CFR part 60, appendix A-6. (2) ASTM D1945-03 Standard Test Method for Analysis of Natural...
International Nuclear Information System (INIS)
Lazarev, Yu.A.; Lobanov, Yu.V.; Sagajdak, R.N.; Utenkov, V.K.; Kharitonov, Yu.P.; Shirokovskij, I.V.; Tret'yakova, S.P.; Oganessyan, Yu.Ts.
1988-01-01
By employing the 249 Cf( 4 He, 3n) and 208 Pb( 48 Ca,2n) reactions, experiments to study the stability against spontaneous fission of the nuclides 250 Fm and 254 102 as well as of the two-quasi-particle (2 q-p) K isomers 250 Fm (T 1/2 =1,8±0,1 s) and 254 102 (T 1/2 =0,28±0,04 s) have been performed. The groundstate spontaneous fission of the two nuclides has been discovered and the corresponding branching ratios b sf and partial half-lives T sf , respectively, have been determined to be: (6,9±1,0)x10 -5 , 0,83±0,15 yr for 250 Fm; (1,7±0,5)x10 -3 , (3,2±0,9)x10 4 s for 254 102. As a by-product of these studies, new data about cross sections of the 206,208 Pb( 48 Ca,xn) reactions have been obtained. Experiments designed to search for the spontaneous fission of the 2 q-p K-isometric states in 250 Fm and 254 102 have not revealed the effect in question. The lower limits of the ratios of the partial spontaneous fission half-lives for the 2 q-p K-isomeric states to those for the respective ground states, T * sf /T sf , have been established to be≥10 -1 for 250m Fm/ 250 Fm and ≥5x10 -3 for 254m 102/ 254 102. This means that the stability of the 2 q-p K-isomeric states in 250 Fm and 254 102 against spontaneous fission is practically not inferior to that of the ground states of these nuclei. In accord with the experimental findings, the theoretical estimates of T * sf /T sf made in the present paper show that, due to the influence of the specialization and blocking effects on the potential energy and the effective mass associated with fission, spontaneous fission from 2 q-p K-isomeric states cannot be facilitated but, on the contrary, should be essentially hindered compared with ground-state spontaneous fission
The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests
International Nuclear Information System (INIS)
Raoelina Andriambololona
1976-01-01
Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr
IDENTITY THEFT SERVICES: Services Offer Some Benefits but Are Limited in Preventing Fraud
2017-03-01
17-254 Identity Theft Services standards. Those standards require that we plan and perform the audit to obtain sufficient, appropriate evidence to... audited financial statements. Page 34 GAO-17-254 Identity Theft Services Although the websites of many identity theft services ...reasonable assurance that significant decisions on the use of identity theft services are appropriately documented. We provided a draft of this
Energy Technology Data Exchange (ETDEWEB)
Tyrrell, R.M.; Werfelli, P.; Moraes, E.C. (Institut Suisse de Recherches Experimentales sur le Cancer, Lausanne)
1984-02-01
The repair proficient human lymphoblastoid line (TK6) has been employed to construct an action spectrum for the lethal action of ultraviolet (UV) radiation in the range 254 to 434 nm and to examine possible interactions between longer (334, 365 and 405 nm) and shorter wavelength (254 and 313 nm) radiations. The action spectrum follows a DNA absorption spectrum fairly closely out to 360 nm. As in previously determined lethal action spectra for procaryotic and eucaryotic cell populations, there is a broad shoulder in the 334 to 405 nm region which could reflect the existence of either (a) a non-DNA chromophore or (b) a unique photochemical reaction in the DNA over this region. Pre-treatment with radiation at 334 or 365 nm causes either a slight sensitivity to (low fluences) or protection from (higher fluences) subsequent exposure to radiation at a shorter wavelength (254 or 313 nm). Pre-irradiation at a visible wavelength (405 nm) at all fluence levels employed sensitizes the populations to treatment with 254 or 313 nm radiations. These interactions will influence the lethal outcome of cellular exposure to broad-band radiation sources.
Thin layer chromatographic analyses of pesticides in a soil ecosystem
International Nuclear Information System (INIS)
Afful, S.; Dogbe, S.A.; Ahmad, K.; Ewusie, A.T.
2008-01-01
Silica gel 60, silica gel 60 F 254 , and aluminium oxide as adsorbents were used to investigate their suitability for the analysis and detection of the pesticides: nitrofen, atrazine, diuron, dioxacarb, propoxur, propanil, carbaryl and cypermethrin in soil ecosystem using ethyl acetate, chloroform, dichloromethane and ethyl acetate/chloroform (1:1) as developing solvents. O-tolidine and potassium iodide reagent were used for the detection of pesticides. R f values obtained for the pesticides using the silica gel 60-ethyl acetate. silica gel 60F 254 -ethyl acetate, silica gel 60 chloroform, silica gel 60 F 254 - chloroform, silica gel 60 - (1:1) ethyl acetate/chloroform and silica gel 60 F 254 - (1:1) ethyl acetate/chloroform systems generally were within the stipulated range of 0.4-0.8. R f values obtained for the pesticides using silica gel 60-dichloromethane systems were very low except for cypermethrin and nitrofen. Analysis with aluminium oxide coated plates gave a heavy yellow background with the detection reagent making visualization of spots difficult. Aluminium oxide coated plate is, therefore, not recommended when o-tolidine plus potassium iodide is used as detection reagent. (au)
International Nuclear Information System (INIS)
Tyrrell, R.M.; Werfelli, P.; Moraes, E.C.
1984-01-01
The repair proficient human lymphoblastoid line (TK6) has been employed to construct an action spectrum for the lethal action of ultraviolet (UV) radiation in the range 254 to 434 nm and to examine possible interactions between longer (334, 365 and 405 nm) and shorter wavelength (254 and 313 nm) radiations. The action spectrum follows a DNA absorption spectrum fairly closely out to 360 nm. As in previously determined lethal action spectra for procaryotic and eucaryotic cell populations, there is a broad shoulder in the 334 to 405 nm region which could reflect the existence of either (a) a non-DNA chromophore or (b) a unique photochemical reaction in the DNA over this region. Pre-treatment with radiation at 334 or 365 nm causes either a slight sensitivity to (low fluences) or protection from (higher fluences) subsequent exposure to radiation at a shorter wavelength (254 or 313 nm). Pre-irradiation at a visible wavelength (405 nm) at all fluence levels employed sensitizes the populations to treatment with 254 or 313 nm radiations. These interactions will influence the lethal outcome of cellular exposure to broad-band radiation sources. (author)
The biogeochemical fingerprint of urbanization: increasing carbon quality in Maine headwater streams
Parr, T.; Cronan, C.; Ohno, T.; Simon, K. S.
2012-12-01
Conversion of land cover to urban use is an accelerating global phenomenon. Physical landscape change manifests as the replacement of forests, grasslands, and wetlands with buildings, novel vegetation, and infrastructure. This physical change also brings with it a change in the human management of the landscape for aesthetic and practical purposes (i.e. road salt applications). Although urbanization's effects on inorganic nutrients have been well studied, far less is known about the interactive influences of urbanization and urban landscape management practices on dissolved organic matter (DOM), a key energy source essential to ecosystem function. We examined the seasonal abundance and composition of DOM, nutrients, and common cations in 116 small streams along a gradient of urbanization (0-60% total watershed imperviousness, TWI), in Maine, USA. Dissolved organic carbon concentration ranged from 0.5 to 20 ppm with no clear relationship to watershed urbanization. In contrast, DOM composition, quantified with specific ultra violet absorbance at 254 nm (SUVA_{254}), fluorescence indices, and parallel factor analysis (PARAFAC), changed considerably with increasing urbanization. SUVA_{254} indicated a shift from higher molecular weight humic compounds (SUVA_{254}>4) toward lower molecular weight compounds (SUVA_{254}road salt application may mobilize base cations into streams draining urbanized watersheds. There was a strong negative relationship between humic-like DOM components and Ca^{2+} (R^2=0.3-0.5, psalts over a natural range (0 - 6 mM) showed that ^{2+} cations (esp. Ca^{2+}) preferentially flocculated the humic fraction of DOM (R^2=0.6-0.9, premoving terrestrial C from the aquatic DOM pool in urban landscapes.
Directory of Open Access Journals (Sweden)
Dongling Zhan
2013-12-01
Full Text Available The organophosphorous hydrolase (PTE from Brevundimonas diminuta is capable of degrading extremely toxic organophosphorous compounds with a high catalytic turnover and broad substrate specificity. Although the natural substrate for PTE is unknown, its loop remodeling (loop 7-2/H254R led to the emergence of a homoserine lactonase (HSL activity that is undetectable in PTE (kcat/km values of up to 2 × 104, with only a minor decrease in PTE paraoxonase activity. In this study, homology modeling and molecular dynamics simulations have been undertaken seeking to explain the reason for the substrate specificity for the wild-type and the loop 7-2/H254R variant. The cavity volume estimated results showed that the active pocket of the variant was almost two fold larger than that of the wild-type (WT enzyme. pKa calculations for the enzyme (the WT and the variant showed a significant pKa shift from WT standard values (ΔpKa = 3.5 units for the His254residue (in the Arg254 variant. Molecular dynamics simulations indicated that the displacement of loops 6 and 7 over the active site in loop 7-2/H254R variant is useful for N-acyl-L-homoserine lactone (C4-HSL with a large aliphatic chain to site in the channels easily. Thence the expanding of the active pocket is beneficial to C4-HSL binding and has a little effect on paraoxon binding. Our results provide a new theoretical contribution of loop remodeling to the rapid divergence of new enzyme functions.
Oloibiri, Violet; Ufomba, Innocent; Chys, Michael; Audenaert, Wim T M; Demeestere, Kristof; Van Hulle, Stijn W H
2015-09-01
The present work investigates the potential of coagulation-flocculation and ozonation to pretreat biologically stabilized landfill leachate before granular activated carbon (GAC) adsorption. Both iron (III) chloride (FeCl3) and polyaluminium chloride (PACl) are investigated as coagulants. Better organic matter removal is observed when leachate was treated with FeCl3. At a dose of 1mg FeCl3/mg CODo (CODo: initial COD content), the COD and α254 removal was 66% and 88%, respectively. Dosing 1mg PACl/mg CODo resulted in 44% COD and 72% α254 removal. The settle-ability of sludge generated by PACl leveled off at 252mL/g, while a better settle-ability of 154mL/g was obtained for FeCl3 after dosing 1mg coagulant/mg CODo. For ozonation, the percentage of COD and α254 removal increased as the initial COD concentration decreased. Respectively 44% COD and 77% α254 removal was observed at 112mg COD/L compared to 5% COD and 26% α254 removal at 1846mg COD/L. Subsequent activated carbon adsorption of ozonated, coagulated and untreated leachate resulted in 77%, 53% and 8% total COD removal after treatment of 6 bed volumes. Clearly showing the benefit of treating the leachate before GAC adsorption. Mathematical modeling of the experimental GAC adsorption data with Thomas and Yoon-Nelson models show that ozonation increases the adsorption capacity and breakthrough time of GAC by a factor of 2.5 compared to coagulation-flocculation. Copyright © 2015 Elsevier Ltd. All rights reserved.
Nogueira, A A; Bassin, J P; Cerqueira, A C; Dezotti, M
2016-05-01
The combination of biological and chemical oxidation processes is an interesting approach to remove ready, poor, and non-biodegradable compounds from complex industrial wastewaters. In this study, biofiltration followed by H2O2/UV oxidation (or microfiltration) and final reverse osmosis (RO) step was employed for tertiary treatment of an oil refinery wastewater. Biofiltration alone allowed obtaining total organic carbon (TOC), chemical oxygen demand (COD), UV absorbance at 254 nm (UV254), ammonium, and turbidity removal of around 46, 46, 23, 50, and 61 %, respectively. After the combined biological-chemical oxidation treatment, TOC and UV254 removal amounted to 88 and 79 %, respectively. Whereas, the treatment performance achieved with different UV lamp powers (55 and 95 W) and therefore distinct irradiance levels (26.8 and 46.3 mW/cm(2), respectively) were very similar and TOC and UV254 removal rates were highly affected by the applied C/H2O2 ratio. Silt density index (SDI) was effectively reduced by H2O2/UV oxidation, favoring further RO application. C/H2O2 ratio of 1:4, 55 W UV lamp, and 20-min oxidation reaction corresponded to the experimental condition which provided the best cost/benefit ratio for TOC, UV254, and SDI reduction from the biofilter effluent. The array of treatment processes proposed in this study has shown to be adequate for tertiary treatment of the oil refinery wastewater, ensuring the mitigation of membrane fouling problems and producing a final effluent which is suitable for reuse applications.
Antony Finto; Lewis Jordan; Laurence R. Schimleck; Alexander Clark; Ray A. Souter; Richard F. Daniels
2011-01-01
Modulus of elasticity (MOE), modulus of rupture (MOR), and specific gravity (SG) are important properties for determining the end-use and value of a piece of lumber. This study addressed the variation in MOE, MOR, and SG with physiographic region, tree height, and wood type. Properties were measured from two static bending samples (dimensions 25.4 mm à 25.4 mm à 406.4...
Maximum permissible concentration (MPC) values for spontaneously fissioning radionuclides
International Nuclear Information System (INIS)
Ford, M.R.; Snyder, W.S.; Dillman, L.T.; Watson, S.B.
1976-01-01
The radiation hazards involved in handling certain of the transuranic nuclides that exhibit spontaneous fission as a mode of decay were reaccessed using recent advances in dosimetry and metabolic modeling. Maximum permissible concentration (MPC) values in air and water for occupational exposure (168 hr/week) were calculated for 244 Pu, 246 Cm, 248 Cm, 250 Cf, 252 Cf, 254 Cf, /sup 254m/Es, 255 Es, 254 Fm, and 256 Fm. The half-lives, branching ratios, and principal modes of decay of the parent-daughter members down to a member that makes a negligible contribution to the dose are given, and all daughters that make a significant contribution to the dose to body organs following inhalation or ingestion are included in the calculations. Dose commitments for body organs are also given
Crevice Corrosion Behavior of 45 Molybdenum-Containing Stainless Steels in Seawater.
1981-12-01
Armco, Avesta Jernverks, Cabot, Carpenter Technology, Crucible, Eastern, Firth-Brown, Huntington, Jessup, Langley Alloys, and Uddeholm. 16...Department of Energy, Report ANL/OTEC-BCM-022. 7. Wallen, B., and M. Liljas, " Avesta 254 SMO - A New, High Molybdenum Stainless Steel," presented at NKM8...1977).; 11. Wallen, B., " Avesta 254 SMO - A Stainless Steel for Seawater Service," presented at the Advanced Stainless Steels for Turbine Condensors
Energy Technology Data Exchange (ETDEWEB)
He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Mezyk, Stephen P. [Department of Chemistry and Biochemistry, California State University Long Beach, 1250 Bellflower Blvd., Long Beach, CA 90840 (United States); Michael, Irene; Fatta-Kassinos, Despo [Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus)
2014-08-30
Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S{sub 2}O{sub 8}{sup 2−}. • 1.84 × 10{sup −14} M [HO{sup •} ]{sub ss} and 3.10 × 10{sup −13} M [SO{sub 4}{sup •} {sup −}]{sub ss} in UV/S{sub 2}O{sub 8}{sup 2−} were estimated. • HO{sup •} reacted faster with the β-lactams than SO{sub 4}{sup •} {sup −} but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H{sub 2}O{sub 2} and S{sub 2}O{sub 8}{sup 2−} photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S{sub 2}O{sub 8}{sup 2−} system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO{sub 4}{sup 2−} and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H{sub 2}O{sub 2} and UV/S{sub 2}O{sub 8}{sup 2−} advanced
Directory of Open Access Journals (Sweden)
Isti Koesharyani
2017-01-01
Full Text Available Spiny lobster (Panulirus homarus and Panulirus ornatus are important commodities for Indonesia. The aquaculture of lobster is susceptible for several diseases like parasite, fungi, bacteria, and virus. Among those diseases, milky haemolymph disease (MHD is often seen as a symptom to mass mortality occurred at lobster farms in Gerupuk Bay of Lombok. The purpose of this study was to determine the lobster diseases on cage culture in Gerupuk Bay of Lombok, West Nusa Tenggara. The study was undertaken from January to March 2015. Diseases status was determined by application of molecular plat-form, polymerase chain reaction (PCR with designation of specific primer for MHD (254F/R, 254F: 5’-CGA-GGA-CCA-GAG-ATG-GAC-CTT-3’ and 254R: 5’-GCT-CAT-TGT-CAC-CGC-CAT-TGT-3’ with PCR size product of 254 bp. and for cloned the pathogen was used TA-cloning Invitrogen for the DNA plasmid as positive control for other analysis. Several tissue samples i.e hepatopancreas, haemolymph, part of muscle hepatopancreas P. homarus and P. ornatus were taken from cage culture farms at Gerupuk Bay then preserved on 90% ethanol for further analysis by PCR and then the amplificated DNA were cloned into pCR®2.1 plasmid and transformed into competent E. coli. The result showed that almost all lobster samples from Gerupuk Bay were positive infected by MHD, as the results of PCR amplification whereas the band appeared at 254bp. Also MHD plasmid has been successfully cloned and will be used for further examination. Histopathologically in hepatopancreas infection have seen necrosis that contain numerous of rickettsia-like bacteria.
Energy Technology Data Exchange (ETDEWEB)
Liu, Wang-Rong; Ying, Guang-Guo, E-mail: guang-guo.ying@gig.ac.cn; Zhao, Jian-Liang; Liu, You-Sheng; Hu, Li-Xin; Yao, Li; Liang, Yan-Qiu; Tian, Fei
2016-11-15
Highlights: • Climbazole (CZ) could be effectively degraded under UV-254 irradiation. • CZ underwent direct and self-sensitized photolysis involving ROS. • The main photodegradation by-products of CZ were identified and semi-quantitated. • Pathway includes hydroxylative dechlorination, dechlorination, and de-pinacolone. • The toxicity of the photodegradation system reduced after UV-254 irradiation. - Abstract: Climbazole (CZ) has been known to persist in various environmental media, and may cause potential risks to aquatic organisms. This study investigated the photodegradation of CZ by ultraviolet (UV, 254 nm) under different conditions. The results revealed that CZ could be effectively degraded in aqueous solutions under UV-254 irradiation with a half-life of 9.78 min (pH = 7.5), and the photodegradation followed pseudo-first-order kinetics. pH had almost no effect on its rate constants and quantum yields; but the water quality of natural waters could affect the photolysis of CZ, and the coexisting constituents such as Fe{sup 3+}, NO{sub 3}{sup −}, and HA obviously inhibited its photolysis. The addition of different radical scavengers also inhibited the photodegradation of CZ due to the reduction of reactive oxygen species (ROS). CZ underwent direct and self-sensitized photolysis involving ROS. Based on the identified photodegradation by-products, the proposed pathways included hydroxylative dechlorination, dechlorination and de-pinacolone. Moreover, toxicity evaluation using duckweed found significant toxicity reduction in the photodegradation system of CZ after the irradiation of UV-254, and the remaining by-products did not pose extra toxicity compared with CZ itself. These findings from present study suggest that CZ in effluent could be further reduced by applying UV photolysis treatment.
Directory of Open Access Journals (Sweden)
Mohammad Abdolah zadeh
2009-06-01
Full Text Available Coagulation and flocculation are the principal units in water treatment processes. In this study, the Jar test was used to investigate the effects of the pH and TOC on FeCl3 and PACl coagulants for further removal of turbidity, organic matter, aluminum, total organic carbon (TOC, dissolved organic carbon (DOC, organic Aadsorption at a wavelength of 254 nm (UV254 nm , alkalinity, residual aluminum and ferric, total trihalomethans (TTHMs in the Karaj River in the year 2007- 2008. These experiments were conducted through a bench scale study using conventional coagulation in the influent to Tehran Water Treatment Plant No. 2 (TWTP2.With normal pH levels, PACl demonstrated more efficiency than FeCl3 in removing turbidity, TOC, UV254 nm, and TTHMs. The lower coagulant consumption, high floc size, lower floc detention time, lower sludge production, lack of the need for pH adjustment in turbidity of 25 NTU and the lower alum consumption were the advantages of PACl application instead of FeCl3 as a coagulant. Also, PACl application was efficient at low turbidity (2 NTU, average turbidity (6 NTU, and high turbidity (100 NTU in TOC, turbidity, UV254 nm , and DOC removal. Thus, PACl is an economical alternative as a coagulant in TWTP2.
Iranian Influence in Iraqi Shi’a Groups
2012-06-01
Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning
People and things. CERN Courier, May 1985, v. 25(4)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-05-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A workshop is being arranged to discuss the potential of the CERN SPS proton-antiproton Collider for the early 90s in view of the then simultaneous operation of the Tevatron at Fermilab, LEP at CERN and HERA at DESY, and to evaluate the need for a new Collider detector.
40 CFR 421.254 - Standards of performance for new sources.
2010-07-01
... property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0... Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of silver... average mg/troy ounce of gold refined electrolytically Lead 5.544 2.574 Mercury 2.970 1.188 Silver 5.742 2...
TASK 2.5.4 DEVELOPMENT OF AN ENERGY SAVINGS CALCULATOR
Energy Technology Data Exchange (ETDEWEB)
Miller, William A [ORNL; New, Joshua Ryan [ORNL; Desjarlais, Andre Omer [ORNL; Huang, Joe [Lawrence Berkeley National Laboratory (LBNL); Erdem, Ender [Lawrence Berkeley National Laboratory (LBNL); Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL)
2010-03-01
California s major energy utilities and the California Energy Commission (CEC) are seeking to allocate capital that yields the greatest return on investment for energy infrastructure that meets any part of the need for reliable supplies of energy. The utilities are keenly interested in knowing the amount of electrical energy savings that would occur if cool roof color materials are adopted in the building market. To meet this need the Oak Ridge National Laboratory and the Lawrence Berkeley National Laboratory (LBNL) have been collaborating on a Public Interest Energy Research (PIER) project to develop an industry-consensus energy-savings calculator. The task was coordinated with an ongoing effort supported by the DOE to develop one calculator to achieve both the DOE and the EPA objectives for deployment of cool roof products. Recent emphasis on domestic building energy use has made the work a top priority by the Department of Energy s (DOE) Building Technologies Program. The Roof Savings Calculator (RSC) tool is designed to help building owners, manufacturers, distributors, contractors and practitioners easily run complex simulations. The latest web technologies and usability design were employed to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on the best available statistical evidence and can provide energy and cost savings after the user selects nothing more than the building location. A key goal for the tool is to promote the energy benefits of cool color tile, metal and asphalt shingle roof products and other energy saving systems. The RSC tool focuses on applications for the roof and attic; however, the code conducts a whole building simulation that puts the energy and heat flows of the roof and attic into the perspective of the whole house. An annual simulation runs in about 30 sec. In addition to cool reflective roofs, the RSC tool will simulate high- medium- and low-slope roofs, and has a custom selection for the user whose house has a unique inclination. There is an option for above sheathing ventilation, which is prevalent in tile and stone-coated metal roof assemblies. The tool also accommodates the effects of radiant barriers and low-emittance surfaces in the inclined air space above the sheathing. The practitioner can select to have air-conditioning ducts either in the conditioned space or in the attic. If in the attic, the user can select one of three air leakage options. Option 1 is an inspected duct having 4% leakage and code level of duct insulation; option 2 is a poorly insulated duct having 14% air leakage; and option 3 is a custom leakage rate specified by the user. The practitioner can setup multiple layers of ceiling insulation. AtticSim is benchmarked against the field data acquired for Ft. Irwin located near Barstow, CA, first as a standalone simulation program and then again integrated within the DOE-2.1E program. The standalone benchmark was very useful to determining how well AtticSim replicates the building physics of an attic. The coupled benchmark was useful to verify that the DOE-2.1E/AtticSim code is modeling correctly the dynamic relationship between the attic and the occupied space below, as well as the interactions between the attic and the HVAC system, in particular when the ducts are located in the attic.
Rodríguez, Francisco J; Schlenger, Patrick; García-Valverde, María
2016-01-15
The main objective of this work is to conduct a comprehensive structural characterization of humic substances using the following experimental techniques: FTIR, 1H NMR and several UV–Vis parameters (Specific UV Absorbance at 254 nm or SUVA254, SUVA280, A400, the absorbance ratios A210/254, A250/365, A254/203, A254/436, A265/465, A270/400, A280/350, A465/665, the Absorbance Slope Index (ASI), the spectral slopes S275–295, S350–400 and the slope ratio SR). These UV–Vis parameters have also been correlated with key properties of humic substances such as aromaticity, molecular weight (MW) and trihalomethane formation potential (THMFP). An additional objective of this work is also to evaluate the usefulness of these techniques to monitor structural changes in humic substances produced by the ozonation treatment. Four humic substances were studied in this work: three of them were provided by the International Humic Substances Society (Suwannee River Fulvic Acid Standard: SRFA, Suwannee River Humic Acid Standard: SRHA and Nordic Reservoir Fulvic Acid Reference: NLFA) and the other one was a terrestrial humic acid widely used as a surrogate for aquatic humic substances in various studies (Aldrich Humic Acid: AHA). The UV–Vis parameters showing the best correlations with aromaticity in this study were SUVA254, SUVA280, A280/A350 ratio and A250/A364 ratio. The best correlations with molecular weight were for SUVA254, SUVA280 and A280/A350 ratio. Finally, in the case of the THMFP it was STHMFP-per mol HS the parameter showing good correlations with most of the UV–Vis parameters studied (especially with A280/A350 ratio, A265/A465 ratio and A270/A400 ratio) whereas STHMFP-per mg C showed poor correlations in most cases. On the whole, the UV–Vis parameter showing the best results was A280/A350 ratio as it showed excellent correlations for the three properties studied (aromaticity, MW and THMFP). A decrease in aromaticity following ozonation of humic substances can
Radiochemical studies of neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Moeser, Christina
2010-01-01
The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.
Directory of Open Access Journals (Sweden)
Julia Bock
2016-10-01
Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.
Time resolution measurements with an improved discriminator and conical scintillators
International Nuclear Information System (INIS)
McGervey, J.D.; Vogel, J.; Sen, P.; Knox, C.
1977-01-01
A new constant fraction discriminator with improved stability and walk characteristics is described. The discriminator was used with RCA C31024 photomultiplier tubes to test scintillators of conical and cylindrical shapes. Conical scintillators of 2.54 cm base diameter, 1.0 cm top diameter, and 2.54 cm height gave a fwhm of 155 ps for 60 Co gamma rays; larger conical scintillators gave an improvement of 10-15% in fwhm over cylindrical scintillators of equal volume. (Auth.)
UV-radiation and the flavonoid content in callus culture of Ononis arvensis L
International Nuclear Information System (INIS)
Tumowa, L.; Psotowa, R.
1998-01-01
The paper discussed a possible influence on the production of secondary metabolites - the flavonoids, by the method of elicitation in the callus cultures of Ononis arvensis L., the elicitor employed being the UV 254 and 366 nm and the sun-lamp. In some cases there was an increase in the production of flavonoids particularly 60, 120, 240 and 300 s after sun-lamp irradiation and in case of 15 and 30 min irradiation with UV-254 nm
Therapeutic Efficacy of the Small Molecule GS-5734 against Ebola virus in Rhesus Monkeys
2016-03-02
culture. The diastereomeric mixture at phosphorous 858 containing GS-5734 was incubated continuously for 72 h at 1 µM and levels of intracellular NTP...constants (J) in Hertz. Analytical thin–layer chromatography was performed using Merck KGaA Silica gel 60 F254 glassplates with UV visualization. Preparative...trifluoroacetic acid in water and 0.1% trifluoroacetic acid in acetonitrile; flow rate, 2 mL/min; acquisition time, 6 min; wavelength, UV 214 and 254 nm
A preliminary parasitological survey of hepatozoon spp. Infection in dogs in mashhad, iran.
Amoli, Aa Rahmani; Khoshnegah, J; Razmi, Ghr
2012-01-01
We attempted to determine the prevalence of Hepatozoon spp. infection in Mashhad, northeast of Iran, via blood smear parasitology. The prevalence was investigated by examination of blood smear parasitology, using blood samples collected from 254 dogs (51 strays and 203 privately owned-dogs). Two stray dogs (2/51; 3.92%) and two privately-owned dogs (2/203; 0.98%) were infected with Hepatozoon spp. Therefore, as per blood smear parasitology, the prevalence of Hepatozoon spp. infection was 1.57% (4/254). Sixteen out of 254 dogs (6.29%) were infested with ticks; all of which were Rhipicephalus sanguineus. One of the dogs infected with Hepatozoon spp. exhibited ticks at the time of examination. Concurrent infection with Ehrlichia canis and Leishmania infantum was not detected in the four Hepatozoon spp. infected dogs. This is the first epidemiological study on the prevalence of Hepatozoon spp. infection in dogs in Iran.
Nuclear reactions and the synthesis of new species
International Nuclear Information System (INIS)
Anon.
1983-01-01
Targets of relatively short-lived, neutron-rich transplutonium isotopes, such as 254 Es, which are produced by the HFIR/TRU, when combined with the capabilities of modern heavy-ion accelerators, offer a unique possibility to expand our knowledge of chemical elements and atomic nuclei toward the limits of nuclear stability. This knowledge should enable us to delineate the forces that eventually terminate the periodic table at its upper end. Specifically, the panel concludes that significant research opportunities exist in several areas, which are highlighted below: Nucleon-transfer reactions between light heavy-ion projectiles (such as 18 O, 22 Ne, or 48 Ca) and 254 Es targets will give access to a completely uncharted region of neutron-rich isotopes. Cold-fusion reactions of 48 Ca projectiles with /sup 254,255/Es targets should yield superheavy nuclei with neutron numbers very close to the predicted closed neutron shell at N = 184
Energy Technology Data Exchange (ETDEWEB)
Shen, Hong, E-mail: song.wei0326@163.com [National Engineering Research Center for Urban Pollution Control, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China); Chen, Xin, E-mail: 742702437@qq.com [National Engineering Research Center for Urban Pollution Control, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China); Zhang, Dong, E-mail: zhdongtj7021@sina.com [National Engineering Research Center of Urban Water Resources, Shanghai National Engineering Research Center of Urban Water Resources Co. Ltd, Shanghai 200082 (China); Chen, Hong-bin, E-mail: hbctxc@tongji.edu.cn [National Engineering Research Center for Urban Pollution Control, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China)
2016-11-01
In order to improve our understanding of bio-activated carbon (BAC) filter, the water quality of influent and effluent treated with BAC in a drinking water treatment plant (DWTP) of Shanghai during 2015 was valued. Combining the results from UV{sub 254}, SUVA{sub 254}, dissolved organic carbon (DOC) and scanning electron microscopic (SEM), it is found that performance of BAC treatment will be affected by characteristics of activated carbon (AC), which is relevant to the type of activated carbon (including shape and operating time) in this study. Fluorescence excitation–emission matrix (FEEM) shows that the humification index (HIX) and index of recent autochthonous contribution (BIX) is a reliable indicator to descript the variation of dissolved organic matter (DOM) during BAC process. The pattern of variation in BIX and HIX implies that soluble microbial products (SMPs) are formed and humic-like substances are removed during BAC treatment, which is also confirmed by the change of peaks of FEEM in BAC effluent. Large, positive correlations between SUVA{sub 254} and disinfection by-products formation potential yield (DBPFP yield) demonstrate that UV-absorbing DOM is directly related to the generation of DBPs. Poor correlations of HIX with DBPFP suggest that non-humic substances with UV-absorbing properties play an important role in the generation of DBPs in water with low SUVA{sub 254}. Finally, strong but negative correlations between BIX and DBPFP suggest that vigorous microbial metabolism of BAC results in a decrease in DBPFP. However, the DBPFP yield will be enhanced for the generation of SMPs by BAC, especially in summer. - Highlights: • SMPs can be produced by BAC during drinking water advanced treatment. • BAC can reduce DBPFP, while there are risks associated with increasing DBPFP yield. • SUVA{sub 254} is strongly correlated with the DBPFP yields. • BIX is strongly correlated with DBPFP and THMFP, but weakly with HAAFP.
Bener, Abdulbari; Khattab, Azhar O.; Al-Dabbagh, Mohamad M.
2014-01-01
Aim: To determine the association between Vitamin D and autism, and the difference in level of Vitamin D in autism children and control. Design: Case–control study conducted between June 2011 and May 2013, among autism at the Hamad Medical Corporation and controls at the School Health Clinics and Primary Health Care Clinics Subjects and Methods: A total of 254 cases and 254 controls. The Autism Diagnostic Observation Schedule-Generic is a semi-structured, standardized assessment of social interaction, communication, play and imaginative use of materials for individuals suspected of having autism spectrum disorders. Data on clinical manifestations and laboratory, family history, body mass index (BMI) and clinical biochemistry variables including serum 25-hydroxy Vitamin D, calcium, phosphorus and magnesium were obtained. Univariate and multivariate statistical analyzes were performed. Results: Of the total number of 508 children surveyed, 254 of autism and 254 of healthy children were contacted. The mean age (± standard deviation, in years) for autism versus control children was 5.51 ± 1.58 versus 5.76 ± 1.56. There were statistically significant differences between autism and healthy children control subjects with respect to educational level of mother (P = 0.016); occupation of mother (P = 0.005); BMI (P 30 ng/ml). Similarly, of the total 254 of healthy children 8.3% had severe Vitamin D deficiency (30 ng/ml). Furthermore, there was statistically significant differences between autism and control subjects with respect to the serum level of Vitamin D (P = 0.023). Conclusion: The present study revealed that Vitamin D deficiency was higher in autism children compared to healthy children and supplementing infants with Vitamin D might be a safe and more effective strategy for reducing the risk of autism. PMID:25624924
International Nuclear Information System (INIS)
Zelle, B.; Reynolds, R.J.; Kottenhagen, M.J.; Schuite, A.; Lohmann, P.H.M.
1980-01-01
Chinese hamster ovary cells were used to compare the cytotoxicity and mutagenicity of far-UV radiation emitted by a low-pressure mercury, germicidal lamp (wavelength predominantly 254 nm) with that of near UV radiation emitted by a fluorescent lamp with a continuous spectrum (Westinghouse Sun Lamp), of which only the radiation with wavelengths greater than 290 nm or greater than 310 nm was transmitted to the cells. The radiation effects were compared on the basis of an equal number of pyrimidine dimers, the predominant lesion induced in DNA by far-UV, for the induction of which much more energy is needed with near-UV than with 254-nm radiation. The numbers of dimers induced were determined by a biochemical method detecting UV-endonuclease-susceptible sites. The equivalence of these sites with pyrimidine dimers was established, qualitatively and quantitatively, in studies with enzymic photoreactivation in vitro and chromatographic analysis of dimers. On the basis of induced dimers, more cells were killed by UE 310-nm UV than by UE 290-nm UV; both forms of radiation were more cytotoxic than 254-nm UV when equal numbers of dimers were induced. Moreover, 5-6 times as many mutants were induced per dimer by UE 310-nm UV than by UE 290-nm UV; the latter appeared approximately as mutagenic as 254-nm UV. The differences in lethality and mutagenicity were not caused by differences in repair of dimers: cells with an equal number of dimers induced by either 254-nm or near-UV showed the same removal of sites susceptible to a UV endonuclease specific for dimers, as well as an identical amount of repair replication. The results indicate that near-UV induces, besides pyrimidine dimers, other lesions that appear to be of high biological significance. (orig.)
The Association between Oxidative Stress and Metabolic Syndrome in Adults
Chung, So-Won; Kang, Sung-Goo; Rho, Jun-Seung; Kim, Ha-Na; Song, In-Sun; Lee, Yun-Ah; Heo, Soo-Jeong; Song, Sang-Wook
2013-01-01
Background In this Study, we investigated the effects of lifestyle and metabolic syndrome on free oxygen radical levels in men and women in Korea. Methods A total of 254 adults were included in this study from February 2011 to June 2012 at a health promotion center. Information of the lifestyles and presence of metabolic syndrome factors was obtained. Biochemical markers were measured and free oxygen radicals test (FORT) was performed on the blood. Results Of the 254 subjects, 86 (33.9%) had ...
Conversion electron spectroscopy in transfermium nuclei
International Nuclear Information System (INIS)
Herzberg, R.D.
2003-01-01
Conversion electron spectroscopy is an essential tool for the spectroscopy of heavy deformed nuclei. The conversion electron spectrometer SACRED has been used in conjunction with the gas-filled recoil separator RITU to study conversion electron cascades in 254 No. The spectra reveal the ground state rotational bands down to low spin. A detailed analysis of the background seen for 254 No shows that approximately 40% of the decay path goes via excited high K bands which may be built on an isomer. (orig.)
Test Methods for Measuring Material Properties of Composite Materials in all Three Material Axes
2012-01-24
eccentricities in the test setup. Therefore, the research team purchased a special test fixture for performing out-of-plane tension testing in which the...coated wheels as shown in Figure 6. The 15.2 cm long by 2.54 cm thick blocks were separated into five pieces, each with a length of 2.67 cm using the...composite plate. Figure 6. Blocks reduced to a thickness of 2.54 cm using surface grinder and custom electro plated diamond coated wheels Figure 7
Ultraviolet absorbance as a proxy for total dissolved mercury in streams
Dittman, J.A.; Shanley, J.B.; Driscoll, C.T.; Aiken, G.R.; Chalmers, A.T.; Towse, J.E.
2009-01-01
Stream water samples were collected over a range of hydrologic and seasonal conditions at three forested watersheds in the northeastern USA. Samples were analyzed for dissolved total mercury (THgd), DOC concentration and DOC composition, and UV254 absorbance across the three sites over different seasons and flow conditions. Pooling data from all sites, we found a strong positive correlation of THgd to DOC (r2 = 0.87), but progressively stronger correlations of THgd with the hydrophobic acid fraction (HPOA) of DOC (r2 = 0.91) and with UV254 absorbance (r2 = 0.92). The strength of the UV254 absorbance-THgd relationship suggests that optical properties associated with dissolved organic matter may be excellent proxies for THgd concentration in these streams. Ease of sample collection and analysis, the potential application of in-situ optical sensors, and the possibility for intensive monitoring over the hydrograph make this an effective, inexpensive approach to estimate THgd flux in drainage waters. ?? 2009 Elsevier Ltd.
Remoción de sustancias húmicas por coagulación con alumbre
Directory of Open Access Journals (Sweden)
Miller Camargo Valero
1999-09-01
Full Text Available En la búsqueda de mejores condiciones para remover material precursor en la formación de subproductos de desinfección con cloro libre, se encontró que la absorbancia al ultravioleta a 254 nm (AUV 254 nm es un parámetro que puede ser usado como medida no específica para estimar concentraciones de material precursor, específicamente sustancias húmicas, y además, como instrumento de control en las operaciones y procesos previos a la desinfección con cloro libre. El estudio plantea la importancia para que en los ensayos de tratabilidad de agua para potabilización se incluya la AUV 254 nm como parámetro de control, ya que en ensayos de coagulación con alumbre se encontró que la remoción de estas sustancias depende de la dosis de coagulante y el pH de coagulación.
Stretchable microelectrode array using room-temperature liquid alloy interconnects
International Nuclear Information System (INIS)
Wei, P; Ziaie, B; Taylor, R; Chung, C; Higgs, G; Pruitt, B L; Ding, Z; Abilez, O J
2011-01-01
In this paper, we present a stretchable microelectrode array for studying cell behavior under mechanical strain. The electrode array consists of gold-plated nail-head pins (250 µm tip diameter) or tungsten micro-wires (25.4 µm in diameter) inserted into a polydimethylsiloxane (PDMS) platform (25.4 × 25.4 mm 2 ). Stretchable interconnects to the outside were provided by fusible indium-alloy-filled microchannels. The alloy is liquid at room temperature, thus providing the necessary stretchability and electrical conductivity. The electrode platform can withstand strains of up to 40% and repeated (100 times) strains of up to 35% did not cause any failure in the electrodes or the PDMS substrate. We confirmed biocompatibility of short-term culture, and using the gold pin device, we demonstrated electric field pacing of adult murine heart cells. Further, using the tungsten microelectrode device, we successfully measured depolarizations of differentiated murine heart cells from embryoid body clusters
A Preliminary Parasitological Survey of Hepatozoon Spp. Infection in Dogs in Mashhad, Iran
Directory of Open Access Journals (Sweden)
J Khoshnegah
2012-12-01
Full Text Available Background: We attempted to determine the prevalence of Hepatozoon spp. infection in Mashhad, northeast of Iran, via blood smear parasitology.Methods: The prevalence was investigated by examination of blood smear parasitology, using blood samples collected from 254 dogs (51 strays and 203 privately owned-dogs.Results: Two stray dogs (2/51; 3.92% and two privately-owned dogs (2/203; 0.98% were infected with Hepatozoon spp. Therefore, as per blood smear parasitology, the prevalence of Hepatozoon spp. infection was 1.57% (4/254. Sixteen out of 254 dogs (6.29% were infested with ticks; all of which were Rhipicephalus sanguineus. One of the dogs infected with Hepatozoon spp. exhibited ticks at the time of examination. Concurrent infection with Ehrlichia canis and Leishmania infantum was not detected in the four Hepatozoon spp. infected dogs.Conclusion: This is the first epidemiological study on the prevalence of Hepatozoon spp. infection in dogs in Iran.
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2 [es
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2 [fr
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2
UV sensitivity of various solid state detectors
International Nuclear Information System (INIS)
Knezevic, Zeljka; Ranogajec-Komor, Maria; Miljanic, Saveta
2008-01-01
Full text: The light sensitivity is an important characteristic of solid state passive dosimeters used in individual, clinical and environmental dosimetry. Light sensitivity stands for the response directly induced by visible or UV light in a fully annealed material. For the above mentioned applications a negligible light sensitivity is an advantage. However, high light sensitivity and linear response allows the use of detectors as UV dosimeters. For this purpose various TL detectors and the glass element of the RPL dosemeter type SC-1 were systematically investigated after exposure to UV light (254 and 366 nm) as a function of time. The following solid state detectors were investigated relative to TLD-100: Li 2 B 4 O 7 :Cu,Ag,P LiF:Mg,Cu,P, LiF:Mg,Cu,Si, Al 2 O 3 :C and the glass element of RPL dosimeter. UV irradiations were performed with Camag UV lamp at 254 nm and at 366 nm. The illumination times were 5, 10 and 20 minutes. Day light illumination was also carried out at room temperature over time period of several hours up to 2 weeks. The UV light response of each detector was compared to the response obtained after irradiation with 137 Cs. Al 2 O 3 :C, showed high light sensitivity; after 10 minutes illumination with 254 nm UV light the response was equivalent to 130 mGy 137 Cs gamma irradiation. The 254 nm UV response of LiF:Mg,Cu,P (GR-200 A), as well as TLD-700H and Li 2 B 4 O 7 :Cu,Ag,P were proportional to the time of illumination. The responses after 10 min UV illumination were equivalent to 0.001 mGy, 0.01 mGy and 0.1 mGy 137 Cs gamma irradiation, respectively. The complete SC-1 RPL dosimeter is insensitive to light because the glass element is encapsulated in light protected holder throughout the automatic evaluation process following the annealing (irradiation, preheat, readout). The responses of the previously annealed glass element after 20 min illumination with 254 nm and 366 nm UV light were equivalent to 45μSv and 3 μSv of 137 Cs gamma
Fan, Jun; Li, Haibo; Shuang, Chendong; Li, Wentao; Li, Aimin
2014-08-01
This study investigated the removal of dissolved organic matter (DOM) from real dyeing bio-treatment effluents (DBEs) with the use of a novel magnetic anion exchange resin (NDMP). DOMs in two typical DBEs were fractionized using DAX-8/XAD-4 resin and ultrafiltration membranes. The hydrophilic fractions and the low molecular weight (MW) (50%) of DOMs for the two effluents. The hydrophilic and low MW fractions of both effluents were the greatest contributors of specific UV254 absorbance (SUVA254), and the SUVA254 of DOM fractions decreased with hydrophobicity and MW. Two DBEs exhibited acute and chronic biotoxicities. Both acute and chronic toxicities of DOM fractions increased linearly with the increase of SUVA254 value. Kinetics of dissolved organic carbon (DOC) removal via NDMP treatment was performed by comparing it with that of particle active carbon (PAC). Results indicated that the removal of DOC from DBEs via NDMP was 60%, whereas DOC removals by PAC were lower than 15%. Acidic organics could be significantly removed with the use of NDMP. DOM with large MW in DBE could be removed significantly by using the same means. Removal efficiency of NDMP for DOM decreased with the decrease of MW. Compared with PAC, NDMP could significantly reduce the acute and chronic bio-toxicities of DBEs. NaCl/NaOH mixture regenerants, with selected concentrations of 10% NaCl (m/m)/1% NaOH (m/m), could improve desorption efficiency. Copyright © 2014. Published by Elsevier B.V.
Actinopolyspora biskrensis sp. nov., a novel halophilic actinomycete isolated from Northern Sahara.
Saker, Rafika; Bouras, Noureddine; Meklat, Atika; Zitouni, Abdelghani; Schumann, Peter; Spröer, Cathrin; Klenk, Hans-Peter; Sabaou, Nasserdine
2015-03-01
A novel halophilic, filamentous actinomycete, designated H254(T), was isolated from a Saharan soil sample collected from Biskra (Northern Sahara), and subjected to a polyphasic taxonomic characterization. The strain is Gram-positive, aerobic, and halophilic, and the optimum NaCl concentration for growth is 15-20 % (w/v). The cell-wall hydrolysate contained meso-diaminopimelic acid, and the diagnostic whole-cell sugars were arabinose and galactose. The diagnostic phospholipid detected was phosphatidylcholine, and MK-9(H4) was the predominant menaquinone. The major fatty acid profiles were anteiso-C17:0 (32.8 %), C15:0 (28 %), and iso-C17:0 (12.3 %). Comparative analysis of the 16S rRNA gene sequences revealed that the strain H254(T) formed a well-separated sub-branch within the radiation of the genus Actinopolyspora, and the microorganism was most closely related to Actinopolyspora saharensis DSM 45459(T) (99.2 %), Actinopolyspora halophila DSM 43834(T) (99.1 %), and Actinopolyspora algeriensis DSM 45476(T) (99.0 %). Nevertheless, the strain had relatively lower mean values for DNA-DNA relatedness with the above strains (57.2, 68.4, and 45.6 %, respectively). Based on phenotypic features and phylogenetic position, we propose that strain H254(T) represents a novel species of the genus Actinopolyspora, for which the name Actinopolyspora biskrensis sp. nov. is proposed. The type strain of A. biskrensis is strain H254(T) (=DSM 46684(T) =CECT 8576(T)).
International Nuclear Information System (INIS)
Ishikawa, T.; Kodama, K.; Matsumoto, J.; Takayama, S.
1984-01-01
We previously developed a quantitative autoradiographic technique with special forceps for measuring unscheduled DNA synthesis (UDS) in mouse skin after treatment with ultraviolet light in vivo. By this method, we investigated the relationship between the protective role of melanin and UV-induced DNA repair in black-and-white guinea pigs. Flat areas containing a sharp border between pigmented and unpigmented skin were selected. The skin of the selected areas was shaved and irradiated with short-wave UV (254 nm) or UV-AB (270 to 440 nm, emission peak at 312 nm) at various doses. Immediately after irradiation, the skin was clamped off with forceps, and an isotonic aqueous solution of [methyl- 3 H]thymidine was injected s.c. into the clamped off portion. UDS was clearly demonstrated as silver grains in this portion of the skin after irradiation with 254 nm UV or UV-AB. Errors due to individual differences were avoided by comparing the intensities of UDS in basal cells from pigmented skin and unpigmented skin of the same animals. Unexpectedly, in groups of animals treated with 254 nm UV or UV-AB, no difference in UDS in pigmented and unpigmented skin was seen at any UV dose. These results suggested that epidermal melanin granules do not significantly protect DNA of basal cells against 254 nm UV or UV-AB irradiation. Results of a study on the effect of the wavelength of irradiation on the UDS response of albino guinea pigs are also reported
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 309 ... Query: 254 LRPGEQVQIDTTRLDIMAILEDGSLGRPELTIAVDVATRSILAAVLRPYSTKAVDAALLL 313 ... LRPGEQVQIDTTRLDIMAIL...EDGSLGRPELTIAVDVATRSILAAVLRPYSTKAVDAALLL Sbjct: 1 ... LRPGEQVQIDTTRLDIMAILEDGSLGRPELTIAVDVA
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 98 ... Query: 254 IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 313 ... IVAAARDYVLAHRSRP...VGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD Sbjct: 1 ... IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 60 ...
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-06-19
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2.
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-06-19
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2.
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2
Indian Academy of Sciences (India)
2. 2.92. 2.44. 1.25. 2.54. 3.66. C57B3. 2.97. 2.44. 1.25. 2.54. 3.49. C60. LiAlH4. 2.91. 2.60. 1.64. 2.36. 3.37. C59B. 2.76. 2.63. 1.63. 2.36. 3.47. C58B2. 2.80. 2.64. 1.65. 2.32. 3.49. C57B3. 2.72. 2.61. 1.64. 2.32. 3.47. C60. LiBH4. 2.20. 2.20. 1.26.
AAS determination of total mercury content in environmental samples
International Nuclear Information System (INIS)
Moskalova, M.; Zemberyova, M.
1997-01-01
Two methods for determination of total mercury content in environmental samples soils, and sediments, were compared. Dissolution procedure of soils, sediments, and biological material under elevated pressure followed by determination of mercury by cold vapour atomic absorption spectrometry using a MHS-1 system and direct total mercury determination without any chemical pretreatment from soil samples using a Trace Mercury Analyzer TMA-254 were compared. TMA-254 was also applied for the determination of mercury in various further standard reference materials. Good agreement with certified values of environmental reference materials was obtained. (authors)
Reflective optical imaging system for extreme ultraviolet wavelengths
Viswanathan, V.K.; Newnam, B.E.
1993-05-18
A projection reflection optical system has two mirrors in a coaxial, four reflection configuration to reproduce the image of an object. The mirrors have spherical reflection surfaces to provide a very high resolution of object feature wavelengths less than 200 [mu]m, and preferably less than 100 [mu]m. An image resolution of features less than 0.05-0.1 [mu]m, is obtained over a large area field; i.e., 25.4 mm [times] 25.4 mm, with a distortion less than 0.1 of the resolution over the image field.
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AIVKGYFADQLQQYFLSHGVSSAIIDLGGNVLTIGRQPETLE 180 ... Query: 254 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSV...LMTSKMQKY 311 ... ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298
International Nuclear Information System (INIS)
Shen, Hong; Chen, Xin; Zhang, Dong; Chen, Hong-bin
2016-01-01
In order to improve our understanding of bio-activated carbon (BAC) filter, the water quality of influent and effluent treated with BAC in a drinking water treatment plant (DWTP) of Shanghai during 2015 was valued. Combining the results from UV_2_5_4, SUVA_2_5_4, dissolved organic carbon (DOC) and scanning electron microscopic (SEM), it is found that performance of BAC treatment will be affected by characteristics of activated carbon (AC), which is relevant to the type of activated carbon (including shape and operating time) in this study. Fluorescence excitation–emission matrix (FEEM) shows that the humification index (HIX) and index of recent autochthonous contribution (BIX) is a reliable indicator to descript the variation of dissolved organic matter (DOM) during BAC process. The pattern of variation in BIX and HIX implies that soluble microbial products (SMPs) are formed and humic-like substances are removed during BAC treatment, which is also confirmed by the change of peaks of FEEM in BAC effluent. Large, positive correlations between SUVA_2_5_4 and disinfection by-products formation potential yield (DBPFP yield) demonstrate that UV-absorbing DOM is directly related to the generation of DBPs. Poor correlations of HIX with DBPFP suggest that non-humic substances with UV-absorbing properties play an important role in the generation of DBPs in water with low SUVA_2_5_4. Finally, strong but negative correlations between BIX and DBPFP suggest that vigorous microbial metabolism of BAC results in a decrease in DBPFP. However, the DBPFP yield will be enhanced for the generation of SMPs by BAC, especially in summer. - Highlights: • SMPs can be produced by BAC during drinking water advanced treatment. • BAC can reduce DBPFP, while there are risks associated with increasing DBPFP yield. • SUVA_2_5_4 is strongly correlated with the DBPFP yields. • BIX is strongly correlated with DBPFP and THMFP, but weakly with HAAFP.
Spectroscopy of odd-proton nuclei in the region of 254No
International Nuclear Information System (INIS)
Ketelhut, S.; Greenlees, P. T.; Eeckhaudt, S.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Leino, M.; Leppaenen, A.-P.; Nieminen, P.; Nyman, M.; Perkowski, J.; Rahkila, P.; Saren, J.; Scholey, C.; Uusitalo, J.; Chatillon, A.; Bouchez, E.; Clement, E.; Goergen, A.
2008-01-01
Two rotational bands have been found in the transfermium nuclei 251 Md and 255 Lr, the latter being the heaviest nucleus so far studied in-beam. Both are assigned to a [521]1/2 - Nilsson state by comparison to theory. The experiments have been carried out in the Accelerator Laboratory of the University of Jyvaeskylae (JYFL), where the array of germanium detectors JUROGAM was used in conjunction with the recoil-seperator RITU and the focal-plane setup GREAT for gamma-spectroscopic studies
30 CFR 254.42 - Exercises for your response personnel and equipment.
2010-07-01
..., communication, and decisionmaking in managing a response. You must not reveal the spill scenario to team members... the complete 3-year exercise cycle. Records should be maintained at the facility or at a corporate...
: tous les projets | Page 254 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
La production de petits mils, en dépit des vertus nutritionnelles de cette céréale, de sa capacité de croître dans des conditions difficiles et de sa facilité de stockage, a toujours été négligée par les politiques agricoles déployées en Asie du Sud. Ces dernières, en effet, ont privilégié les cultures de rente et les céréales comme ...
Peculiarities of near-ultraviolet (365 nm) and visible light effects in Paramecium Caudatum cells
International Nuclear Information System (INIS)
Samoilova, K.A.; Sushchenko, N.B.
1977-01-01
After treatment with 365 nm or visible light Paramecium caudatum cells fail to divide and die shortly after irradiation; no death occurs long after irradiation, as well as after several cell cycles, unlike the situation after the action of 254 nm or 300-380 nm. Irradiation inhibits mainly the first cell cycle following which the recovery of cells starts. Thus no after-effects take place after the action of 365 nm and visible light, and the patterns of their effects are rather similar. The photoreactivation of damages induced by 365 nm is quite small, being about 2 times less than that for 254 nm and 300-380 nm. Similarity of the action of 254, 300-380, 365 nm and visible light was established by the stimulation of cell division by low doses and increase in viability of infusoria from cultures with low survival and depressed rate of multiplication. This effect of 365 nm is not eliminated by visible light; moreover, the latter promotes the 'therapeutic' effect of the 365 nm line. (author)
International Nuclear Information System (INIS)
Smith-Kappus, S.D.
1987-01-01
In experiments investigating DNA repair, it was shown that B. melaninogenicus does not repair UV light induced damage via photoreactivation. Survival curves constructed for the organism after exposure to UV light at 254 nm and 365 nm under aerobic and anaerobic conditions while the organisms were in exponential or stationary growth phase, revealed that the cells were most sensitive to UV induced damage when exposed to radiation while in the exponential growth phase under aerobic conditions at either wavelength. B. melaninogenicus exposed to UV light under anaerobic conditions while the cells were in stationary growth phase were much more sensitive to UV induced damage at 254 nm than cells irradiated under the same conditions at 365 nm UV. Survival studies of B. melaninogenicus after co-insult with UV light and subinhibitory concentrations of chloramphenicol, metronidazole, caffeine, or fluoroacetate, at 254 nm UV or 365 nm UV, under aerobic and anaerobic atmospheric conditions illustrated a decreased shoulder region on the curves, particularly after 365 nm UV exposure, when compared to UV irradiation applied without subsequent chemical treatment
Near-ultraviolet radiation blocks SOS responses to DNA damage in Escherichia coli
Energy Technology Data Exchange (ETDEWEB)
Turner, M.A.; Eisenstark, A.
1984-01-01
Escherichia coli cells in which the recA promoter is fused to a lac structural gene, (Mu) Mud(Ap,lac)::rec, were irradiated with two far-ultraviolet light wavelengths (254 and 290 nm), selected monochromatic near-ultraviolet (NUV) wavelengths 313 nm, 334 nm, 365 nm, or broad band solar-UV (290-420 nm) from a solar simulator. Irradiation with the two far-ultraviolet wavelengths was followed by high yields of ..beta..-galactosidase, lambda prophage induction, and Weigle reactivation. These end points were not observed after irradiation with the selected NUV wavelengths or the broad spectrum solar-UV. Thus, neither broad spectrum solar-UV nor monochromatic NUV wavelengths resulted in the derepression of the recA promoter. Further, prior exposure of the cells either to the selected monochromatic NUV wavelengths or to solar-UV inhibited a) the induction of ..beta..-galactosidase by subsequent 254-nm radiation, b) subsequent 254-nm induction of lambda prophage, c) Weigle reactivation, and d) mutation frequency. These observations are consistent with the hypothesis that NUV blocks subsequent recA protease action.
A radiographic study on the condylar position in temporomandibular joint dysfunction patients
International Nuclear Information System (INIS)
Bang, Seo Howan; Kim, Jae Duck
1987-01-01
The author obtained the transcranial-oblique lateral radiograms from 78 patients (26 male, 52 female) with temporom andibular dysfunction problem. And then, the author analyzed the dimensional changes of the TMJ space on centric occlusion, horizontal condylar movement and antero-posterior positional relationship of condyle to the articular eminence on 2.54 cm mouth opening with clicking, TMJ pain and mouth opening limitation respectively, which were the symptoms of the temporomandibular joint pain dysfunction problem, and compared these data with control group. The results were as follow: 1. In centric occlusion, anterior and posterior TMJ space of experimental group was slightly lesser than those of the control group, also superior TMJ space of experimental group was significantly lesser than that of the control group. (p 2. In 2.54 cm mouth opening, the condylar horizontal movement and the antero-posterior positional relationship to the articular eminence were significantly lesser than those of the control group. (p 3. Examined experimental group, the degree of condylar horizontal movement of affected side was lesser than that of the normal side in 2.54 cm mouth opening.
Energy Technology Data Exchange (ETDEWEB)
Cabrera-Juarez, E; Setlow, J K; Swenson, P A; Peak, M J
1976-01-01
The action spectrum for the oxygen-independent inactivation of native transforming DNA from Haemophilus influenzae with near-uv radiation revealed a shoulder beginning at 334 and extending to 460 nm. The presence of 0.2 M histidine during irradiation produced a small increase in inactivation at 254, 290 and 313 nm, a large increase at 334 nm and a decrease in inactivation at 365, 405, and 460 nm. Photoreactivation did not reverse the DNA damage produced at pH 7.0 at 334, 365, 405 and 460 nm, but did reactivate the DNA after irradiation at 254, 290 and 313 nm. The inactivation of DNA irradiated at 254, 290 and 313 nm was considerably greater when the transforming ability was assayed in an excision-defective mutant compared with the wild type, although DNA irradiated at 334, 365, 405 and 460 nm showed smaller differences. These results suggest that the oxygen-independent inactivation of H. influenzae DNA at pH 7 by irradiation at 334, 365, 405 and 460 nm is caused by lesions other than pyrimidine dimers.
Lethal effects of solar radiation in proficient and deficient bacteria in repair systems
International Nuclear Information System (INIS)
Sousa Neto, A. de.
1980-01-01
A study of the lethal action of solar radiation on strains of E.coli K12, proficient or deficient in repair systems, as well as the wild type strain gene products are involved in repair of damage induced by solar radiation. The inactivation of the various bacterial strains (normalized to a dose equivalent to radiation at a wavelength 254 nm) suggests that the more energetic wavelengths of the solar spectrum (290-320 nm) could be responsible for the primary damage that occurs in the DNA. The reduction in the shoulder of the survival curve in wild type strains in indicative of induction of sub-lethal damage in this region of the curve. Analysing solar inactivation curves of the bacterial strains (normalised by spore dosimetry) together with those of the same strains irradiated with UV at 254 nm, it was evident that 254 nm is not the ideal wavelength for comparison. This analysis also indicated that in addition to damage to DNA, other factors are involved in the solar radiation inactivation of wild type strains. (author)
UV-induced changes in cell cycle and gene expression within rabbit lens epithelial cells
International Nuclear Information System (INIS)
Sidjanin, D.; Grdina, D.; Woloschak, G.E.
1996-01-01
Damage to lens epithelial cells is a probable initiation process in cataract formation mediated by UV radiation. In these experiments, we investigated the effects of exposure to 254 nm radiation on cell cycle progression in the rabbit lens epithelial cell line N/N1003A. The RNA was harvested at various times following exposure to UV (254 nm) radiation and analyzed by dot-blot and northern blot hybridizations. These results revealed that during the first 6 h following exposure of the cells to UV, there was, associated with decreasing dose, a decrease in accumulation of transcripts specific for histones H3 and H4 and an increase in the mRNA encoding protein kinase C and β- and γ-actin. Using flow cytometry, we detected an accumulation of cells in G1/S phase of the cell cycle 1 h following exposure to 254 nm radiation. The observed changes in gene expression, especially the decreased accumulation of histone transcripts reported here, may play a role in UV-induced inhibition of cell cycle progression. (Author)
Ultraviolet absorbance as a proxy for total dissolved mercury in streams
International Nuclear Information System (INIS)
Dittman, Jason A.; Shanley, James B.; Driscoll, Charles T.; Aiken, George R.; Chalmers, Ann T.; Towse, Janet E.
2009-01-01
Stream water samples were collected over a range of hydrologic and seasonal conditions at three forested watersheds in the northeastern USA. Samples were analyzed for dissolved total mercury (THg d ), DOC concentration and DOC composition, and UV 254 absorbance across the three sites over different seasons and flow conditions. Pooling data from all sites, we found a strong positive correlation of THg d to DOC (r 2 = 0.87), but progressively stronger correlations of THg d with the hydrophobic acid fraction (HPOA) of DOC (r 2 = 0.91) and with UV 254 absorbance (r 2 = 0.92). The strength of the UV 254 absorbance-THg d relationship suggests that optical properties associated with dissolved organic matter may be excellent proxies for THg d concentration in these streams. Ease of sample collection and analysis, the potential application of in-situ optical sensors, and the possibility for intensive monitoring over the hydrograph make this an effective, inexpensive approach to estimate THg d flux in drainage waters. - Ultraviolet absorbance measurements are a cost-effective proxy to estimate dissolved mercury concentration in stream water.
Damage to UV-sensitive cells by short UV in photographic flashes
International Nuclear Information System (INIS)
Menezes, S.; Monteiro, C.
1996-01-01
Light emitted by electronic photographic flash units is shown to damage bacteria and human skin fibroblasts deficient in repair systems, with survival curves very similar to those produced by 254 nm short UV. The lesions induced by these flashes are as photorepairable by the photolyase enzyme as those induced by 254 nm UV and result in equivalent survival rates. Biological dosimetry performed with microorganisms highly sensitive to UV (Escherichia coli K12 AB2480, deficient in excision and recombinational-dependent repair systems and Bacillus subtilis UVSSP spores, deficient in excision and in a specific spore repair process) revealed that each 1 ms flash of light from the photographic unit used in this work contained the equivalent of 0.25 J m -2 of 254 nm UV, when measured at a distance of 7.0 cm. This dose of UV was found to be lethal to both repair-deficient E. coli bacteria and repair-deficient human skin fibroblasts obtained from xeroderma pigmentosum donors, as well as mutagenic in B/r wild-type and HCR-mutant bacteria. (Author)
Energy Technology Data Exchange (ETDEWEB)
Sousa Neto, A de
1981-12-31
A study of the lethal action of solar radiation on strains of E.coli K12, proficient or deficient in repair systems, as well as the wild type strain gene products are involved in repair of damage induced by solar radiation. The inactivation of the various bacterial strains (normalized to a dose equivalent to radiation at a wavelength 254 nm) suggests that the more energetic wavelengths of the solar spectrum (290-320 nm) could be responsible for the primary damage that occurs in the DNA. The reduction in the shoulder of the survival curve in wild type strains in indicative of induction of sub-lethal damage in this region of the curve. Analysing solar inactivation curves of the bacterial strains (normalised by spore dosimetry) together with those of the same strains irradiated with UV at 254 nm, it was evident that 254 nm is not the ideal wavelength for comparison. This analysis also indicated that in addition to damage to DNA, other factors are involved in the solar radiation inactivation of wild type strains. (author).
Radiochemical studies of neutron deficient actinide isotopes
Energy Technology Data Exchange (ETDEWEB)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
International Nuclear Information System (INIS)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.
2000-01-01
Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
International Nuclear Information System (INIS)
Lin, P.F.; Howard-Flanders, P.; Yale Univ., New Haven, Conn.
1976-01-01
Genetic recombination induced by structural damage in DNA molecules was investigated in E. coli K12(lamda) lysogens infected with genetically marked phage lamda. Photoproducts were induced in the phage DNA before infection by exposing them either to 313 nm light in the presence of acetophenone or to 254 nm light. To test the role of the replication of the damage phage DNA on the frequency of the induced recombination , both heteroimmune and homoimmune crosses were performed, and scored for P + recombinants. In heteroimmune crosses, recombination was less frequent in infected cells exposed to visible light and in wild type cells able to perform excision repair than in excision-defective lysogens. Therefore, much of the induced recombination can be attributed to the pyrimidine dimers in the phage DNA. In homoimmune crosses, replication of the phage DNA containing ultraviolet photoproducts was represented by lamda immunity, and was further blocked by the lack of the P gene product needed for replication. The 254 nm photoproducts increased the frequency of recombination in these homoimmune crosses, even though phage DNA replication was blocked. Irradiation with 313 nm light and acetophenone M, which produces dimers and unknown photoproducts, was not as effective per dimer as the 254 nm light. It is concluded from these results that certain unidentified 254 nm photoproducts can cause recombination even in the absence of DNA replication. They are not pyrimidine dimers, as they are not susceptible to excision repair or photoreactivation. In contrast, pyrimidine dimers appear to cause recombination only when the DNA containing them undergoes replication. (orig./MG) [de
Osburn, Christopher L.; Oviedo-Vargas, Diana; Barnett, Emily; Dierick, Diego; Oberbauer, Steven F.; Genereux, David P.
2018-03-01
A paired-watershed approach was used to compare the quality and fluxes of dissolved organic matter (DOM) during stormflow and baseflow in two lowland tropical rainforest streams located in northeastern Costa Rica. The Arboleda stream received regional groundwater (RGW) flow, whereas the Taconazo stream did not. DOM quality was assessed with absorbance and fluorescence and stable carbon isotope (δ13C-DOC) values. RGW DOM lacked detectable fluorescence and had specific ultraviolet absorption (SUVA254) and absorbance slope ratio (SR) values consistent with low aromaticity and low molecular weight material, respectively. We attributed these properties to microbial degradation and sorption of humic DOM to mineral surfaces during transport through bedrock. SUVA254 values were lower and SR values were higher in the Arboleda stream during baseflow compared to the Taconazo stream, presumably due to dilution by RGW. However, no significant difference in SUVA254 or SR occurred between the streams during stormflow. SUVA254 was negatively correlated to δ13C-DOC (r2 = 0.61, P runoff containing soil and throughfall C sources. Mean DOC export from the Taconazo stream during the study period was 2.62 ± 0.39 g C m-2 year-1, consistent with other tropical streams, yet mean DOC export from the Arboleda stream was 13.79 ± 2.07 g C m-2 year-1, one of the highest exports reported and demonstrating a substantial impact of old RGW from outside the watershed boundary can have on surface water carbon cycling.
International Nuclear Information System (INIS)
Uchiyama, H; Takahashi, T; Arinuma, K; Sato, K; Kanazawa, I; Hamada, E; Suzuki, T; Kirihara, K; Kimura, K
2004-01-01
The positron lifetimes for the icosahedral quasicrystal Al 62.4 Cu 25.4 Ru 12.2 and its cubic approximants (1/ 1-Al 58 Cu 31.5 Ru 10.5 , 1/ 1-Al 68 Cu 7 Ru 17 Si 8 , and 1/0-Al 55 Cu 15 Ru 20 Si 10 ), two-detector coincident Doppler broadening for the icosahedral quasicrystal Al 62.4 Cu 25.4 Ru 12.2 and its 1/ 1-Al 68 Cu 7 Ru 17 Si 8 cubic approximant, and the Doppler broadening obtained by making use of a slow positron beam for the 1/ 1-Al 58 Cu 31.5 Ru 10.5 cubic approximant have been measured. Structurally intrinsic trapping sites giving rise to saturation trapping were detected by lifetime measurements. The chemical environments of the trapping sites in the icosahedral quasicrystal Al 62.4 Cu 25.4 Ru 12.2 and the 1/ 1-Al 68 Cu 7 Ru 17 Si 8 cubic approximant were determined by coincident Doppler broadening techniques to be dominantly surrounded by Al atoms. The positron diffusion length in the 1/ 1-Al 58 Cu 31.5 Ru 10.5 cubic approximant derived from the measured S parameter measured by means of a slow positron beam was ∼ 180 A, which is clearly too short, probably due to the high concentration of trapping sites as described above. The atomic structures of the icosahedral quasicrystal Al 62.4 Cu 25.4 Ru 12.2 and its variety of approximants are discussed and compared to the present proposed model
ORF Alignment: NT_033777 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Query: 134 SDCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF 193 ... SDCHELDEGVRVDGVYRFLVP...ERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF Sbjct: 1 ... SDCHELDEGVRVDGVYRFLVPERNEVQRDL...YERYCAFATDGPAWTVIQSRGGSFDPHENF 60 ... Query: 254 SYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQ 3
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NLVVLQELNPYSYFCQSENPKFFDLGEYFEEDKAFFS 60 ... Query: 134 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEE...KKRQQ 193 ... DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ... Sbjct: 121 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ 180 ... Query: 254 EEILYAEIELERTEEVRRM
The pin pixel detector--X-ray imaging
Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Simmons, J E; Stephenson, R
2002-01-01
The development and testing of a soft X-ray gas pixel detector, which uses connector pins for the anodes is reported. Based on a commercial 100 pin connector block, a prototype detector of aperture 25.4 mm centre dot 25.4 mm can be economically fabricated. The individual pin anodes all show the expected characteristics of small gas detectors capable of counting rates reaching 1 MHz per pin. A 2-dimensional resistive divide readout system has been developed to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics.
Bacterial growth in humic waters exposed to UV-radiation and simulated sunlight
DEFF Research Database (Denmark)
Corin, N.; Backlund, P.; Wiklund, T.
1998-01-01
Sterile filtered (0.45 mu m) humic lake water was exposed to simulated sunlight (300-800 nm) or W-radiation (254 run)for various periods of times and the dissolved organic carbon content, absorbance at 254 and 460 nm and PH were recorded. The irradiated water was inoculated with a natural bacterial...... assemblage and the number of viable bacteria war estimated 3 and 5 days after the inoculation using the plate count technique. The number of viable bacteria increased with the irradiation time indicating that the chemical changes of the humus macromolecules observed during irradiation resulted...
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...
Hurricane Matthew's Effects on Wetland Sources of Organic Matter to North Carolina Coastal Waters.
Rudolph, J. C.; Osburn, C. L.; Paerl, H. W.; Hounshell, A.
2017-12-01
Increased frequency and intensity of storm events such as tropical cyclones will have a major impact on estuarine and coastal biogeochemical cycling. Here, we determined the sources of dissolved and particulate organic matter (DOM and POM) as part of a larger study to quantify the short-term (several months) response of carbon and nitrogen cycling in the Neuse River Estuary-Pamlico Sound (NRE-PS) ecosystem to floodwaters associated with Hurricane Matthew. Sampling was conducted weekly in both the NRE-PS (October 2016 to January 2017), the Neuse River (NR) (October to December 2016) and in freshwater wetlands of the Neuse River above head of tide in March 2017. Specific ultraviolet (UV) absorbance at 254 nm (SUVA254) and stable carbon isotope ratios (δ13C-DOC) were used to determine the sources of DOM and POM transported to the NRE-PS in post-hurricane floodwaters. For DOM, SUVA254 values increased from 3.23 ±0.52 mg C L-1 m-1 in the NR to 4.14±0.52 mg C L-1 m-1 in the NRE and then declined to 3.63±0.32 mg C L-1 m-1 in PS. Combined with depleted δ13C-DOC values (-26 to -32‰) and elevated C:N values in the estuary and sound, these results confirm continued loading of fresh terrestrial organic matter into NRE-PS weeks after the storm. For POM, δ13C-POC and C:N ratio results likewise indicated a terrestrial source in floodwaters. SUVA254 values >3.5 mg C L-1 m-1 coupled with the depleted δ13C values and large C:N values were consistent with DOM primarily sourced from wetlands (e.g., wetland SUVA254 = 3.77±0.52 mg C L-1 m-1 in March 2017). We hypothesize that floodwaters connected riverine wetlands to the main channel of the NR, exporting DOM and POM into the NRE-PS. Our results indicate that upstream wetlands play a central and potentially significant role in organic matter enrichment and metabolism of estuarine and coastal waters, in light of increasing frequencies and intensities of tropical cyclones impacting coastal watersheds.
International Nuclear Information System (INIS)
Jones, C.A.; Huberman, E.; Cunningham, M.L.; Peak, M.J.
1987-01-01
Action spectra were determined for cell killing and mutation by monochromatic ultraviolet and visible radiations (254-434 nm) in cultured human epithelial P3 cells. Cell killing was more efficient following radiation at the shorter wavelengths (254-434 nm) than at longer wavelengths (365-434 nm). At 254 nm, for example, a fluence of 11 Jm-2 gave 37% cell survival, while at 365 nm, 17 X 10(5) Jm-2 gave equivalent survival. At 434 nm little killing was observed with fluences up to 3 X 10(6) Jm-2. Mutant induction, determined at the hypoxanthine-guanine phosphoribosyltransferase locus, was caused by radiation at 254, 313, and 365 nm. There was no mutant induction at 334 nm although this wavelength was highly cytotoxic. Mutagenesis was not induced by 434 nm radiation, either. There was a weak response at 405 nm; the mutant frequencies were only slightly increased above background levels. For the mutagenic wavelengths, log-log plots of the mutation frequency against fluence showed linear regressions with positive slopes of 2.5, consistent with data from a previous study using Escherichia coli. The data points of the action spectra for lethality and mutagenesis were similar to the spectrum for DNA damage at wavelengths shorter than 313 nm, whereas at longer wavelengths the lethality spectrum had a shoulder, and the mutagenesis spectrum had a secondary peak at 365 nm. No correlation was observed for the P3 cells between the spectra for cell killing and mutagenesis caused by wavelengths longer than 313 nm and the induction of DNA breakage or the formation of DNA-to-protein covalent bonds in these cells
O'Donnell, Jonathan A.; Aiken, George R.; Walvoord, Michelle A.; Raymond, Peter A.; Butler, Kenna D.; Dornblaser, Mark M.; Heckman, Katherine
2014-11-01
Recent warming at high latitudes has accelerated permafrost thaw, which can modify soil carbon dynamics and watershed hydrology. The flux and composition of dissolved organic matter (DOM) from soils to rivers are sensitive to permafrost configuration and its impact on subsurface hydrology and groundwater discharge. Here, we evaluate the utility of DOM composition and age as a tool for detecting permafrost thaw in three rivers (Beaver, Birch, and Hess Creeks) within the discontinuous permafrost zone of interior Alaska. We observed strong temporal controls on Δ14C content of hydrophobic acid isolates (Δ14C-HPOA) across all rivers, with the most enriched values occurring during spring snowmelt (75 ± 8‰) and most depleted during winter flow (-21 ± 8‰). Radiocarbon ages of winter flow samples ranged from 35 to 445 yr BP, closely tracking estimated median base flow travel times for this region (335 years). During spring snowmelt, young DOM was composed of highly aromatic, high molecular-weight compounds, whereas older DOM of winter flow had lower aromaticity and molecular weight. We observed a significant correlation between Δ14C-HPOA and UV absorbance coefficient at 254 nm (α254) across all study rivers. Using α254 as an optical indicator for Δ14C-HPOA, we also observed a long-term decline in α254 during maximum annual thaw depth over the last decade at the Hess Creek study site. These findings suggest a shift in watershed hydrology associated with increasing active layer thickness. Further development of DOM optical indicators may serve as a novel and inexpensive tool for detecting permafrost degradation in northern watersheds.
Al-Juboori, Raed A; Yusaf, Talal; Aravinthan, Vasantha; Bowtell, Leslie
2016-02-01
In this study, the structural alteration to DOC for a range of ultrasound treatments was investigated with chemical fractionation and UV-vis spectroscopic measurement. Ultrasound treatments were applied in continuous and pulsed modes at power levels of 48 and 84 W for effective treatment times of 5 and 15 min. Overall results show that the ultrasound treatments tended to degrade the hydrophobic aromatic fraction, while increasing the hydrophilic fraction to a lesser extent. The highest recorded reduction of hydrophobic DOC (17.8%) was achieved with pulse treatment of 84 W for15 min, while the highest increase in the hydrophilic DOC (10.5%) was obtained with continuous treatment at 84 W and 5 min. The optimal ultrasound treatment conditions were found to be pulse mode at high power and short treatment time, causing a minimal increase in the hydrophilic fraction of 1.3% with moderate removal of the hydrophobic fraction of 15.52%. The same treatment conditions, with longer treatment time, resulted in the highest removal of SUVA254 and SUVA280 of 17.09% and 16.93, respectively. These results indicate the potential for ultrasound treatments in DOC structural alteration. The hydrophobic fraction showed strong and significant correlations with UV absorbance at 254 and 280 nm. A254/A204 also exhibited strong and significant correlations with the hydrophobic/hydrophilic ratio. The other UV ratios (A250/A365 (E2/E3) and A254/A436) had weak and insignificant correlations with the hydrophobic/hydrophilic ratio. This confirms the applicability of UV indices as a suitable surrogate method for estimating the hydrophobic/hydrophilic structure. Copyright © 2015 Elsevier Ltd. All rights reserved.
Beltrán, F J; Alvarez, P M; Rodríguez, E M; García-Araya, J F; Rivas, J
2001-01-01
The performance of integrated aerobic digestion and ozonation for the treatment of high strength distillery wastewater (i.e., cherry stillage) is reported. Experiments were conducted in laboratory batch systems operating in draw and fill mode. For the biological step, activated sludge from a municipal wastewater treatment facility was used as inoculum, showing a high degree of activity to distillery wastewater. Thus, BOD and COD overall conversions of 95% and 82% were achieved, respectively. However, polyphenol content and absorbance at 254 nm (A(254)) could not be reduced more than 35% and 15%, respectively, by means of single biological oxidation. By considering COD as substrate, the aerobic digestion process followed a Contois' model kinetics, from which the maximum specific growth rate of microorganisms (mu(max)) and the inhibition factor, beta, were then evaluated at different conditions of temperature and pH. In the combined process, the effect of a post-ozonation stage was studied. The main goals achieved by the ozonation step were the removal of polyphenols and A(254). Therefore, ozonation was shown to be an appropriate technology to aid aerobic biological oxidation in the treatment of cherry stillage.
Yamamichi, Nobutake; Hirano, Chigaya; Takahashi, Yu; Minatsuki, Chihiro; Nakayama, Chiemi; Matsuda, Rie; Shimamoto, Takeshi; Takeuchi, Chihiro; Kodashima, Shinya; Ono, Satoshi; Tsuji, Yosuke; Fujishiro, Mitsuhiro; Wada, Ryoichi; Mitsushima, Toru; Koike, Kazuhiko
2016-04-01
Upper gastrointestinal endoscopy (UGI-ES) and double-contrast upper gastrointestinal barium X-ray radiography (UGI-XR) are two major image-based methods to diagnose atrophic gastritis, which is mostly induced by Helicobacter pylori infection. However, there have been few studies directly comparing them. Atrophic gastritis was evaluated using the data of 962 healthy subjects who underwent UGI-ES and UGI-XR within 1 year. Based on UGI-ES and UGI-XR, 602 subjects did not have atrophic gastritis and 254 subjects did have it. Considering UGI-ES-based atrophic gastritis as the standard, sensitivity and specificity of UGI-XR-based atrophic gastritis were 92.0 % (254/276) and 92.8 % (602/649), respectively. The seven-grade Kimura-Takemoto classification of UGI-ES-based atrophic gastritis showed a strong and significant association with the four-grade UGI-XR-based atrophic gastritis. Sensitivity and specificity of serum anti-Helicobacter pylori IgG to detect UGI-ES/UGI-XR-based atrophic gastritis were 89.4 % (227/254) and 99.8 % (601/602), indicating that atrophic gastritis can be overlooked according to serum anti-Helicobacter pylori IgG alone.
Miyazato, Itsuki; Tanaka, Yuzuru; Takahashi, Keisuke
2018-02-01
Two-dimensional (2D) magnets are explored in terms of data science and first principle calculations. Machine learning determines four descriptors for predicting the magnetic moments of 2D materials within reported 216 2D materials data. With the trained machine, 254 2D materials are predicted to have high magnetic moments. First principle calculations are performed to evaluate the predicted 254 2D materials where eight undiscovered stable 2D materials with high magnetic moments are revealed. The approach taken in this work indicates that undiscovered materials can be surfaced by utilizing data science and materials data, leading to an innovative way of discovering hidden materials.
Mycological studies housed in the Apollo 16 microbial ecology evaluation device
Volz, P. A.
1973-01-01
Survival, death, and phenotype count have yielded variation in the number of fungi recovered from the controls and the flight exposed cuvettes during preliminary analysis of postflight first phase data. Also the preliminary analysis was indicative that fungi exposed to specific space flight conditions demonstrated variable survival rates and phenotype counts. Specific space flight conditions included full light space exposure for Chaetomium globosum, exposure at 300- and 254-nanometer wavelengths for Rhodotorula rubra, full light and 280-nanometer wavelength exposure for Trichophyton terrestre, and 254-nanometer wavelength exposure for Saccharomyces cerevisiae. In general, phenotype counts for flight cuvettes and survival rates for control cuvettes were higher compared with the remaining cuvettes.
Four channel Cosmic Ray detector based on polymaq
Herrera-Guzman, K. N.; Gutierrez-Sanchez, R. A.; Felix, J.
2017-01-01
The Cherenkov radiation has been widely studied in transparent materials, and applied to detect and identify elementary particles. But it has not been widely studied in opaque materials. A four channels radiation detector has been designed, built, characterized, and operated; based on four polymaq (UHMW-PE) bars of 2.54 cm X 5.08 cm X 25.4 cm, which is an opaque material to visible radiation to the human eye. Silicon photo detectors, Hamamatsu, avalanche type (APD) are used to detect the radiation produced by the passage of particles in the detector blocks. The design, construction, characterization, operation, and preliminary results of this cosmic ray detector details are presented.
ORF Alignment: NT_037436 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... gb|AAM10986.1| AT04143p [Drosophila melanogaster] ... Length = 254 ... Query: 12 ... STALRLLGANVEL...FGVLTRNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQDRWTRR 71 ... STALRLLGANVELFGVLT...RNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQDRWTRR Sbjct: 1 ... STALRLLGANVELFGVLTRNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQ
S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...
African Journals Online (AJOL)
In the case of sheep the treatment of OF-collected samples (total extrusa vs. solid frac- tion) had a significant ... of laboratory drying equipment, is discussed. Oesophageally ..... Chemistry of browning reactions in model system. J. Agric. Food ...
SSC 254 Screen-Based Word Processors: Production Tests. The Lanier Word Processor.
Moyer, Ruth A.
Designed for use in Trident Technical College's Secretarial Lab, this series of 12 production tests focuses on the use of the Lanier Word Processor for a variety of tasks. In tests 1 and 2, students are required to type and print out letters. Tests 3 through 8 require students to reformat a text; make corrections on a letter; divide and combine…
50 CFR 14.254 - What are the requirements contained in these regulations?
2010-10-01
... IMPORTATION OF WILDLIFE AND PLANTS IMPORTATION, EXPORTATION, AND TRANSPORTATION OF WILDLIFE Captive Wildlife... exemption in § 14.255, an accredited wildlife sanctuary must maintain complete and accurate records of any..., sold, or otherwise transferred; and the dates of these transactions. The accredited wildlife sanctuary...
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
Adsorption and photocatalytic oxidation of formaldehyde on a clay-TiO{sub 2} composite
Energy Technology Data Exchange (ETDEWEB)
Kibanova, Daria [Facultad de Quimica, Universidad Nacional Autonoma de Mexico (Mexico); Departamento de Procesos y Tecnologia, Universidad Autonoma Metropolitana (Mexico); Sleiman, Mohamad [Lawrence Berkeley National Laboratory, Indoor Environment Group, Environmental Energy Technologies Division (United States); Cervini-Silva, Javiera, E-mail: jcervini@correo.cua.uam.mx [Departamento de Procesos y Tecnologia, Universidad Autonoma Metropolitana (Mexico); NASA Astrobiology Institute (United States); Destaillats, Hugo, E-mail: HDestaillats@lbl.gov [Lawrence Berkeley National Laboratory, Indoor Environment Group, Environmental Energy Technologies Division (United States); Arizona State University, Department of Chemistry and Biochemistry (United States)
2012-04-15
Highlights: Black-Right-Pointing-Pointer Formaldehyde adsorption and photocatalytic elimination on hectorite-TiO{sub 2} nanocomposites. Black-Right-Pointing-Pointer Dark adsorption in dry air >4 times higher than P25 (reference). Black-Right-Pointing-Pointer Dark adsorption in humid air dominated by adsorbed water layer. Black-Right-Pointing-Pointer Photocatalytic removal efficiency proportional to the Ti content, increased with contact time. Black-Right-Pointing-Pointer More complete elimination with 254 + 185 nm irradiation. - Abstract: We investigated the adsorption capacity and photocatalytic removal efficiency of formaldehyde using a hectorite-TiO{sub 2} composite in a bench flow reactor. The same experimental conditions were applied to pure TiO{sub 2} (Degussa P25) as a reference. The catalysts were irradiated with either a UVA lamp (365 nm) or with one of two UVC lamps of 254 nm and 254 + 185 nm, respectively. Formaldehyde was introduced upstream at concentrations of 100-500 ppb, with relative humidity (RH) in the range 0-66% and residence times between 50 and 500 ms. Under dry air and without illumination, saturation of catalyst surfaces was achieved after {approx}200 min for P25 and {approx}1000 min for hectorite-TiO{sub 2}. The formaldehyde uptake capacity by hectorite-TiO{sub 2} was 4.1 times higher than that of P25, almost twice the BET surface area ratio. In the presence of humidity, the difference in uptake efficiency between both materials disappeared, and saturation was achieved faster (after {approx}200 min at 10% RH and {approx}60 min at 65% RH). Under irradiation with each of the three UV sources, removal efficiencies were proportional to the Ti content and increased with contact time. The removal efficiency decreased at high RH. A more complete elimination of formaldehyde was observed with the 254 + 185 nm UV source.
Directory of Open Access Journals (Sweden)
Hufiadi Hufiadi
2016-06-01
Full Text Available Permasalahan utama pada perikanan jaring arad adalah banyaknya jumlah hasil tangkap sampingan berukuran kecil yang belum layak tangkap. Dalam upaya untuk mengurangi tangkapan ikan muda yang belum layak tangkap telah dilakukan observasi dan ujicoba operasi penangkapan melalui penggunaan perangkat juvenile and trash exluder devices pada alat tangkap jaring arad yang dioperasikan nelayan di Pekalongan. Perangkat juvenile and trash exluder devices yang digunakan dibedakan pada ukuran jarak antar kisi, yaitu 10,0; 17,5; dan 25,4 mm. Analisis selektivitas kisi menggunakan model kurva logistik dengan bantuan solver pada Microsoft Excel. Hasil penelitian menunjukkan bahwa penggunaan juvenile and trash exluder devices pada jaring arad dapat meloloskan ikan kurisi (Nemipterus spp. berukuran kecil. Ukuran jarak antar kisi 25,4 mm mempunyai selektivitas yang paling baik terhadap ikan kurisi berdasarkan atas ukuran panjang baku dan jarak antar kisi 17,5 mm mempunyai selektivitas paling baik berdasarkan atas ukuran lingkar tubuh ikan kurisi. The serius problem on bottom mini trawl has the large number caught of bycatch caught especially for juvenile and trash fish. Improvement to reduce catches of juvenile was conducted through observation and experimental fishing using juvenile and trash exluder devices of mini bottom trawl in Pekalongan. The juvenile and trash excluder devices (juvenile and trash exluder devices in the experimental fishing with different space bar of the juvenile and trash exluder devices i.e. 10.0; 17.5; and 25.4 mm. The selectivity analysis of logistic curve by using solver on Microsoft Excel was applied. The results showed that juvenile and trash excluder devices might reduce catches of threadfin breams juvenile. Where as 25.4 space bar had the best selectivity based on the size of threadfin breams fork length and 17.5 mm space bar had the best selectivity based on the size of threadfin breams body girth.
O'Donnell, Jonathan A.; Aiken, George R.; Walvoord, Michelle Ann; Butler, Kenna D.
2012-01-01
Groundwater discharge to rivers has increased in recent decades across the circumpolar region and has been attributed to thawing permafrost in arctic and subarctic watersheds. Permafrost-driven changes in groundwater discharge will alter the flux of dissolved organic carbon (DOC) in rivers, yet little is known about the chemical composition and reactivity of dissolved organic matter (DOM) of groundwater in permafrost settings. Here, we characterize DOM composition of winter flow in 60 rivers and streams of the Yukon River basin to evaluate the biogeochemical consequences of enhanced groundwater discharge associated with permafrost thaw. DOC concentration of winter flow averaged 3.9 ± 0.5 mg C L−1, yet was highly variable across basins (ranging from 20 mg C L−1). In comparison to the summer-autumn period, DOM composition of winter flow had lower aromaticity (as indicated by specific ultraviolet absorbance at 254 nm, or SUVA254), lower hydrophobic acid content, and a higher proportion of hydrophilic compounds (HPI). Fluorescence spectroscopy and parallel factor analysis indicated enrichment of protein-like fluorophores in some, but not all, winter flow samples. The ratio of DOC to dissolved organic nitrogen, an indicator of DOM biodegradability, was positively correlated with SUVA254 and negatively correlated with the percentage of protein-like compounds. Using a simple two-pool mixing model, we evaluate possible changes in DOM during the summer-autumn period across a range of conditions reflecting possible increases in groundwater discharge. Across three watersheds, we consistently observed decreases in DOC concentration and SUVA254 and increases in HPI with increasing groundwater discharge. Spatial patterns in DOM composition of winter flow appear to reflect differences in the relative contributions of groundwater from suprapermafrost and subpermafrost aquifers across watersheds. Our findings call for more explicit consideration of DOC loss and stabilization
Two low-level gamma spectrometry systems of the IAEA Safeguards Analytical Laboratory
Energy Technology Data Exchange (ETDEWEB)
Parus, J L [IAEA, SAL, Vienna (Austria); Raab, W [IAEA, SAL, Vienna (Austria); Donohue, D [IAEA, SAL, Vienna (Austria); Jansta, V [IAEA, SAL, Vienna (Austria); Kierzek, J [IAEA, SAL, Vienna (Austria)
1997-03-01
A gamma spectrometry system designed for the measurement of samples with low and medium radioactivity (activity from a few to about 10{sup 4} Bq in the energy range from 25 to 2700 keV) has been installed at the IAEA Safeguards Analytical Laboratory in Seibersdorf. The system consists of 3 low level detectors: (1) n-type coaxial Ge with 42.4% relative efficiency, 1.85 keV FWHM at 1.33 MeV (2) planar Ge with 2000 mm{sup 2} area and 20 mm thickness, 562 eV FWHM at 122 keV (3) NaI(Tl) annulus of 25.4 cm diameter and 25.4 cm height, hole diameter 90 mm. (orig./DG)
Lon gene and photoprotection in Escherichia coli K-12
Energy Technology Data Exchange (ETDEWEB)
Waksman, G.; Thomas, G.; Favre, A. (Institut de Recherche en Biologie Moleculaire, Group de Photobiologie Moleculaire, Paris (France))
1984-03-01
Photoprotection, i.e. the increased resistance of the cells preilluminated with near ultraviolet light (300-380 nm) to the lethal action of 254nm radiations requires either an integrated prophage or a recA mutation in Escherichia coli K12 strains. Significant photoprotection occurs in an Escherichia coli K12 recA/sup +/ cell containing the lon allele responsible for filamentous growth after 254nm irradiation. The Fil phenotype can be suppressed by the sfiA or sfiB suppressor genes. Since the E. coli K12 recA/sup +/ lon sfiB strain exhibits no more photoprotection, it is concluded that in lon strains photoprotection is due to the abolition of the 254nm induced filamentation by the near ultraviolet treatment. In addition, near ultraviolet illumination of the cells leads to a severe restriction of the bulk protein synthesis. This effect is observed only in nuv/sup +/ cells that contain 4-thiouridine the chromophore responsible for photoprotection. It is proposed that in lon (lysogenic strains) photoprotection is due to prevention of the SOS response. During the growth lag, the low residual level of protein synthesis does not allow the induction of the SOS response and accordingly prevents filamentation (the lytic cycle).
The lon gene and photoprotection in Escherichia coli K-12
International Nuclear Information System (INIS)
Waksman, G.; Thomas, G.; Favre, A.
1984-01-01
Photoprotection, i.e. the increased resistance of the cells preilluminated with near ultraviolet light (300-380 nm) to the lethal action of 254nm radiations requires either an integrated prophage or a recA mutation in Escherichia coli K12 strains. Significant photoprotection occurs in an Escherichia coli K12 recA + cell containing the lon allele responsible for filamentous growth after 254nm irradiation. The Fil phenotype can be suppressed by the sfiA or sfiB suppressor genes. Since the E. coli K12 recA + lon sfiB strain exhibits no more photoprotection, it is concluded that in lon strains photoprotection is due to the abolition of the 254nm induced filamentation by the near ultraviolet treatment. In addition, near ultraviolet illumination of the cells leads to a severe restriction of the bulk protein synthesis. This effect is observed only in nuv + cells that contain 4-thiouridine the chromophore responsible for photoprotection. It is proposed that in lon (lysogenic strains) photoprotection is due to prevention of the SOS response. During the growth lag, the low residual level of protein synthesis does not allow the induction of the SOS response and accordingly prevents filamentation (the lytic cycle). (author)
Sartoris, J.J.; Thullen, J.S.; Barber, L.B.; Salas, D.E.
2000-01-01
A 9.9-ha combined habitat and wastewater treatment demonstration wetland was constructed and planted in the summer of 1994, at Eastern Municipal Water District’s (EMWD) Hemet/San Jacinto Regional Water Reclamation Facility (RWRF) in southern California. From January 1996 through September 1997, the marsh–pond–marsh wetland system was operated to polish an average of 3785 m3 d−1 (1×106 gal day−1) of secondary-treated effluent from the RWRF. Nitrogen removal was a major objective of this wetland treatment. Weekly inflow/outflow water quality monitoring of the wetland was supplemented with biannual, 45-station synoptic surveys within the system to determine internal distribution patterns of the nitrogen species (total ammonia, nitrite, nitrate, and organic nitrogen), total organic carbon (TOC), and ultraviolet absorbance at 254 nm (UV254). Synoptic surveys were carried out during May 22 and September 17, 1996, and May 6 and September 25, 1997 and the results were mapped using the ARC/INFO processing package and inverse distance weighted mathematical techniques. Distribution patterns of the various nitrogen species, TOC, and UV254 within the wetland indicate that the nitrogen dynamics of the system are influenced both by variations in treatment plant loading, and, increasingly, by the degree of coverage and maturity of the emergent vegetation.
International Nuclear Information System (INIS)
Lord, J.T.; Ziboh, V.A.; Blick, G.; Poitier, J.; Kursunoglu, I.; Penneys, N.S.
1978-01-01
Oxygenation of arachidonic acid in vitro by calf skin microsomal acetone powder was enhanced by UV-irradiation at wavelengths of 254 and 360 nm. Further enhancement of the oxygenation reaction was observed in the presence of two photosensitizing cyclic antibiotics, tetracycline and demethylchlortetracycline. To test whether or not the oxygenation of arachidonic acid was related to the biosynthesis of prostaglandins, [I- 14 C]-arachidonic acid was incubated with calf skin acetone powder in the presence of UV-irradiation and the cyclic antibiotics. Prostaglandin biosynthesis from arachidonic acid by the calf skin microsomal acetone powder was enhanced after exposure to UV-irradiation at 254 nm and moderately at 360 nm. Incubation in the presence of demethylchlortetra-cycline (0.2 mM) increased prostaglandin biosynthesis approximately 95% over control by UV-irradiation at 254 nm. No significant stimulation of prostaglandin biosynthesis was observed at 360 nm. Non-photosensitizing antibiotics had no effect either on the oxygenation of arachidonic acid or on the biosynthesis of prostaglandin with or without UV-irradiation. It is suggested that the inflammatory reactions associated with these photo-reactive antibiotics may in part, be via the biosynthesis and release of the prostaglandins which are known to produce cutaneous inflammatory reactions. (author)
Directory of Open Access Journals (Sweden)
Vanessa Jurca Seolin
2012-05-01
Full Text Available Several natural coagulants have been studied for use in water treatment. The seed of Moringa oleifera Lam, for example, is a natural coagulant whose extract has been mentioned as effective not only for removing color, turbidity, and compounds with absorption at UV-254 nm, but also for significantly reducing the amount of sludge and bacteria in wastewaters. Therefore, the present study (1 evaluated the molecular weight of the extract of Moringa oleifera seed utilizing electrophoresis, and (2 compared the efficiency of different extracts obtained, using solutions of NaCl (0.01 M, 0.1 M and 1 M, distilled water, and Moringa oleifera Lam seed, acting as a natural coagulant in order to obtain drinking water. The tests were performed in Jar Test, and the effectiveness of the process was assessed regarding the removal of color, turbidity and UV-254 nm. It was observed that the molecular weight found in this study is consistent with literature data. Moreover, the highest removal efficiency of color, turbidity, and UV-254 nm occurred with 1M NaCl solution, with coagulant concentration between 100 and 300 mg L-1. The results obtained evidenced that the seed of Moringa oleifera Lam is a great alternative for use as a coagulant in drinking water treatment systems.
Zhao, Yue; Wei, Yu-quan; Li, Yang; Xi, Bei-dou; Wei, Zi-min; Wang, Xing-lei; Zhao, Zhi-nan; Ding, Jei
2015-04-01
The present study was conducted to assess the degree of humification in DOM during composting using different raw materials, and their effect on maturity of compost based on UV-Vis spectra measurements and chemometrics method. The raw materials of composting studied included chicken manure, pig manure, kitchen waste, lawn waste, fruits and vegetables waste, straw waste, green waste, sludge, and municipal solid waste. During composting, the parameters of UV-Vis spectra of DOM, including SUVA254 , SUVA280 , E250/E365, E4/E6, E2/E4, E2/E6, E253/E203, E253/E220, A226-400, S275-295 and S350-400 were calculated, Statistical analysis indicated that all the parameter were significantly changed during composting. SUVA254 and SUVA280 of DOM were continuously increased, E250/E365 and E4/E6 were continuously decreased in DOM, while A226-400, S275-295 and S350-400 of DOM at the final stage were significantly different with those at other stages of composting. Correlation analysis indicated that the parameters were significantly correlated with each other except for E2/E4 and E235/E203. Furthermore, principal component analysis suggested that A226-400, SUVA254, S350-400, SUVA280 and S275~295 were reasonable parameters for assessing the compost maturity. To distinguish maturity degree among different composts, hierarchical cluster analysis, an integrated tool utilizing multiple UV-Vis parameters, was performed based on the data (A226-400, SUVA254, S350-400, SUVA280 and S275-295) of DOM derived from the final stage of composting. Composts from different sources were clustered into 2 groups. The first group included chicken manure, pig manure, lawn waste, fruits and vegetables waste, green waste, sludge, and municipal solid waste characterized by a lower maturity degree, and the second group contained straw waste and kitchen waste associated with a higher maturity degree. The above results suggest that a multi-index of UV-Vis spectra could accurately evaluate the compost maturity
Holland, Aleicia; Stauber, Jenny; Wood, Chris M; Trenfield, Melanie; Jolley, Dianne F
2018-06-15
Dissolved organic matter (DOM) plays important roles in both abiotic and biotic processes within aquatic ecosystems, and these in turn depend on the quality of the DOM. We collected and characterized chromophoric DOM (CDOM) from different Australian freshwater types (circumneutral, naturally acidic and groundwater-fed waterways), climatic regions and seasons. CDOM quality was characterized using absorbance and fluorescence spectroscopy. Excitation emission scans followed by parallel factor (PARAFAC) analysis showed that CDOM was characterized by three main components: protein-like, fulvic-like and humic-like components commonly associated with various waters globally in the Openfluor database. Principal component analysis showed that CDOM quality varied between naturally acidic, circumneutral and groundwater-fed waters, with unique CDOM quality signatures shown for each freshwater type. CDOM quality also differed significantly within some sites between seasons. Clear differences in dominant CDOM components were shown between freshwater types. Naturally acidic waters were dominated by highly aromatic (as indicated by the specific absorbance co-efficient (SAC 340 ) and the specific UV absorbance (SUVA 254 ) values which ranged between 31 and 50 cm 2 mg -1 and 3.9-5.7 mg C -1 m -1 respectively), humic-like CDOM of high molecular weight (as indicated by abs 254/365 which ranged from 3.8 to 4.3). In contrast, circumneutral waters were dominated by fulvic-like CDOM of lower aromaticity (SAC 340 : 7-21 cm 2 mg -1 and SUVA 254 : 1.5-3.0 mg C -1 m -1 ) and lower molecular weight (abs 254/365 5.1-9.3). The groundwater-fed site had a higher abundance of protein-like CDOM, which was the least aromatic (SAC 340 : 2-5 cm 2 mg -1 and SUVA 254 : 0.58-1.1 mg C -1 m -1 ). CDOM was generally less aromatic, of a lower molecular weight and more autochthonous in nature during the summer/autumn sampling compared to winter/spring. Significant
Systema Naturae. Classification of living things.
Alexey Shipunov
2007-01-01
Original classification of living organisms containing four kingdoms (Monera, Protista, Vegetabilia and Animalia), 60 phyla and 254 classes, is presented. The classification is based on latest available information.
2010-07-07
... Manistee Iron Works Machine Shop, 254 River St., Manistee, 10000477 Wayne County Rosedale Gardens Historic... Berry Morot Car Service Building, (Auto-Related Resources of St. Louis, Missouri [[Page 39041
Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750
Directory of Open Access Journals (Sweden)
C.A. (Annemieke Romein
2017-10-01
Full Text Available Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750 (Dissertation Leiden University 2014; Leiden/ Boston: Brill. 2016, 254 pp., ISBN 9789004315914.
ISSN 2073-9990 East Cent Afr J Surg
African Journals Online (AJOL)
Appendicular perforation (25.4%) and gangrenous intussusception (23.8%) were the ... Successful management of peritonitis requires timely surgical intervention to ... perforations (especially peptic ulcer perforations) are more common in ...
76 FR 12364 - Agency Information Collection Activities: Bonded Warehouse Regulations
2011-03-07
... respondents or record keepers from the collection of information (a total capital/ startup costs and... Total Annual Responses: 9,254. Estimated Time per Response: 32 minutes. Estimated Total Annual Burden...
Hidayah, E. N.; Yeh, H. H.
2018-01-01
Laboratory scale experiments was conducted to examine effect of permanganate (KMnO4) peroxidation in characterizing and to remove natural organic matter (NOM) in source water. The experimental results shows that increasing permanganate dosage could decreased aromatic matter, as indicated by decreasing UV254 and SUVA value about 23% and 28%, respectively. It seems that permanganate preoxidation caused the breakdown of high molecular weight (MW) organics into low MW ones, as represented by increasing NPDOC about 10%. Further, disinfection by-products formation potential (DBPFP) in terms of trihalomethanes formation potential (THMFP) and haloacetic acid formation potential (HAAP) decreased about 15% and 23%, respectively. HAAFP removal is higher than THMFP removal and that DPBFP removal is consistent with UV254 and NPDOC removal.
International Nuclear Information System (INIS)
1997-01-01
The document reproduces the text of a letter dated 13 August 1997 received by the Director General of the IAEA from the Permanent Mission of Australia to the Agency on behalf of the Member States of the 'Nuclear Suppliers Group (NSG)'. Attached to this letter was a paper entitled 'The Nuclear Suppliers Group: Its origins, role and activities'. The purpose of the letter and the attached paper was to provide detailed background to the origins of guidelines that govern the export of items exclusively for nuclear use and the export of nuclear related dual-use items and technologies. These guidelines were published by the Agency in documents INFCIRC/254/Rev.3/Part 1 and INFCIRC/254/Rev.2/Part 2/Mod.1
The competitive action of UV of different wavelengths of the survival of Saccharomyces cerevisiae
International Nuclear Information System (INIS)
Ivanova, Eh.V.; Pospelov, M.E.; Strakhovskaya, M.G.; Frajkin, G.Ya.
1982-01-01
During investigation into combined action of different wavelengths of UV spectrum on Saccharomyces cerevisiae yeast (strains XII and CI-9) it was established that 334 nm preliminary irradiation causes photoprotection of cells from lethal action of 254 and 313 nm UV-rays. During 334 postradiation irradiation strengthening of lethal action of 254 and 313 nm UV-rays for strain XII, not capable of photoreactivation, is observed. Using specific inhibitor of serotonin-biosynthesis- parachlorophenyl alanine it is shown that 334 nm serotonin synthesis induced by light lies in the base of mechanism of both effects. The effect of postradiation action of 334 nm light for strain CI-9, capable of photoreactivation, depends on interaction of two different photobiological reactions caused by light, photoreactivation and photoinduced synthesis of serotonin
UV induced photoluminescence and thermally stimulated luminescence of ThO{sub 2}:Tb{sup 3+} phosphor
Energy Technology Data Exchange (ETDEWEB)
Godbole, S.V.; Nagpal, J.S.; Page, A.G. E-mail: agpage@magnum.barc.ernet.in
2000-08-15
Thorium oxide doped with trivalent terbium ions offers itself as a novel phosphor with its photo- and thermally-stimulated luminescence (PL and TSL) characteristics showing a marked change on sustained exposure to 254 and 365 nm ultraviolet (UV) radiation. The reduction in luminescence intensity of Tb{sup 3+} ions, on irradiation with 254 nm photons and subsequent restoration on exposure to 365 nm, has been correlated with the complimentary behaviour in UV-induced TSL. These changes are, in turn, ascribed to inter-configurational (f-d) transitions and e-h formation and recombination processes. UV radiation induced TSL output increases linearly with incident UV radiant energy at a constant radiation flux; however, for a fixed exposure, TSL output increases with increase in radiant flux.
UV induced photoluminescence and thermally stimulated luminescence of ThO2:Tb3+ phosphor
International Nuclear Information System (INIS)
Godbole, S.V.; Nagpal, J.S.; Page, A.G.
2000-01-01
Thorium oxide doped with trivalent terbium ions offers itself as a novel phosphor with its photo- and thermally-stimulated luminescence (PL and TSL) characteristics showing a marked change on sustained exposure to 254 and 365 nm ultraviolet (UV) radiation. The reduction in luminescence intensity of Tb 3+ ions, on irradiation with 254 nm photons and subsequent restoration on exposure to 365 nm, has been correlated with the complimentary behaviour in UV-induced TSL. These changes are, in turn, ascribed to inter-configurational (f-d) transitions and e-h formation and recombination processes. UV radiation induced TSL output increases linearly with incident UV radiant energy at a constant radiation flux; however, for a fixed exposure, TSL output increases with increase in radiant flux
LANDFILL LEACHATES PRETREATMENT BY OZONATION
Directory of Open Access Journals (Sweden)
Jacek Leszczyński
2016-06-01
Full Text Available In this paper, the application of ozonation processes for stabilized landfill leachate treatment was investigated. The leachate came from a municipal sanitary landfill located nearby Bielsk Podlaski. The average values of its main parameters were: pH 8.23; COD 870 mgO2/dm3; BOD 90 mgO2/dm3; NH4+ 136.2 mgN/dm3; UV254 absorbance 0.312 and turbidity 14 NTU. The ozone dosages used were in the range of 115.5 to 808.5 mgO3/dm3 of the leachate. The maximum COD, color and UV254 absorbance removal wa.5 mgO3/dm3. After oxidation, the ratio of BOD/COD was increased from 0.1 up to 0.23.
Enforcement and Effectiveness of Consumer Law in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Pauknerová, Monika; Skalská, H.
2017-01-01
Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law
Magnetically responsive biological materials and their applications
Czech Academy of Sciences Publication Activity Database
Šafařík, Ivo; Pospíšková, K.; Baldíková, E.; Šafaříková, Miroslava
2016-01-01
Roč. 7, č. 4 (2016), s. 254-261 ISSN 0976-3961 Institutional support: RVO:60077344 Keywords : adsorbents * biological materials * carriers * magnetic modification * whole-cell biocatalyst Subject RIV: EI - Biotechnology ; Bionics
Czech Academy of Sciences Publication Activity Database
Těšínská, Emilie
2015-01-01
Roč. 60, č. 3 (2015), s. 239-254 ISSN 0032-2423 Institutional support: RVO:68378114 Keywords : general theory of relativity * Albert Einstein * history of science * Viktor Trkal Subject RIV: AB - History
CAMEX-4 NOAA LYMAN-ALPHA HYGROMETER V1
National Aeronautics and Space Administration — Ozone is measured in situ using a photometer consisting of a mercury lamp, two sample chambers and two detectors. The detectors measure the 254nm radiation...
Glia: the fulcrum of brain diseases
Czech Academy of Sciences Publication Activity Database
Giaume, C.; Kirchhoff, F.; Matute, C.; Reichenbach, A.; Verkhratsky, Alexei
2007-01-01
Roč. 14, - (2007), s. 1324-1335 ISSN 1350-9047 Institutional research plan: CEZ:AV0Z50390512 Keywords : Glia * Astrocyte * Oligodendrocyte Subject RIV: FH - Neurology Impact factor: 8.254, year: 2007
Kim, Chan-Hee; Lee, Eun-Song; Kang, Si-Mook; de Josselin de Jong, Elbert; Kim, Baek-Il
2017-06-01
The aim of this study was to determine the effect of titanium dioxide (TiO 2 ) photocatalysis induced by the application of clinically acceptable visible light at 405nm on the growth of Streptococcus mutans biofilms. S. mutans biofilms were grown on a hydroxyapatite (HA) disk and deposited in a rutile-type TiO 2 solution at a concentration of 0.1mg/mL. TiO 2 photocatalysis was measured for exposure to visible light (405nm) and ultraviolet (UV) light (254nm) produced by light-emitting diodes for 10, 20, 30, and 40min. After two treatments, the number of colonies formed in the final S. mutans biofilm on the HA disk were measured to confirm their viability, and the morphological changes of S. mutans were evaluated using scanning electronic microscopy. The bactericidal effects of 254- and 405-nm light resulted in > 5-log and 4-log reductions, respectively (p7-log reduction after 40min of treatment in both treatment groups relative to the control group. It was confirmed that the antibacterial effect could be shown by causing the photocatalytic reaction of TiO 2 in S. mutans biofilm even at the wavelength of visible light (405nm) as at the wavelength of ultraviolet light (254nm). Copyright © 2017 Elsevier B.V. All rights reserved.
Oloibiri, Violet; Ufomba, Innocent; Chys, Michael; Audenaert, Wim; Demeestere, Kristof; Van Hulle, Stijn W H
2015-01-01
A major concern for landfilling facilities is the treatment of their leachate. To optimize organic matter removal from this leachate, the combination of two or more techniques is preferred in order to meet stringent effluent standards. In our study, coagulation-flocculation and ozonation are compared as pre- treatment steps for stabilized landfill leachate prior to granular activated carbon (GAC) adsorption. The efficiency of the pre treatment techniques is evaluated using COD and UVA254 measurements. For coagulation- flocculation, different chemicals are compared and optimal dosages are determined. After this, iron (III) chloride is selected for subsequent adsorption studies due to its high percentage of COD and UVA254 removal and good sludge settle-ability. Our finding show that ozonation as a single treatment is effective in reducing COD in landfill leachate by 66% compared to coagulation flocculation (33%). Meanwhile, coagulation performs better in UVA254 reduction than ozonation. Subsequent GAC adsorption of ozonated effluent, coagulated effluent and untreated leachate resulted in 77%, 53% and 8% total COD removal respectively (after 6 bed volumes). The effect of the pre-treatment techniques on GAC adsorption properties is evaluated experimentally and mathematically using Thomas and Yoon-Nelson models. Mathematical modelling of the experimental GAC adsorption data shows that ozonation increases the adsorption capacity and break through time with a factor of 2.5 compared to coagulation-flocculation.
Rosado-Lausell, Sahid L.; Wang, Hanting; Gutié rrez, Leonardo A.; Romero-Maraccini, Ofelia C.; Niu, Xi-Zhi; Gin, Karina; Croue, Jean-Philippe; Nguyen, Thanh Ha
2013-01-01
Inactivation of bacteriophage MS2 by reactive oxygen species (ROS) and triplet excited state of dissolved organic matter (3DOM*) produced by irradiation of natural and synthetic sensitizers with simulated sunlight of wavelengths greater than 320nm was investigated. Natural sensitizers included purified DOM isolates obtained from wastewater and river waters, and water samples collected from Singapore River, Stamford Canal, and Marina Bay Reservoir in Singapore. Linear correlations were found between MS2 inactivation rate constants (kobs) and the photo-induced reaction rate constants of 2,4,6-trimethylphenol (TMP), a probe compound shown to react mainly with 3DOM*. Linear correlations between MS2 kobs and singlet oxygen (1O2) concentrations were also found for both purified DOM isolates and natural water samples. These correlations, along with data from quenching experiments and experiments with synthetic sensitizers, Rose Bengal (RB), 3'-methoxyacetophenone (3'-MAP), and nitrite (NO2-), suggest that 1O2, 3DOM*, and hydroxyl radicals (•OH) could inactivate bacteriophage MS2. Linear correlations between MS2 kobs and Specific Ultraviolet Absorption determined at 254nm (SUVA254) were also found for both purified DOM isolates and natural samples. These results suggest the potential use of TMP as a chemical probe and SUVA254 as an indicator for virus inactivation in natural and purified DOM water samples. © 2013 Elsevier Ltd.
Xue, Shuang; Jin, Wujisiguleng; Zhang, Zhaohong; Liu, Hong
2017-07-01
The reductions of dissolved organic matter (DOM) and disinfection byproduct precursors in four full-scale wastewater treatment plants (WWTPs) (Liaoning Province, China) where different biological treatment processes were employed in winter were investigated. The total removal efficiencies of dissolved organic carbon (DOC), ultraviolet light at 254 nm (UV-254), trihalomethane formation potential (THMFP), and haloacetic acid formation potential (HAAFP) were in the range of 70.3-76.0%, 49.6-57.3%, 54.4-65.0%, and 53.7-63.8% in the four WWTPs, respectively. The biological treatment was the predominant process responsible for the removal of DOC, THMFP, and HAAFP in WWTPs. Differences in the reduction of UV-254 were not significant (p > 0.05) among biochemical reaction pool, secondary sedimentation tank, and disinfection tank. Biological aerated filter and suspended carrier activated sludge processes achieved higher DOM removal than the conventional active sludge and anaerobic-anoxic-oxic processes. Hydrophobic neutral and hydrophilic fraction were removed to a higher degree through biological treatment than the other three DOM fractions. HAAFP removal was more efficient than THMFP reduction during biological treatment. During primary treatment, fluorescent materials in secondary sedimentation tanks were preferentially removed, as compared to the bulk DOM. Humic-like fluorescent compounds were not readily eliminated during biological treatment. The fluorescent materials were more susceptible to chlorine than nonfluorescent compounds. Copyright © 2017. Published by Elsevier Ltd.
Rosado-Lausell, Sahid L.
2013-09-01
Inactivation of bacteriophage MS2 by reactive oxygen species (ROS) and triplet excited state of dissolved organic matter (3DOM*) produced by irradiation of natural and synthetic sensitizers with simulated sunlight of wavelengths greater than 320nm was investigated. Natural sensitizers included purified DOM isolates obtained from wastewater and river waters, and water samples collected from Singapore River, Stamford Canal, and Marina Bay Reservoir in Singapore. Linear correlations were found between MS2 inactivation rate constants (kobs) and the photo-induced reaction rate constants of 2,4,6-trimethylphenol (TMP), a probe compound shown to react mainly with 3DOM*. Linear correlations between MS2 kobs and singlet oxygen (1O2) concentrations were also found for both purified DOM isolates and natural water samples. These correlations, along with data from quenching experiments and experiments with synthetic sensitizers, Rose Bengal (RB), 3\\'-methoxyacetophenone (3\\'-MAP), and nitrite (NO2-), suggest that 1O2, 3DOM*, and hydroxyl radicals (•OH) could inactivate bacteriophage MS2. Linear correlations between MS2 kobs and Specific Ultraviolet Absorption determined at 254nm (SUVA254) were also found for both purified DOM isolates and natural samples. These results suggest the potential use of TMP as a chemical probe and SUVA254 as an indicator for virus inactivation in natural and purified DOM water samples. © 2013 Elsevier Ltd.
A facile route to synthesis of CoPt magnetic nanoparticles
International Nuclear Information System (INIS)
Liu, Yang; Yang, Yanting; Zhang, Yongjun; Wang, Yaxin; Zhang, Xiaolong; Jiang, Yuhong; Wei, Maobin; Liu, Yanqing; Liu, Xiaoyan; Yang, Jinghai
2013-01-01
Graphical abstract: CoPt NPs are successfully synthesized by sol–gel method. Different distinct particle sizes with narrow particle size distribution of CoPt nanoparticles are obtained. The maximum coercivity of 254,720.3 A/m is obtained for 800 °C heat-treated sample. Display Omitted Highlights: ► L1 0 -CoPt NPs with FCT structure are successfully synthesized by sol–gel method. ► The maximum value of 254,720.3 A/m is obtained for the samples heated at 800 °C. ► The synthetic route proposed in this study is less toxic and easy-to-handle. -- Abstract: The face-centered tetragonal (FCT) ordered L1 0 CoPt nanoparticles (NPs) are prepared by the sol–gel method. Their structure and magnetic properties are characterized by the X-ray diffraction (XRD), the transmission electron microscope (TEM) and the vibrating sample magnetometer (VSM). The results indicate that the CoPt NPs heated at 400 °C are the disordered face-centered cubic (FCC) structure, whereas the samples annealed at the temperature above 600 °C exhibit an ordered FCT structure. TEM images show the increase of the particle size as the annealing temperature increases. SAED images show the appearance of the L1 0 phase at 800 °C, and the maximum coercivity is 254,720.3 A/m.
Feasibility and desirability of employing the thorium fuel cycle for power generation - 254
International Nuclear Information System (INIS)
Sehgal, B.R.
2010-01-01
Thorium fuel cycle for nuclear power generation has been considered since the very start of the nuclear power era. In spite of a very large amount of research, experimentation, pilot scale and prototypic scale installations, the thorium fuel was not adopted for large scale power generation [1,2]. This paper reviews the developments over the years on the front and the back-end of the thorium fuel cycle and describes the pros and cons of employing the thorium fuel cycle for large generation of nuclear power. It examines the feasibility and desirability of employing the thorium fuel cycle in concert with the uranium fuel cycle for power generation. (authors)
16 CFR 254.3 - Misrepresentation of extent or nature of accreditation or approval.
2010-01-01
...) Misrepresent that students successfully completing a course or program of instruction can transfer the credit... subject of unsolicited testimonials or endorsements from former students. It is deceptive for an industry member to use testimonials or endorsements that do not accurately reflect current practices of the school...
Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics
Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G.
2012-01-01
This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct
Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus
Kruus, Hans, 1891-1976
2005-01-01
Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255
Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania
Czech Academy of Sciences Publication Activity Database
Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David
2011-01-01
Roč. 18, 20 September 2011 (2011), s. 245-254 ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology
Czech Academy of Sciences Publication Activity Database
Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.
2013-01-01
Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013
African Journals Online (AJOL)
HP
. 254 responses or injuries to asphyxia. (Shakespare, 2012). Although overwhelming aspiration of regurgitated contents had been considered a potential cause of instant death in mature bovines (Lopez, 2012, Shakespare,. 2012; McEwen ...
Saliba, Jason; Zabriskie, Ryan; Ghosh, Rajarshi; Powell, Bradford C; Hicks, Stephanie; Kimmel, Marek; Meng, Qingchang; Ritter, Deborah I; Wheeler, David A; Gibbs, Richard A; Tsai, Francis T F; Plon, Sharon E
2016-01-01
Background Mutations or alteration in expression of the 5’ nucleotidase gene family can confer altered responses to treatment with nucleoside analogs. While investigating leukemia susceptibility genes, we discovered a very rare p.L254P NT5C1A missense variant in the substrate recognition motif. Given the paucity of cellular drug response data from NT5C1A germline variation, we characterized p.L254P and eight rare variants of NT5C1A from genomic databases. Methods Through lentiviral infection, we created HEK293 cell lines that stably overexpress wildtype NT5C1A, p.L254P, or eight NT5C1A variants reported in the NHLBI Exome Variant server (one truncating and seven missense). IC50 values were determined by cytotoxicity assays after exposure to chemotherapeutic nucleoside analogs (Cladribine, Gemcitabine, 5-Fluorouracil). In addition, we used structure-based homology modeling to generate a 3D model for the C-terminal region of NT5C1A. Results The p.R180X (truncating), p.A214T, and p.L254P missense changes were the only variants that significantly impaired protein function across all nucleotide analogs tested (>5-fold difference versus WT; p<.05). Several of the remaining variants individually displayed differential effects (both more and less resistant) across the analogs tested. The homology model provided a structural framework to understand the impact of NT5C1A mutants on catalysis and drug processing. The model predicted active site residues within NT5C1A motif III and we experimentally confirmed that p.K314 (not p.K320) is required for NT5C1A activity. Conclusion We characterized germline variation and predicted protein structures of NT5C1A. Individual missense changes showed substantial variation in response to the different nucleoside analogs tested, which may impact patients’ responses to treatment. PMID:26906009
Utilizing Colored Dissolved Organic Matter to Derive Dissolved Black Carbon Export by Arctic Rivers
Stubbins, Aron; Spencer, Robert; Mann, Paul; Holmes, R.; McClelland, James; Niggemann, Jutta; Dittmar, Thorsten
2015-10-01
Wildfires have produced black carbon (BC) since land plants emerged. Condensed aromatic compounds, a form of BC, have accumulated to become a major component of the soil carbon pool. Condensed aromatics leach from soils into rivers, where they are termed dissolved black carbon (DBC). The transport of DBC by rivers to the sea is a major term in the global carbon and BC cycles. To estimate Arctic river DBC export, 25 samples collected from the six largest Arctic rivers (Kolyma, Lena, Mackenzie, Ob’, Yenisey and Yukon) were analyzed for dissolved organic carbon (DOC), colored dissolved organic matter (CDOM), and DBC. A simple, linear regression between DOC and DBC indicated that DBC accounted for 8.9 ± 0.3% DOC exported by Arctic rivers. To improve upon this estimate, an optical proxy for DBC was developed based upon the linear correlation between DBC concentrations and CDOM light absorption coefficients at 254 nm (a254). Relatively easy to measure a254 values were determined for 410 Arctic river samples between 2004 and 2010. Each of these a254 values was converted to a DBC concentration based upon the linear correlation, providing an extended record of DBC concentration. The extended DBC record was coupled with daily discharge data from the six rivers to estimate riverine DBC loads using the LOADEST modeling program. The six rivers studied cover 53% of the pan-Arctic watershed and exported 1.5 ± 0.1 million tons of DBC per year. Scaling up to the full area of the pan-Arctic watershed, we estimate that Arctic rivers carry 2.8 ± 0.3 million tons of DBC from land to the Arctic Ocean each year. This equates to ~8% of Arctic river DOC export, slightly less than indicated by the simpler DBC vs DOC correlation-based estimate. Riverine discharge is predicted to increase in a warmer Arctic. DBC export was positively correlated with river runoff, suggesting that the export of soil BC to the Arctic Ocean is likely to increase as the Arctic warms.
The Influence of Water Circulation on Dissolved Organic Matter Dynamics in Bald Head Creek
Lebrasse, M. C.; Osburn, C. L.; Bohnenstiehl, D. R.; He, R.
2016-12-01
Dissolved organic matter (DOM) plays an important role in biogeochemical cycles in estuaries such as tidal creeks draining coastal wetlands such as salt marshes. However, significant knowledge gaps remain regarding the quantity and quality of the DOM that tidally exchanges between salt marshes and their adjacent estuaries. Tidal movements play a central role in lateral exchanges of materials and bidirectional flow results in the mixing of DOM from marsh plants and estuarine DOM. The aim of this study was to better understand the role of water circulation on the distribution and quality of DOM in Bald Head Creek, a tributary to the Cape Fear River estuary in eastern North Carolina. Dissolved organic carbon (DOC) concentration, stable carbon isotopes, and chromophoric DOM (CDOM) absorbance at 254 nm (a254) were used to distinguish between DOM quantity and quality at three locations along the creek: Site 3 (upstream), Site 2 (middle stream), and Site 1 (near the creek mouth). Samples were collected over four tidal cycles between March-August 2016 and compared to time series data collected approximately weekly from 2014-2016. DOM characteristics differed substantially over the tidal cycle. Higher CDOM and DOC concentration were observed at low tide than at high tide at all three sites, suggesting greater export of carbon from the marsh into the creek as the tides recede. Analysis of CDOM quality based on specific UV absorbance at 254 nm (SUVA254) and spectral slope ratio (SR) showed that the marsh end-member (Site 3) source of DOM had greater aromaticity and higher molecular weight. Site 1 showed greater variability over the tidal cycle most likely due to a greater tidal influence, being closer to the mouth. Additionally, an unmanned surface vehicle (USV) and a hydrodynamic model were used to map water circulation and DOC concentration along the creek to compute exchanges with the adjacent estuary. Results suggest that estuarine OM dynamics are strongly controlled by
Utilizing Colored Dissolved Organic Matter to Derive Dissolved Black Carbon Export by Arctic Rivers
Directory of Open Access Journals (Sweden)
Aron eStubbins
2015-10-01
Full Text Available Wildfires have produced black carbon (BC since land plants emerged. Condensed aromatic compounds, a form of BC, have accumulated to become a major component of the soil carbon pool. Condensed aromatics leach from soils into rivers, where they are termed dissolved black carbon (DBC. The transport of DBC by rivers to the sea is a major term in the global carbon and BC cycles. To estimate Arctic river DBC export, 25 samples collected from the six largest Arctic rivers (Kolyma, Lena, Mackenzie, Ob’, Yenisey and Yukon were analyzed for dissolved organic carbon (DOC, colored dissolved organic matter (CDOM, and DBC. A simple, linear regression between DOC and DBC indicated that DBC accounted for 8.9 ± 0.3% DOC exported by Arctic rivers. To improve upon this estimate, an optical proxy for DBC was developed based upon the linear correlation between DBC concentrations and CDOM light absorption coefficients at 254 nm (a254. Relatively easy to measure a254 values were determined for 410 Arctic river samples between 2004 and 2010. Each of these a254 values was converted to a DBC concentration based upon the linear correlation, providing an extended record of DBC concentration. The extended DBC record was coupled with daily discharge data from the six rivers to estimate riverine DBC loads using the LOADEST modeling program. The six rivers studied cover 53% of the pan-Arctic watershed and exported 1.5 ± 0.1 million tons of DBC per year. Scaling up to the full area of the pan-Arctic watershed, we estimate that Arctic rivers carry 2.8 ± 0.3 million tons of DBC from land to the Arctic Ocean each year. This equates to ~8% of Arctic river DOC export, slightly less than indicated by the simpler DBC vs DOC correlation-based estimate. Riverine discharge is predicted to increase in a warmer Arctic. DBC export was positively correlated with river runoff, suggesting that the export of soil BC to the Arctic Ocean is likely to increase as the Arctic warms.
Zhang, Yunlin; Zhou, Yongqiang; Shi, Kun; Qin, Boqiang; Yao, Xiaolong; Zhang, Yibo
2017-12-26
Chromophoric dissolved organic matter (CDOM) is an important optically active substance in aquatic environments and plays a key role in light attenuation and in the carbon, nitrogen and phosphorus biogeochemical cycles. Although the optical properties, abundance, sources, cycles, compositions and remote sensing estimations of CDOM have been widely reported in different aquatic environments, little is known about the optical properties and composition changes in CDOM along trophic gradients. Therefore, we collected 821 samples from 22 lakes along a trophic gradient (oligotrophic to eutrophic) in China from 2004 to 2015 and determined the CDOM spectral absorption and nutrient concentrations. The total nitrogen (TN), total phosphorus (TP), and chlorophyll a (Chla) concentrations and the Secchi disk depth (SDD) ranged from 0.02 to 24.75 mg/L, 0.002-3.471 mg/L, 0.03-882.66 μg/L, and 0.05-17.30 m, respectively. The trophic state index (TSI) ranged from 1.55 to 98.91 and covered different trophic states, from oligotrophic to hyper-eutrophic. The CDOM absorption coefficient at 254 nm (a(254)) ranged from 1.68 to 92.65 m -1 . Additionally, the CDOM sources and composition parameters, including the spectral slope and relative molecular size value, exhibited a substantial variability from the oligotrophic level to other trophic levels. The natural logarithm value of the CDOM absorption, lna(254), is highly linearly correlated with the TSI (r 2 = 0.92, p 10 m -1 , respectively. The results suggested that the CDOM absorption coefficient a(254) might be a more sensitive single indicator of the trophic state than TN, TP, Chla and SDD. Therefore, we proposed a CDOM absorption coefficient and determined the threshold for defining the trophic state of a lake. Several advantages of measuring and estimating CDOM, including rapid experimental measurements, potential in situ optical sensor measurements and large-spatial-scale remote sensing estimations, make it
Santos, L; Santos, E B H; Dias, J M; Cunha, A; Almeida, A
2014-08-01
The influence of photochemical transformations of chromophoric dissolved organic matter (CDOM) on microbial communities was evaluated in the estuarine system Ria de Aveiro. Two sites, representative of the marine and brackish water zones of the estuary, were surveyed regularly in order to determine seasonal and vertical profiles of variation of CDOM properties. Optical parameters of CDOM indicative of aromaticity and molecular weight were used to establish CDOM sources, and microbial abundance and activity was characterized. Additionally, microcosm experiments were performed in order to simulate photochemical reactions of CDOM and to evaluate microbial responses to light-induced changes in CDOM composition. The CDOM of the two estuarine zones showed different spectral characteristics, with significantly higher values of the specific ultra-violet absorbance at 254 nm (SUVA254) (5.5 times) and of the absorption coefficient at 350 nm (a350) (12 times) and lower SR (S275-295/S350-400) ratio at brackish water compared with the marine zone, reflecting the different amounts and prevailing sources of organic matter, as well as distinct riverine and oceanic influences. At the marine zone, the abundance of bacteria and the activity of Leu-AMPase correlated with a350 and a254, suggesting a microbial contribution to the HMW CDOM pool. The irradiation of DOM resulted in a decrease of the values of a254 and a350 and an increase of the slope S275-295 and of the ratios E2 : E3 (a250/a365) and SR, which in turn increase its bioavailability. However, the extent of photoinduced transformations and microbial responses was dependent on the initial optical characteristics of CDOM. In Ria de Aveiro both photochemical and microbial processes yielded optical changes in CDOM and the overall results of these combined processes determine the fate of CDOM in the estuarine system and have an influence on local productivity and in adjacent coastal areas.
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Minor Actinides Recycling in PWRs
International Nuclear Information System (INIS)
Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.
2006-01-01
Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)
Czech Academy of Sciences Publication Activity Database
Juchelka, Jiří
2009-01-01
Roč. 50, 1-2 (2009), s. 254 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : Czech Silesia * Cultur of linear potter * archaeological research Subject RIV: AC - Archeology, Anthropology, Ethnology
75 FR 74608 - Airworthiness Directives; CENTRAIR Models 101, 101A, 101P, and 101AP Gliders
2010-12-01
....societe.com . You may review copies of the referenced service information at the FAA, Small Airplane..., France; telephone: +33 (0)254 370796; fax: +33 (0)54. 374864; Internet: http://www.societe.com . (3) You...
Protective effects of two Astragalus species on ulcerative colitis in rats
African Journals Online (AJOL)
management of UC are corticosteroids, 5- ... toothache, and neck pain, or orally for treating .... Macroscopic assessment of ulcerative colitis ... (version 8) software package (SPSS Inc, USA). ..... University Press, Edinburgh, 1970: 49–254. 6.
Energy Technology Data Exchange (ETDEWEB)
Zhang Shuxiu E-mail: shuxiu_zhang@dyden.co.jp; Kono, Toshihiko; Ito, Akira; Yasaka, Taketo; Uchiike, Heiju
2004-01-01
The luminescent properties of an Eu{sup 2+}-activated hexagonal aluminate, BaMgAl{sub 10}O{sub 17} (BAM), were studied under 147- and 254-nm excitations. The BAM samples were thermally treated by baking and then irradiated in vacuum ultraviolet (VUV) rays. The results show that the emission efficiency of Eu{sup 2+} in BAM under 147-nm excitation degraded seriously after baking or VUV-irradiating treatments, while no significant degradation was observed under 254-nm excitation. The degree of degradation depended on the excitation wavelength, and the absorption edge of the BAM host was suggested to be close to 175 nm (7.2 eV). The differences between the thermal-induced and the VUV-irradiation-induced degradations, and their mechanisms are discussed for the color plasma display applications.
Orientia, rickettsia, and leptospira pathogens as causes of CNS infections in Laos
DEFF Research Database (Denmark)
Dittrich, Sabine; Rattanavong, Sayaphet; Lee, Sue J
2015-01-01
BACKGROUND: Scrub typhus (caused by Orientia tsutsugamushi), murine typhus (caused by Rickettsia typhi), and leptospirosis are common causes of febrile illness in Asia; meningitis and meningoencephalitis are severe complications. However, scarce data exist for the burden of these pathogens......, Neisseria meningitidis, Haemophilus influenzae, S suis) and O tsutsugamushi, Rickettsia typhi/Rickettsia spp, and Leptospira spp infections in blood or cerebrospinal fluid (CSF). We analysed and compared causes and clinical and CSF characteristics between patient groups. FINDINGS: 1051 (95%) of 1112...... patients who presented had CSF available for analysis, of whom 254 (24%) had a CNS infection attributable to a bacterial or fungal pathogen. 90 (35%) of these 254 infections were caused by O tsutsugamushi, R typhi/Rickettsia spp, or Leptospira spp. These pathogens were significantly more frequent than...
Luminescence properties of CdSiO3:Mn2+ phosphor
International Nuclear Information System (INIS)
Lei Bingfu; Liu Yingliang; Ye Zeren; Shi Chunshan
2004-01-01
A novel long-lasting phosphor CdSiO 3 :Mn 2+ is reported in this paper. The Mn 2+ -doped CdSiO 3 phosphor emits orange light with CIE chromaticity coordinates x=0.5814 and y=0.4139 under 254 nm UV light excitation. In the emission spectrum of 1% Mn 2+ -doped CdSiO 3 phosphor, there is a broad emission band centered at 575 nm which can be attributed to the spin-forbidden transition of the d-orbital electron associated with the Mn 2+ ion. The phosphorescence can be seen by the naked eyes in the dark clearly even after the 254 nm UV irradiation have been removed for about 1 h. The mechanism of the origin of the long-lasting phosphorescence was discussed using the thermoluminescence curves
ORF Alignment: NT_033779 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti
Czech Academy of Sciences Publication Activity Database
Dal Moro, Giancarlo
2015-01-01
Roč. 254, JUL 1 (2015), s. 338-349 ISSN 0019-1035 Institutional support: RVO:67985891 Keywords : moon * Regoliths * geophysics * surface- wave Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015
Antagonistic effects of three species of Trichoderma sp. on ...
African Journals Online (AJOL)
Francis
This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.
2018-05-09T14:12:40Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
... by upper respiratory tract (catarrh) 28.3%, typhoid 25.4%, roundworm 14.1% and ... all the girls expressed in terms of standard deviation (Z-score) below median ... including reprints, photographic reproduction and translation are published.
File list: Unc.Neu.10.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Neu.10.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.10.AllAg.Hypothalamus.bed ...
2018-05-13T09:08:56Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
... carbon footprint, green and blue water, human nutrition, production systems, ... is a major contributor to global warming resulted mainly from the FAO publication, ... animal production, from environment to human health; 247-254 2221-4062 ...
Czech Academy of Sciences Publication Activity Database
Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.
2014-01-01
Roč. 1840, č. 1 (2014), s. 245-254 ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014
2013-01-22
... following sites: Site 1 (1,830 acres)--Rivergate Industrial Park, Port Terminal Nos. 5 and 6, and the... Way and NE Alderwood Road, Portland; Site 3 (254 acres)--Portland Ship Repair Yard, 5555 N. Channel...
Czech Academy of Sciences Publication Activity Database
Michiels, J.; Skřivanová, E.; Missotten, J.; Ovyn, A.; Mrázek, Jakub; De Smet, S.; Dierick, N.
2012-01-01
Roč. 96, č. 6 (2012), s. 1101-1111 ISSN 0931-2439 Institutional support: RVO:67985904 Keywords : antioxidant * gut function * weaning piglets Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 1.254, year: 2012
File list: Unc.Neu.20.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Neu.20.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.20.AllAg.Hypothalamus.bed ...
File list: Unc.Neu.50.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Neu.50.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.50.AllAg.Hypothalamus.bed ...
Genetic diversity and population structure in Meconopsis ...
African Journals Online (AJOL)
STORAGESEVER
2010-05-24
May 24, 2010 ... The location and main ecological characteristics of sample sites are shown in ..... suggest that this is wind-pollinated and allogamous plant species ... (Teleostei, Characidae) from an urban stream, Hydrobiology, 553: 245-254 ...
(Catharanthus roseus) tissue culture
African Journals Online (AJOL)
STORAGESEVER
2008-08-18
Aug 18, 2008 ... Abbreviations: NAA, Naphthalen acetic acid; Kin, Kinetin; MS,. Murashige and .... Acidic phase was isolated by sulphuric acid (5%) and ... reaction with Ceric Ammonium Sulfate (CAS) and Ultra violet (UV) detection (λ=254 ...
File list: ALL.Neu.10.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Neu.10.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.10.AllAg.Hypothalamus.bed ...
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len
Czech Academy of Sciences Publication Activity Database
Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.
2018-01-01
Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016
2016-2017 Travel Expense Report for Stephen McGurk, Vice ...
International Development Research Centre (IDRC) Digital Library (Canada)
Beata Bialic
. Destination(s):. Saskatchewan. Airfare: $933.24. Other. Transportation: $89.13. Accommodation: $546.67. Meals and. Incidentals: $254.65. Other: $0.00. Total: $1,823.69. Comments: 2016-2017 Travel Expense Report for Stephen. McGurk ...
48 CFR 3025.7002-3 - Specific application of trade agreements.
2010-10-01
...-discriminatory treatment under the World Trade Organization Agreement on Government Procurement (WTO GPA), or any... the WTO GPA, or any FTA listed in (FAR) 48 CFR subpart 25.4, apply the restrictions of (HSAR) 48 CFR...
File list: ALL.Neu.50.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Neu.50.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.50.AllAg.Hypothalamus.bed ...
File list: ALL.Neu.20.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Neu.20.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.20.AllAg.Hypothalamus.bed ...
Changes in endogenous hormone concentrations during ...
African Journals Online (AJOL)
Administrator
2011-09-14
Sep 14, 2011 ... The flowering initiation of pineapple plants is affected by the plant weight, ... mediate growth response on external factors such as light and temperature. ... vvv), and the detecting wavelength was 254 nm. Standards of ABA,.
Czech Academy of Sciences Publication Activity Database
Płachno, B.J.; Stpiczyńska, M.; Krajewski, Ł.; Świątek, P.; Adamec, Lubomír; Miranda, V.F.O.
2017-01-01
Roč. 254, č. 5 (2017), s. 2007-2015 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic bladderworts * pollination * ultrastructure Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.870, year: 2016
African Journals Online (AJOL)
Items 151 - 200 of 254 ... Vol 28, No 3-4 (2016), Nutrition knowledge of young, post-year one, ... Obstructive Adenoid Hypertrophy in the Adult: A Case Report ... OA Egwuonwu, SNC Anyanwu, EC Ihekwoaba, GU Chianakwana, IBC Iloabachie.
ORF Alignment: NC_002570 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...
ORF Alignment: NC_004311 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...
The structure of the desiccated Richtersius coronifer (Richters, 1903)
Czech Academy of Sciences Publication Activity Database
Czerneková, Michaela; Jönsson, K. I.; Chajec, Ł.; Student, S.; Poprawa, I.
2017-01-01
Roč. 254, č. 3 (2017), s. 1367-1377 ISSN 0033-183X Institutional support: RVO:67985823 Keywords : anhydrobiosis * cryptobiosis * tardigrades * tun * ultrastructure Subject RIV: ED - Physiology OBOR OECD: Cell biology Impact factor: 2.870, year: 2016
Czech Academy of Sciences Publication Activity Database
Maenhaut, W.; Schwarz, Jaroslav; Cafmeyer, J.; Annegarn, H. J.
2002-01-01
Roč. 189, - (2002), s. 254-258 ISSN 0168-583X Institutional research plan: CEZ:AV0Z4072921 Keywords : PIXE * multielement analysis * atmospheric aerosols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.158, year: 2002
Norma tulemuste taga on eksport Venemaale / Virge Lahe
Lahe, Virge
2008-01-01
Autode turvavarustuse tootja AS-i Norma teise kvartali puhaskasum oli 25,4 miljonit krooni, mis on kaks korda enam kui 2007. aasta teises kvartalis, edaspidi võib kasumit survestada terasehinna tõus. Diagramm: Norma kasum on kasvanud
[Reactivity of several classes of pesticides with UV, ozone and permanganate].
Liu, Chao; Qiang, Zhi-min; Tian, Fang; Zhang, Tao
2009-01-01
The reactivity of eight classes of 26 extensively used pesticides, namely, organochlorines, thiadiazole, dinitroanaline, acetamides, triazines, uracil and carbamates, with three common disinfectants or oxidants including UV254 (average intensity of 10.8 mW x cm(-2)), ozone (dosage of 4.1 - 6.2 mg x L(-1)) and permanganate (dosage of 15.8 mg x L(-1)) was investigated. The reactions were allowed to proceed for 30 min at pH 7.0 and ambient temperature (25 degrees C +/- 3 degrees C). Results indicate that under the applied experimental conditions, more than 95% of chlorobenzilate, etridiazole, alachlor, butachlor, metolachlor, propachlor, atrazine, simazine, aldicarb, oxamyl and methiocarb could be effectively removed by UV254; and the removal efficiencies of other pesticides were in a range of 12.9%-77.7%. Ozone could completely degrade chloroneb, dichlorvos, bromacil, aldicarb, carbaryl, carbofuran, oxamyl and methiocarb; prometon and aldicarb sulfone were resistant to ozonation; and the removal efficiencies of other pesticides varied from 19.0% to 93.1%. Permanganate could fully degrade dichlorvos, aldicarb and methiocarb; organochlorines, dinitroanaline, thiadiazole, acetamides and other carbamates were resistant to permanganate oxidation; and the removal efficiencies of other pesticides ranged from 16.0% to 88.2%. If the practical dosage applied in drinking water treatment is considered, it is expected that most of the pesticides will be completely degraded by ozone, a few by permanganate, but probably none by UV254 .
International Nuclear Information System (INIS)
Tyrrell, R.M.
1980-01-01
The induction of mutations (reversion to tryptophan independence) by various UV (254, 313, 334 and 365 nm) and visible (405 and 434 nm) wavelengths was measured in exponential phase populations of Escherichia coli B/r thy trp and B/r thy trp uvr A by assay of irradiated populations on semi-enriched media. No mutations were induced in the repair proficient strain at wavelengths longer than 313 nm. Mutations were induced to the excisionless strain at wavelengths as long as 405 nm but less than expected from the known amount of DNA damage induced. Irradiation at the long wavelenths (434, 405, 365 and 334 nm) suppressed the appearance of 254- or 313 nm-induced mutations in the repair competent strain but not in the excision deficient strain. The relative dose-requirement for mutation suppression was related to the relative efficiency of these wavelengths in inducing growth delay. These results suggest that the growth delay induced by near-UV and visible wavelenghts allows more time for the 'error-free' excision repair process to act on the potentially mutagenic lesions induced by 254- and 313-nm radiations, thereby reducing the mutation frequency observed in the repair-proficient strain. The level of near-UV mutation induced in the excision deficient strain is lower than expected from the DNA damage known to be induced. It is possible that near-UV radiation induces a class of lethal lesions that are not susceptible to error-prone repair. (author)
Zietzschmann, Frederik; Stützer, Christian; Jekel, Martin
2016-04-01
Small-scale granular activated carbon (GAC) tests for the adsorption of organic micro-pollutants (OMP) were conducted with drinking water and wastewater treatment plant (WWTP) effluent. In both waters, three influent OMP concentration levels were tested. As long as the influent OMP concentrations are below certain thresholds, the relative breakthrough behavior is not impacted in the respective water. Accordingly, the GAC capacity for OMP is directly proportional to the influent OMP concentration in the corresponding water. The differences between the OMP breakthrough curves in drinking water and WWTP effluent can be attributed to the concentrations of the low molecular weight acid and neutral (LMW) organics of the waters. Presenting the relative OMP concentrations (c/c0) over the specific throughput of the LMW organics (mg LMW organics/g GAC), the OMP breakthrough curves in drinking water and WWTP effluent superimpose each other. This superimposition can be further increased if the UV absorbance at 254 nm (UV254) of the LMW organics is considered. In contrast, using the specific throughput of the dissolved organic carbon (DOC) did not suffice to obtain superimposed breakthrough curves. Thus, the LMW organics are the major water constituent impacting OMP adsorption onto GAC. The results demonstrate that knowing the influent OMP and LMW organics concentrations (and UV254) of different waters, the OMP breakthroughs and GAC capacities corresponding to any water can be applied to all other waters. Copyright © 2016 Elsevier Ltd. All rights reserved.
Impacts of backwashing on granular activated carbon filters for advanced wastewater treatment.
Frank, Joshua; Ruhl, Aki Sebastian; Jekel, Martin
2015-12-15
The use of granular activated carbon (GAC) in fixed bed filters is a promising option for the removal of organic micropollutants (OMP) from wastewater treatment plant effluents. Frequent backwashing of the filter bed is inevitable, but its effect on potential filter stratification is not well understood yet and thus has been evaluated in the present study for two commercial GAC products. Backwashing of GAC filters was simulated with 10 or 100 filter bed expansions of 20 or 100% at backwash velocities of 12 and 40 m/h, respectively. Five vertical fractions were extracted and revealed a vertical stratification according to grain sizes and material densities. Sieve analyses indicated increasing grain sizes towards the bottom for one GAC while grain sizes of the other GAC were more homogeneously distributed throughout the filter bed. The apparent densities of the top sections were significantly lower than that of the bottom sections of both products. Comparative long term fixed bed adsorption experiments with the top and bottom sections of the stratified GAC showed remarkable differences in breakthrough curves of dissolved organic carbon, UV light absorption at 254 nm wavelength (UVA254) and OMP. GAC from the upper section showed constantly better removal efficiencies than GAC from the bottom section, especially for weakly adsorbing OMP such as sulfamethoxazole. Furthermore correlations between UVA254 reductions and OMP removals were found. Copyright © 2015 Elsevier Ltd. All rights reserved.
Kirjad vallutatud Hiinast / Karl Rumor
Rumor, Karl, pseud., 1886-1971
2008-01-01
1937. a. alanud Hiina-Jaapani sõjast, poliitlistest oludest ja revolutsioonist Hiinas, hiinlastest ja Hiina suhetest teiste riikidega. Varem ilmunud: Uus Eesti 19.-20. aug, 1938, nr. 226-227; 12.-13., 16. sept. 1938, nr. 250-251, 254
Czech Academy of Sciences Publication Activity Database
Lukavský, Jiří
2010-01-01
Roč. 52, č. 1 (2010), s. 15-22 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Word Association Test * electrodermal activity * pupillary activity Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010
African Journals Online (AJOL)
Ayodele Azeez A
Sample of gypsum from the site was obtained and its physical and chemical properties were determined. It was o ... of sisal fiber showed lower rate of 25.4% water absorbency. The result confirmed ..... Crystal System Habit. Cleavage. Lusture.
Indian Academy of Sciences (India)
Date of birth: 21 September 1953. Specialization: Plant Biotechnology, Genetic Engineering and Molecular Biology, Secondary Metabolism Address: Senior Research Adviser, University Institute of Engineering & Technology, Panjab University, Sector 25, Chandigarh 160 014, Panjab Contact: Office: (0172) 254 4107
Prostor města a jeho fázový růst v českých zemích od konce 19. století
Czech Academy of Sciences Publication Activity Database
Semotanová, Eva
2010-01-01
Roč. 36, č. 2 (2010), s. 225-254 ISSN 0323-0988 R&D Projects: GA ČR GA404/09/0897 Institutional research plan: CEZ:AV0Z80150510 Keywords : Urbanization * Towns * Landscape Subject RIV: AB - History
short communication infrared and ultraviolet spectrophotometric
African Journals Online (AJOL)
a
petroleum distillate into acid, base, neutral, saturate and aromatic fractions while Hirsh et al. [9] ... 100% n-hexane 5% Benzene + 15% benzene + benzene, ether and .... Model compounds: toluene 254 nm, o-xylene 263 nm, aniline 230 nm, ...
2010-01-01
... the air by a single occupant; (b) Is used or intended to be used for recreation or sport purposes only... than 155 pounds; or (e) If powered: (1) Weighs less than 254 pounds empty weight, excluding floats and...
Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems
National Research Council Canada - National Science Library
Gui, Fulin
1996-01-01
..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...
International Nuclear Information System (INIS)
Cao, M.H.; Wang, B.B.; Yu, H.S.; Wang, L.L.; Yuan, S.H.; Chen, J.
2010-01-01
The photochemical decomposition of perfluorooctanoic acid (PFOA) in aqueous periodate (IO 4 - ) was investigated under two types of low-pressure mercury lamps: one emits at 254 nm light (UV light) and the other emits both 254 nm and 185 nm light (VUV light). PFOA decomposed efficiently under VUV light irradiation while it decomposed poorly under UV light irradiation. The addition of IO 4 - significantly increased the rate of decomposition and defluorination of PFOA irradiated with UV light whereas it decreased both processes under VUV irradiation. Reactive radical (IO 3 ·) generated by photolysis of IO 4 - initiated the oxidation of PFOA in UV process. Aquated electrons (e aq - ), generated from water homolysis, scavenged IO 4 - resulting in decrease of reactive radical species production and PFOA decomposition. The shorter-chain perfluorocarboxylic acids (PFCAs) formed in a stepwise manner from long-chain PFCAs.
Kil, Yun-Seo; Nam, Joo-Won; Lee, Jun; Seo, Eun Kyoung
2015-08-01
Angelica keiskei (Shin-sun cho) is an edible higher plant with the beneficial preventive effects on cancer, hypertension, and coronary heart disease. Two bioactive chalcones of Shin-sun cho, xanthoangelol (1) and 4-hydroxyderricin (2), were separated simultaneously by using high-speed counter-current chromatography with a two-phase solvent system composed of n-hexane-EtOAc-MeOH-H2O (9:5:9:4). Only nonconsuming processes, solvent fractionations and Sephadex LH-20 column chromatography, were conducted as presteps. Xanthoangelol (1, 35.9 mg, 99.9 % purity at 254 and 365 nm) and 4-hydroxyderricin (2, 4.4 mg, 98.7 % purity at 254 nm and 98.8 % purity at 365 nm) were successfully purified from 70 mg of the processed extract from A. keiskei. The structures of two compounds were confirmed by (1)H- and (13)C-NMR analysis.
Fabrication of amine-functionalized magnetite nanoparticles for water treatment processes
International Nuclear Information System (INIS)
Chan, Candace C. P.; Gallard, Hervé; Majewski, Peter
2012-01-01
Amine-functionalized magnetite nanoparticles are synthesized by a one pot water based process using N-[3-(trimethoxysilyl)propyl]diethylenetriamine (TRIS) as surfactant. The prepared functionalised nanoparticles are characterised by BET surface area measurements, X-ray diffraction, zeta potential measurement, and X-ray photoelectron spectrometry (XPS). The results clearly show the presence of TRIS on the surface of the nanoparticles. XPS analysis indicates the presence of very small amounts of maghemite on the surface of the magnetite nanoparticles. Water treatment test shows that the prepared nanoparticles are capable to remove natural organic matter (NOM) from natural water samples. The removal of NOM by the prepared particles is characterized by analysing the dissolved organic carbon (DOC) content and UV absorbance at 254 nm (UV 254 ) after the treatment of the water samples at various doses and treatment times.
Fabrication of amine-functionalized magnetite nanoparticles for water treatment processes
Energy Technology Data Exchange (ETDEWEB)
Chan, Candace C. P. [University of South Australia, Ian Wark Research Institute (Australia); Gallard, Herve [Universite de Poitiers, Laboratoire de Chimie et Microbiologie de l' Eau (LCME)-UMR CNRS 6008 (France); Majewski, Peter, E-mail: peter.majewski@unisa.edu.au [Mawson Institute, University of South Australia, School of Advanced Manufacturing and Mechanical Engineering (Australia)
2012-03-15
Amine-functionalized magnetite nanoparticles are synthesized by a one pot water based process using N-[3-(trimethoxysilyl)propyl]diethylenetriamine (TRIS) as surfactant. The prepared functionalised nanoparticles are characterised by BET surface area measurements, X-ray diffraction, zeta potential measurement, and X-ray photoelectron spectrometry (XPS). The results clearly show the presence of TRIS on the surface of the nanoparticles. XPS analysis indicates the presence of very small amounts of maghemite on the surface of the magnetite nanoparticles. Water treatment test shows that the prepared nanoparticles are capable to remove natural organic matter (NOM) from natural water samples. The removal of NOM by the prepared particles is characterized by analysing the dissolved organic carbon (DOC) content and UV absorbance at 254 nm (UV{sub 254}) after the treatment of the water samples at various doses and treatment times.
Development of a magnetic coagulant based on Moringa oleifera seed extract for water treatment.
Santos, Tássia R T; Silva, Marcela F; Nishi, Leticia; Vieira, Angélica M S; Fagundes-Klen, Márcia R; Andrade, Murilo B; Vieira, Marcelo F; Bergamasco, Rosângela
2016-04-01
In this work, to evaluate the effectiveness of the coagulation/flocculation using a natural coagulant, using Moringa oleifera Lam functionalized with magnetic iron oxide nanoparticles, producing flakes that are attracted by an external magnetic field, thereby allowing a fast settling and separation of the clarified liquid, is proposed. The removal efficiency of the parameters, apparent color, turbidity, and compounds with UV254nm absorption, was evaluated. The magnetic functionalized M. oleifera Lam coagulant could effectively remove 90 % of turbidity, 85 % of apparent color, and 50 % for the compounds with absorption at UV254nm, in surface waters under the influence of an external magnetic field within 30 min. It was found that the coagulation/flocculation treatment using magnetic functionalized M. oleifera Lam coagulant was able to reduce the values of the physico-chemical parameters evaluated with reduced settling time.
Paths to subreplacement fertility : the empirical evidence / Tomas Frejka, John Ross
Frejka, Tomas
2001-01-01
Autorid väidavad, et paljudes riikides jääb sündimus ka edaspidi väga madalaks. Vaadeldakse 54 riigis abielude sõlmimist, rasestumisvastaste vahendite kasutamist ja abortide arvu. Diagrammid ja tabelid. Lisa lk. 213-254
Assessment of Phaseolus vulgaris L and Vigna unguiculata (L ...
African Journals Online (AJOL)
SAM
2014-04-09
Apr 9, 2014 ... searching natural compounds with biological activity. .... remain permanently open access under the terms of the Creative Commons Attribution License 4.0 ... (TLC) plate silica gel 60 F254 (Merck 2 × 6 cm), each plate was.
Reconstruction of Effective Cloud Field Geometry from Series of Sunshine Number
Czech Academy of Sciences Publication Activity Database
Badescu, V.; Paulescu, M.; Brabec, Marek
176-177, 1 July - 1 August (2016), s. 254-266 ISSN 0169-8095 Institutional support: RVO:67985807 Keywords : cloud field geometry * sunshine number * point cloud iness Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 3.778, year: 2016
Johansen, Kasper; Sallam, Nader; Robson, Andrew; Samson, Peter; Chandler, Keith; Derby, Lisa; Eaton, Allen; Jennings, Jillian
2017-01-01
mapping approaches suitable for risk mapping. The GEOBIA mapping approach for canegrub damage detection was evaluated over three selected study sites in Queensland, covering a total of 254 km2 and included five main steps developed in the e
Book review Information and Communication Technologies for ...
African Journals Online (AJOL)
Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256.
Lifescience Database Archive (English)
Full Text Available QT75075 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germination... rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr12 49.5-63.0 2.54 ... 10.1111/j.1365-3040.2011.02463.x 22074055
Treatability of South African surface waters by enhanced coagulation
African Journals Online (AJOL)
2013-06-05
Jun 5, 2013 ... From the study of 4 South African inland waters, this paper demonstrates that UV254 ... are effective at NOM removal, there is emerging consensus that ferric chloride is ...... contaminants in drinking water. EPA-600-R-01-110.
Czech Academy of Sciences Publication Activity Database
Vlachová, Klára; Řeháková, Blanka
2009-01-01
Roč. 15, č. 2 (2009), s. 254-279 ISSN 1354-5078 R&D Projects: GA ČR GA403/02/1500 Institutional research plan: CEZ:AV0Z70280505 Keywords : European Union * ISSP * Czech Republic Subject RIV: AO - Sociology, Demography
KWIC Index of nuclear codes (1975 edition)
International Nuclear Information System (INIS)
Akanuma, Makoto; Hirakawa, Takashi
1976-01-01
It is a KWIC Index for 254 nuclear codes in the Nuclear Code Abstracts (1975 edition). The classification of nuclear codes and the form of index are the same as those in the Computer Programme Library at Ispra, Italy. (auth.)
Is PT -symmetric quantum theory false as a fundamental theory?
Czech Academy of Sciences Publication Activity Database
Znojil, Miloslav
2016-01-01
Roč. 56, č. 3 (2016), s. 254-257 ISSN 1210-2709 R&D Projects: GA ČR GA16-22945S Institutional support: RVO:61389005 Keywords : quantum mechanics * PT-symmetric representations of observables * masurement outcomes Subject RIV: BE - Theoretical Physics
2010-10-01
... Section 725.403 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Trade Agreements 725.403 Exceptions. FAR 25.4 establishes procedures for purchases under the Trade Agreements Act of 1979 (including GATT's Agreement on Government Procurement) and...
DEFF Research Database (Denmark)
A-Elbasit, Ishraga E; Elbashir, Mustafa I; Khalil, Insaf F
2006-01-01
OBJECTIVE: To compare the efficacy of sulfadoxine-pyremethamine (SP)+chloroquine (CQ) combination treatment against falciparum malaria with SP treatment alone. METHOD: In-vivo study of 254 patients with uncomplicated Plasmodium falciparum malaria in rural eastern Sudan, where the population is semi...
2017-2018 Travel Expense Reports for Stephen McGurk, Vice ...
International Development Research Centre (IDRC) Digital Library (Canada)
06-28 to 2017-06-29. Destination(s):. Vancouver. Airfare: $1,301.48. Other. Transportation: $78.00. Accommodation: $254.25. Meals and. Incidentals: $161.19. Other: $0.00. Total: $1,794.92. Comments: 2017-2018 Travel Expense Reports for ...
Coping a rezistencia voči mobbingu v kontexte paradigmatického prístupu
Czech Academy of Sciences Publication Activity Database
Vitková, M.; Zábrodská, Kateřina
2014-01-01
Roč. 58, č. 3 (2014), s. 254-269 ISSN 0009-062X R&D Projects: GA ČR GA14-02098S Institutional support: RVO:68081740 Keywords : coping * rezistencia * mobbing Subject RIV: AN - Psychology Impact factor: 0.239, year: 2014
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...
Health problems of children with disabilities with special reference to ...
African Journals Online (AJOL)
admin
Conclusion: Majority of CWDs were not enjoying the health care provisions available in the study area because of the .... justice offices, the health office, the labor and social .... reasons (25.4 %), accidents (16.2%), hereditary (1.7%) and other ...
2010-07-22
... Federal holidays. FOR FURTHER INFORMATION CONTACT: Mr. Anthony DeSimone, (317) 226-5307, Office of Program... 254, Indianapolis, Indiana, 46204, Monday through Friday, except Federal holidays. SUPPLEMENTARY... Virgin Islands and American Samoa. Frequency: Annually. Estimated Average Burden per Response: There is...
Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals
Czech Academy of Sciences Publication Activity Database
Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.
2004-01-01
Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004
Decay studies of neutron-deficient lawrencium isotopes
International Nuclear Information System (INIS)
Antalic, S.; Saro, S.; Streicher, B.; Venhart, M.; Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R.; Hofmann, S.; Kuusiniemi, P.; Leino, M.; Nishio, K.; Sulignano, B.
2008-01-01
The radioactive decay of the isotopes 254-256 Lr and their daughter products was investigated by means of α, prompt α-γ and delayed conversion electron-γ coincidence spectroscopy. The isotopes were produced using the reaction 48 Ca+ 209 Bi. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mailler, R., E-mail: romain.mailler@siaap.fr [LEESU (UMR MA 102, Université Paris-Est, AgroParisTech), Université Paris-Est Créteil, 61 avenue du Général de Gaulle, 94010 Créteil Cedex (France); Gasperi, J., E-mail: gasperi@u-pec.fr [LEESU (UMR MA 102, Université Paris-Est, AgroParisTech), Université Paris-Est Créteil, 61 avenue du Général de Gaulle, 94010 Créteil Cedex (France); Coquet, Y. [SAUR, Direction de la Recherche et du Développement, 1 rue Antoine Lavoisier, 78064 Guyancourt (France); Buleté, A.; Vulliet, E. [Université de Lyon, Institut des Sciences Analytiques, UMR5280 CNRS, Université Lyon 1, ENS-Lyon, 5 rue de la Doua, 69100 Villeurbanne (France); Deshayes, S. [LEESU (UMR MA 102, Université Paris-Est, AgroParisTech), Université Paris-Est Créteil, 61 avenue du Général de Gaulle, 94010 Créteil Cedex (France); LCPP (Laboratoire Central de la Préfecture de Police), 39 bis rue de Dantzig, 75015 Paris (France); Zedek, S. [LEESU (UMR MA 102, Université Paris-Est, AgroParisTech), Université Paris-Est Créteil, 61 avenue du Général de Gaulle, 94010 Créteil Cedex (France); and others
2016-01-15
Among the solutions to reduce micropollutant discharges into the aquatic environment, activated carbon adsorption is a promising technique and a large scale pilot has been tested at the Seine Centre (240,000 m{sup 3}/d — Paris, France) wastewater treatment plant (WWTP). While most of available works studied fixed bed or contact reactors with a separated separation step, this study assesses a new type of tertiary treatment based on a fluidized bed containing a high mass of activated carbon, continuously renewed. For the first time in the literature, micro-grain activated carbon (μGAC) was studied. The aims were (1) to determine the performances of fluidized bed operating with μCAG on both emerging micropollutants and conventional wastewater quality parameters, and (2) to compare its efficiency and applicability to wastewater to former results obtained with PAC. Thus, conventional wastewater quality parameters (n = 11), pharmaceuticals and hormones (PPHs; n = 62) and other emerging pollutants (n = 57) have been monitored in μGAC configuration during 13 campaigns. A significant correlation has been established between dissolved organic carbon (DOC), PPHs and UV absorbance at 254 nm (UV-254) removals. This confirms that UV-254 could be used as a tertiary treatment performance indicator to monitor the process. This parameter allowed identifying that the removals of UV-254 and DOC reach a plateau from a μGAC retention time (SRT) of 90–100 days. The μGAC configuration substantially improves the overall quality of the WWTP discharges by reducing biological (38–45%) and chemical oxygen demands (21–48%), DOC (13–44%) and UV-254 (22–48%). In addition, total suspended solids (TSS) are retained by the μGAC bed and a biological activity (nitratation) leads to a total elimination of NO{sub 2}{sup −}. For micropollutants, PPHs have a good affinity for μGAC and high (> 60%) or very high (> 80%) removals are observed for most of the quantified compounds (n = 22
International Nuclear Information System (INIS)
Mailler, R.; Gasperi, J.; Coquet, Y.; Buleté, A.; Vulliet, E.; Deshayes, S.; Zedek, S.
2016-01-01
Among the solutions to reduce micropollutant discharges into the aquatic environment, activated carbon adsorption is a promising technique and a large scale pilot has been tested at the Seine Centre (240,000 m"3/d — Paris, France) wastewater treatment plant (WWTP). While most of available works studied fixed bed or contact reactors with a separated separation step, this study assesses a new type of tertiary treatment based on a fluidized bed containing a high mass of activated carbon, continuously renewed. For the first time in the literature, micro-grain activated carbon (μGAC) was studied. The aims were (1) to determine the performances of fluidized bed operating with μCAG on both emerging micropollutants and conventional wastewater quality parameters, and (2) to compare its efficiency and applicability to wastewater to former results obtained with PAC. Thus, conventional wastewater quality parameters (n = 11), pharmaceuticals and hormones (PPHs; n = 62) and other emerging pollutants (n = 57) have been monitored in μGAC configuration during 13 campaigns. A significant correlation has been established between dissolved organic carbon (DOC), PPHs and UV absorbance at 254 nm (UV-254) removals. This confirms that UV-254 could be used as a tertiary treatment performance indicator to monitor the process. This parameter allowed identifying that the removals of UV-254 and DOC reach a plateau from a μGAC retention time (SRT) of 90–100 days. The μGAC configuration substantially improves the overall quality of the WWTP discharges by reducing biological (38–45%) and chemical oxygen demands (21–48%), DOC (13–44%) and UV-254 (22–48%). In addition, total suspended solids (TSS) are retained by the μGAC bed and a biological activity (nitratation) leads to a total elimination of NO_2"−. For micropollutants, PPHs have a good affinity for μGAC and high (> 60%) or very high (> 80%) removals are observed for most of the quantified compounds (n = 22/32), i
30 CFR 254.7 - How do I submit my response plan to the MMS?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit my response plan to the MMS... do I submit my response plan to the MMS? You must submit the number of copies of your response plan that the appropriate MMS regional office requires. If you prefer to use improved information technology...
Directory of Open Access Journals (Sweden)
José Nivaldo da Silva
2010-06-01
Full Text Available A erliquiose canina é uma doença transmitida por carrapatos Rhipicephalus sanguineus e ocasionada pela Ehrlichia canis, bactéria intracelular obrigatória. O presente estudo verificou a prevalência de anticorpos anti-E. canis em 254 cães de quatro regiões administrativas de Cuiabá, Estado de Mato Grosso, por imunofluorescência indireta, observando-se uma prevalência de 42,5% (108/254 sem diferença significativa entre as regiões. As variáveis idade, raça, sexo, hábitat, acesso à zona rural e presença de carrapatos foram analisadas. Os títulos de anticorpos variaram entre 1:40 a 1:2.560. Somente 32 (29,63% cães soropositivos estavam infestados por carrapatos, todos R. sanguineus. O resultado encontrado confirma que não há predisposição racial, sexual ou etária, enquanto a menor ocorrência de cães reagentes no intradomicílio provavelmente está relacionada à baixa infestação por carrapato, apesar de não ter sido observada diferença significativa entre os cães com ou sem a infestação com o carrapato vetor.Canine ehrlichiosis is a disease transmitted by ticks Rhipicephalus sanguineus and caused by Ehrlichia canis, obligatory intracellular bacteria. The present study examined the prevalence of anti-E. canis in 254 dogs from four administrative regions of Cuiabá, Mato Grosso, by indirect immunofluorescence assay. There was a prevalence of 42.5% (108/254 without significant difference between the studied regions. The variables age, breed, sex, habitat, access to rural and ticks were analyzed. The antibody titers ranged from 1:40 to 1:2,560. Only 32 (29.63% seropositive dogs were infested with ticks, all R. sanguineus. The results confirm that do not have breed, sex or age predisposition to ehrlichiosis due E. canis, while the lowest occurrence of reactive dogs indoors probably related to low tick infestation, although no significant difference between dogs with or without infestation with the tick vector.
Chang, Ji Suk; Jun, Hee-Jin; Park, Minsung
2016-10-01
The transcriptional coactivator PGC-1α plays a central role in hepatic gluconeogenesis. We previously reported that alternative splicing of the PGC-1α gene produces an additional transcript encoding the truncated protein NT-PGC-1α NT-PGC-1α is co-expressed with PGC-1α and highly induced by fasting in the liver. NT-PGC-1α regulates tissue-specific metabolism, but its role in the liver has not been investigated. Thus, the objective of this study was to determine the role of hepatic NT-PGC-1α in the regulation of gluconeogenesis. Adenovirus-mediated expression of NT-PGC-1α in primary hepatocytes strongly stimulated the expression of key gluconeogenic enzyme genes (PEPCK and G6Pase), leading to increased glucose production. To further understand NT-PGC-1α function in hepatic gluconeogenesis in vivo, we took advantage of a previously reported FL-PGC-1α -/- mouse line that lacks full-length PGC-1α (FL-PGC-1α) but retains a slightly shorter and functionally equivalent form of NT-PGC-1α (NT-PGC-1α 254 ). In FL-PGC-1α -/- mice, NT-PGC-1α 254 was induced by fasting in the liver and recruited to the promoters of PEPCK and G6Pase genes. The enrichment of NT-PGC-1α 254 at the promoters was closely associated with fasting-induced increase in PEPCK and G6Pase gene expression and efficient production of glucose from pyruvate during a pyruvate tolerance test in FL-PGC-1α -/- mice. Moreover, FL-PGC-1α -/- primary hepatocytes showed a significant increase in gluconeogenic gene expression and glucose production after treatment with dexamethasone and forskolin, suggesting that NT-PGC-1α 254 is sufficient to stimulate the gluconeogenic program in the absence of FL-PGC-1α Collectively, our findings highlight the role of hepatic NT-PGC-1α in stimulating gluconeogenic gene expression and glucose production. © 2016 The Authors. Physiological Reports published by Wiley Periodicals, Inc. on behalf of the American Physiological Society and The Physiological Society.
Unit Ministry Team Religious Support to Casualties on the Airland Battlefield
1987-10-28
Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart
antidiabetic activity of anacardium occidentale in alloxan – diabetic
African Journals Online (AJOL)
User
ethanolic extract led to fractions that displayed diverse hypoglycemic effects at doses of 34.0,. 200.0 and 300.0 mg/kg body ... plates. TLC bands were visualized under UV lamps at 254 and 366 nm or with vanilin spray reagent. Plant Material.
Separation and identification of carp pituitary proteins and glycoproteins
Czech Academy of Sciences Publication Activity Database
Ryšlavá, H.; Janatová, M.; Čalounová, G.; Selicharová, Irena; Barthová, J.; Barth, Tomislav
2005-01-01
Roč. 50, č. 9 (2005), 430-437 ISSN 1212-1819 R&D Projects: GA MZe(CZ) QF3028 Institutional research plan: CEZ:AV0Z4055905 Keywords : carp hormones * glycoproteins * oligosaccharide chains Subject RIV: CE - Biochemistry Impact factor: 0.254, year: 2005
Corrigendum to “Geometric Arveson–Douglas conjecture” [Adv. Math. 274 (2015) 606–630
Czech Academy of Sciences Publication Activity Database
Engliš, Miroslav; Eschmeier, J.
2015-01-01
Roč. 278, June (2015), s. 254 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson- Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S000187081500119X
Choosing adolescent smokers as friends : The role of parenting and parental smoking
Mercken, L.; Sleddens, E. F. C.; de Vries, H.; Steglich, C. E. G.
The present study examined whether parenting and parental smoking can prevent children from selecting smoking friends during adolescence. 254 Adolescents of one Belgian secondary school participated. Self-administered questionnaires were distributed among 2nd-4th graders (mean ages = 14.2-16.2
78 FR 68987 - Guides for Private Vocational and Distance Education Schools
2013-11-18
... deceptive practices in connection with the advertising, promotion, marketing, or sale of their courses or... CFR Part 254 Advertising, Trade practices. Text of Amendments For the reasons set forth in the... the application of section 5 of the FTC Act [[Page 68990
Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum
Czech Academy of Sciences Publication Activity Database
Kirchner, Karel; Kuča, M.
2009-01-01
Roč. 50, 1-2 (2009), s. 253-254 ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology
Impact-pressure controlled orientation of shatter cone magnetizations in Sierra Madera, Texas, USA
Czech Academy of Sciences Publication Activity Database
Adachi, T.; Kletetschka, Günther
2008-01-01
Roč. 52, č. 2 (2008), s. 237-254 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30130516 Keywords : shatter cones * impact crater * shock fractures * magnetism * Mars Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.770, year: 2008
Differential operators admitting various rates of spectral projection growth
Czech Academy of Sciences Publication Activity Database
Mityagin, B.; Siegl, Petr; Viola, J.
2017-01-01
Roč. 272, č. 8 (2017), s. 3129-3175 ISSN 0022-1236 Institutional support: RVO:61389005 Keywords : harmonic and anharmonic oscillators * Hennite functions * spectral projections * Riesz basis Subject RIV: BE - Theoretical Physics OBOR OECD: Pure mathematics Impact factor: 1.254, year: 2016
ORF Alignment: NC_003318 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini
Thermodynamic and Spectrophotometric Studies of Electron Donor ...
African Journals Online (AJOL)
Some features of the formed complex, such as molar ratio of the reaction and effect of time ... Thermodynamic parameters were determined as well, the method was ... enthalpy change (ÄH) was steady at -0.254 kcal.mol-1 while the free energy ...
Integrating AR services for the masses: geotagged POI transformation platform
Czech Academy of Sciences Publication Activity Database
Trojan, Jakub
2016-01-01
Roč. 7, č. 3 (2016), s. 254-265 ISSN 1757-9880 Institutional support: RVO:68145535 Keywords : augmented reality * location-based services * geotagging * points of interest Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://dx.doi.org/10.1108/JHTT-07-2015-0028
Data of evolutionary structure change: 1OZHA-1UPCB [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1OZHA-1UPCB 1OZH 1UPC A B VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLL...>B 1UPCB LLGSSEGIDTPNPP HH... ASP CA 254 1UPC B 1UPCB...MET CA 330 1UPC B 1UPCB.../pdbID> B 1UPCB WQKGIEKKTVR
J. Tinbergen (Jan)
1967-01-01
textabstractSeries ‘Wereldakademie’ No. 18. In English: Development Planning, Series World University Library No. 18, Weidenfeld and Nicolson, London, 1967, 256 p. In Spanish: Planificacion del Desarrollo, Series ‘Biblioteca para el Hombre Actual’, Ediciones Guadarrama, Madrid, 1967, 254 p. In
The degradation of cylindrospermopsin (CYN), a widely distributed and highly toxic cyanobacterial toxin (cyanotoxin), remains poorly elucidated. In this study, the mechanism of CYN destruction by UV-254 nm/H2O2 advanced oxidation process (AOP) was investigated by mass spectrometr...
Czech Academy of Sciences Publication Activity Database
Goodson, W.H.; Vondráček, Jan
2015-01-01
Roč. 36, JUN 2015 (2015), s. 254-296 ISSN 0143-3334 R&D Projects: GA ČR(CZ) GA13-07711S Keywords : BREAST-CANCER CELLS * ESTROGEN-RECEPTOR-ALPHA * EPITHELIAL-MESENCHYMAL TRANSITION Subject RIV: BO - Biophysics Impact factor: 4.874, year: 2015
Word order and information structure in Czech 3-and 4-year-olds' comprehension.
Czech Academy of Sciences Publication Activity Database
Smolík, Filip
2015-01-01
Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015
2011-12-20
... Government Procurement Agreement (WTO GPA) country (Aruba, Austria, Belgium, Bulgaria, Canada, Cyprus, Czech... of Subjects in 48 CFR Parts 212, 225, and 252 Government procurement. Ynette R. Shelkin, Editor... (see FAR 25.4). (2) World Trade Organization--Government Procurement Agreement. For covered contracts...
DEFF Research Database (Denmark)
Nawaz, Shah; Shah, Noor S.; Khan, Javed Ali
2017-01-01
Bromate, a potential carcinogen, is a well known highly persistent and environmentally recalcitrant contaminant. UV-254/sulfite-based advanced reductive pathways (ARPs) were proposed to eliminate bromate successfully from water. Experiments with N2, N2O, 2-chlorophenol, inorganic ions, and differ...
2010-02-19
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 79 [CG Docket No. 05-231; ET Docket No. 99-254; FCC 08-255] Closed Captioning of Video Programming; Closed Captioning Requirements for Digital Television... Captioning of Video Programming; Closed Captioning Requirements for Digital Television Receivers, Declaratory...
Sledování obsahu tritia ve srážkových vodách
Czech Academy of Sciences Publication Activity Database
Světlík, Ivo; Budská, E.
2001-01-01
Roč. 9, 7/8 (2001), s. 251-254 ISSN 1210-7085 R&D Projects: GA AV ČR KSK4055109 Institutional research plan: CEZ:AV0Z1048901 Keywords : tritium * monitoring * atmospheric precipitation Subject RIV: DL - Nuclear Waste, Radioactive Pollution ; Quality
Pití bílého vína kávečeři oddaluje aterosklerózu a působí antikoagulačně
Czech Academy of Sciences Publication Activity Database
Šamánek, M.; Dobiášová, Milada; Urbanová, Z.; Kašpar, Z.; Omáčka, A.
2002-01-01
Roč. 8, č. 141 (2002), s. 251-254 ISSN 0008-7335 R&D Projects: GA MZd NA6590 Institutional research plan: CEZ:AV0Z5011922 Keywords : white wine * lipoprotein markers * HDL-C Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery
2. Home 3. Journals 4. Resonance–Journal of Science Education 5 ...
Indian Academy of Sciences (India)
IAS Admin
Day with School. Children. Vishwesha Guttal. 254. Classics. Predictability: Does the Flap of a Butterfly's Wings in. Brazil Set off a Tornado in Texas? Edward U Lorenz. Science Academies' Refresher Course in Quantum. Mechanics. Science Academies' Refresher Course in Mathematics. Information & Announcements. 278.
2011-07-11
... Administration (FHA) Mortgage Insurance Premiums for Multifamily Housing Programs, Health Care Facilities and... mortgage insurance premiums (MIPs) for FHA Multifamily Housing, Health Care Facilities, and Hospital... mortgage insurance regulation at 24 CFR 207.254 provides as follows: Notice of future premium changes will...
Tailored Training in Vehicle Maintenance Courses
2014-07-01
1998) and that the predictive power of GMA often swamps that of specific (i.e., more narrow) tests ( Thorndike , 1985). 15...Command. Thorndike , R. L. (1985). The central role of general ability in prediction. Multivariate Behavioral Research, 20, 241-254. VanLehn, K
Directory of Open Access Journals (Sweden)
Wasinton Simanjuntak
2011-07-01
Full Text Available In the present study, electrocoagulation method was employed to remove natural organic matter from brackish water. This study explores the potential of brackish water as a source of potable water. Two electrochemical variables, potential and contact time, were tested to determine their effect on the treatment efficiency defined in terms of the reduction of the absorbance at the wavelength of 254 nm (A254. Both potential and contact time were found to influence the removal efficiency of the method, and the best result was obtained from the experiment using the potential of 8 V and contact time of 60 min, resulting in 69.5% reduction of the absorbance. Very clean treated water was produced with much lower conductivity (12.06 mS/cm as compared to that obtained for the sea water sample from a location near to the sampling site (133.9 mS/cm.
Zhang, Xuan; Wang, Youpeng; Li, Guo; Liu, Zhaotie; Liu, Zhongwen; Jiang, Jinqiang
2017-01-01
An amphiphilic block copolymer of poly(ethylene oxide)-b-poly((N-methacryloxy phthalimide)-co-(7-(4-vinyl-benzyloxyl)-4-methylcoumarin)) (PEO 45 -b-P(MAPI 36 -co-VBC 4 )) is designed to improve the micellar stability during the photo-triggered release of hydrophobic cargoes. Analysis of absorption and emission spectra, solution transmittance, dynamic light scattering, and transmission electron microscopy supports that polymer micelles of PEO 45 -b-P(MAPI 36 -co-VBC 4 ) upon the combinational irradiation of 365 and 254 nm light can be solubilized through the photolysis of phthalimide esters and simultaneously crosslinked via the partially reversible photo-dimerization of coumarins. The photo-triggered release experiment shows that the leakage of doxorubicin molecules from crosslinked micelles can be predictably regulated by controlling the irradiation time of 365 and 254 nm light. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
DEFF Research Database (Denmark)
Milman, N; Schultz-Larsen, K
1994-01-01
Iron status, including serum (S-) ferritin and hemoglobin (Hb) was assessed in a population survey of 469 old subjects (70 years of age; 254 men, 215 women); 7.9% of the participants had abnormal laboratory tests indicating diseases which might be connected with inappropriately high S-ferritin le......Iron status, including serum (S-) ferritin and hemoglobin (Hb) was assessed in a population survey of 469 old subjects (70 years of age; 254 men, 215 women); 7.9% of the participants had abnormal laboratory tests indicating diseases which might be connected with inappropriately high S......-ferritin levels. Men had a median S-ferritin of 114 micrograms/L, 5-95 percentile 28-373 micrograms/L; 2.4% had values depleted iron stores), 3.5% values from 15-30 micrograms/L (i.e., small iron stores), and 94.1% values > 30 micrograms/L (e.g., replete iron stores); 74.4% had values...
DEFF Research Database (Denmark)
Pedersen, Alma B; Mehnert, Frank; Overgaard, Søren
2009-01-01
BACKGROUND: Allogeneic red blood cell transfusion is frequently used in total hip replacement surgery (THR). However, data on the prognosis of transfused patients are sparse. In this study we compared the risk of complications following THR in transfused and non-transfused patients. METHODS......: A population-based follow-up study was performed using data from medical databases in Denmark. We identified 28,087 primary THR procedures performed from 1999 to 2007, from which we computed a propensity score for red blood cell transfusion based on detailed data on patient-, procedure-, and hospital......-related characteristics. We were able to match 2,254 transfused with 2,254 non-transfused THR patients using the propensity score. RESULTS: Of the 28,087 THR patients, 9,063 (32.3%) received at least one red blood cell transfusion within 8 days of surgery. Transfused patients had higher 90-day mortality compared...
Ozone and membrane filtration based strategies for the treatment of cork processing wastewaters
Energy Technology Data Exchange (ETDEWEB)
Benitez, F. Javier [Departamento de Ingenieria Quimica, Universidad de Extremadura, 06071 Badajoz (Spain)], E-mail: javben@unex.es; Acero, Juan L.; Leal, Ana I.; Real, Francisco J. [Departamento de Ingenieria Quimica, Universidad de Extremadura, 06071 Badajoz (Spain)
2008-03-21
The degradation of the pollutant organic matter present in the cork processing wastewater was studied by combining chemical treatments, which used ozone and some Advanced Oxidation Processes, and membrane filtration procedures. Two schemes were conducted: firstly, a single ozonation stage followed by an UF stage; and secondly, a membrane filtration stage, using different MF and UF membranes, followed by a chemical oxidation stage, where ozone, UV radiation, and the AOPs constituted by ozone plus UV radiation and ozone plus hydrogen peroxide, were used. The membrane filtration stages were carried out in tangential filtration laboratory equipment, and the membranes used were two MF membranes with pores sizes of 0.65 and 0.1 {mu}m, and three UF membranes with molecular weights cut-off of 300, 10, and 5 kDa. The effectiveness of the different stages (conversions in the chemical procedures and rejection coefficients in the membrane processes) were evaluated in terms of several parameters which measure the global pollutant content of the wastewater: COD, absorbance at 254 nm, tannins content, color, and ellagic acid. In the ozonation/UF combined process the following removals were achieved: 100% for ellagic acid and color, 90% for absorbance at 254 nm, more than 80% for tannins, and 42-57% for COD reduction. In the filtration/chemical oxidation combined process, 100% elimination of ellagic acid, more than 90% elimination in color, absorbance at 254 nm and tannins, and removal higher than 80% in COD were reached, which indicates a greater purification power of this combination.
Chromophoric Dissolved Organic Matter in Southwestern Greenland Lakes
Osburn, C. L.; Giles, M. E.; Underwood, G. J. C.
2014-12-01
Dissolved organic matter (DOM) is an important property of Arctic lake ecosystems, originating from allochthonous inputs from catchments and autochthonous production by plankton in the water column. Little is known about the quality of DOM in Arctic lakes that lack substantial inputs from catchments and such lakes are abundant in southwestern Greenland. Colored dissolved organic matter (CDOM), the fraction that absorbs ultraviolet (UV) and visible light, is the controlling factor for the optical properties of many surface waters and as well informs on the quality of DOM. We examined the quality of CDOM in 21 lakes in southwestern Greenland, from the ice sheet to the coast, as part of a larger study examining the role of DOM in regulating microbial communities in these lakes. DOM was size fractioned and absorbance and fluorescence was measured on each size fraction, as well as on bulk DOM. The specific ultraviolet absorbance (SUVA) at 254 nm (SUVA254), computed by normalizing absorption (a254) to dissolved organic carbon (DOC) concentration, provided an estimate of the aromatic carbon content of DOM. SUVA values were generally CDOM fluorescence was used to determine the relative abundance of allochthonous and autochthonous DOM in all size fractions. Younger lakes near the ice sheet and lakes near the coast had lower amounts of CDOM and appeared more microbial in quality. However, lakes centrally located between the ice sheet and the coast had the highest CDOM concentrations and exhibited strong humic fluorescence. Overall distinct differences in CDOM quality were observed between lake locations and among DOM size fractions.
Peacock, Mike; Freeman, Chris; Gauci, Vincent; Lebron, Inma; Evans, Chris D
2015-07-01
Although measured rates of biological degradation of DOC are typically low under dark conditions, it is assumed that water samples must be analysed soon after collection to provide an accurate measure of DOC concentration and UV-visible absorbance. To examine the impact of storage on DOC quality and quantity, we took water samples from an ombrotrophic peatland, and stored them in the dark at 4 °C for 138-1082 days. A median of 29% of DOC was lost during storage, but losses of absorbance at 254 nm were less. DOC loss followed a first-order exponential decay function, and was dependent on storage time. DOC half-life was calculated as 1253 days. Specific absorbance at 254 nm suggested that samples containing more aromatic DOC were more resistant to degradation, although time functioned as the primary control. Samples from two fens showed that loss of absorbance was greater at 400 nm rather than 254 nm, after 192 days storage, suggesting that non-aromatic DOC is preferentially degraded. These results suggest that samples can be stored for several months before losses of DOC become detectable, and that it is possible to back-calculate initial DOC concentrations in long-term stored samples based on known decay rates. Freeze/thaw experiments using samples from a range of peatlands suggested that DOC concentration was mostly unaffected by the process, but DOC increased 37% in one sample. Freezing had unpredictable and sometimes strong effects on absorbance, SUVA and E ratios, therefore freezing is not recommended as a method of preservation for these analyses.
Energy Technology Data Exchange (ETDEWEB)
Liu, Shaogang [Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, University of Chinese Academy of Sciences, Chinese Academy of Sciences, 18 Shuang-qing Road, Beijing, 100085 (China); Guangxi Colleges and Universities Key Laboratory of Food Safety and Pharmaceutical Analytical Chemistry, Guangxi Key Laboratory of Chemistry and Engineering of Forest Products, School of Chemistry and Chemical Engineering, Guangxi University for Nationalities, Nanning, 530006, Guangxi (China); Li, Zhenlin [Guangxi Colleges and Universities Key Laboratory of Food Safety and Pharmaceutical Analytical Chemistry, Guangxi Key Laboratory of Chemistry and Engineering of Forest Products, School of Chemistry and Chemical Engineering, Guangxi University for Nationalities, Nanning, 530006, Guangxi (China); Dong, Huiyu [Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, University of Chinese Academy of Sciences, Chinese Academy of Sciences, 18 Shuang-qing Road, Beijing, 100085 (China); Goodman, Bernard A. [College of Physical Science and Engineering, State Key Laboratory for Conservation and Utilization of Subtropical Agro-Bioresources, Guangxi University, Nanning, 520004, Guangxi (China); Qiang, Zhimin, E-mail: qiangz@rcees.ac.cn [Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, University of Chinese Academy of Sciences, Chinese Academy of Sciences, 18 Shuang-qing Road, Beijing, 100085 (China)
2017-01-05
This study investigated systematically the factors influencing the formation of iodinated disinfection by-products (I-DBPs) during chloramination of I{sup −}-containing waters, including reaction time, NH{sub 2}Cl dose, I{sup −} concentration, pH, natural organic matter (NOM) concentration, Br{sup −}/I{sup −} molar ratio, and water matrix. Among the I-DBPs detected, iodoform (CHI{sub 3}), iodoacetic acid (IAA), diiodoacetic acid (DIAA), triiodoacetic acid (TIAA), and diiodoacetamide (DIAcAm) were the major species produced from reactions between reactive iodine species (HOI/I{sub 2}) and NOM. A kinetic model involving the reactions of NH{sub 2}Cl auto-decomposition, iodine species transformation and NOM consumption was developed, which could well describe NH{sub 2}Cl decay and HOI/I{sub 2} evolution. Higher concentrations of CHI{sub 3}, IAA, DIAA, TIAA, and DIAcAm were observed in chloramination than in chlorination, whereas IO{sub 3}{sup −} was only formed significantly in chlorination. Maximum formation of I-DBPs occurred at pH 8.0, but acidic conditions favored the formation of iodinated haloacetic acids and DIAcAm. Increasing Br{sup −}/I{sup −} molar ratio from 1 to 10 did not increase the total amount of I-DBPs, but produced more bromine-substituting species. In addition, chloramination of 18 model compounds indicated that low-SUVA{sub 254} (specific ultraviolet absorbance at 254 nm) NOM generally favored the formation of I-DBPs compared to high-SUVA{sub 254} NOM. Finally, potential pathways for I-DBPs formation from chloramination of NOM were proposed.
International Nuclear Information System (INIS)
Frajkin, G.Ya.; Pospelov, M.E.; Rubin, L.B.
1976-01-01
The results of studies on the effect of near uv light on the yeast Candida guilliermondii are presented. It was shown that certain doses of 313 nm light inactivated the yeast. The detailed affect is shown in the loss of the ability of the cells to form microcolonies and outwardly does not differ from inactivation caused by 254 nm uv. It was concluded that the cell destruction caused by the 313 nm light was not due to damage to DNA. Experiments in which yeast cells were inactivated by 313 nm light before plating on agar and held for some time in a non-nutrient medium permitted observation of recovery of their viability. A difference was shown in the level of repair of yeasts irradiated by 313 nm light (up to 100% recovery) and 254 nm light (60% recovery). The nature of the dependence of the photoprotection on the 313 nm light dose was determined. A decrease in photoprotection was noted, starting with 7x10 -7 einstein/cm 2 , with its complete disappearance upon further dose increase. It is suggested that, in this recovery of the yeast, some other, thus far unknown, mechanism participates. Data were obtained on the survival of yeast irradiated with lethal uv doses. Of special importance, in the authors' opinion, is the fact that, for the photoprotection effect to appear, some time is needed between actions of the 313 and 254 nm lights, which suggests a photoinduced formation in the yeast cells of compounds that protect them from lethal injury
Avoiding acidic region streaking in two-dimensional gel ...
Indian Academy of Sciences (India)
Supplementary figure 6. 2DE gel images ... Number of acidic streaks. Fedyunin et al. 2012. 4.02. 6. Zuo et al. 2000. 2.54. 9. Valenete et ... CE, 3rd 2009 Proteasomal protein degradation in ... Nandakumar MP, Shen J, Raman B and Marten MR.
2012-03-06
.... Services Group, Inc., Corporate/Finance/ Controllers. 81,213 American Express Travel Phoenix, AZ February.... Corporate Resources, Aerotek, Dysis and Tek. 81,254 BT North America, Network Atlanta, GA February 13, 2010... February 7, 2011. Services Group, Inc., Corporate/EIT/Consumer. The following certifications have been...
Supporting Information final.pdf
Indian Academy of Sciences (India)
RC
Materials and apparatus. Spectroscopic grade organic solvents were obtained from Finar Chemicals. Starting and other chemicals and reagents were purchased from Sigma-Aldrich unless otherwise stated and were used without further purification. Thin layer chromatography (TLC) was performed on silica gel 60 F254 ...
The Five-Factor Nonverbal Personality Questionnaire in the Czech context
Czech Academy of Sciences Publication Activity Database
Hřebíčková, Martina
2010-01-01
Roč. 52, č. 3 (2010), s. 165-177 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Nonverbal personality measurement * five -factor model * The Five -Factor Nonverbal Personality Questionnaire * FF-NPQ Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010
2011-12-28
... carriers (ETCs), and the Commission codifies it in the rules. Section 254(e) thus contemplates that...-party service, operator services, and directory assistance. 30. Today, all ETCs, whether designated by a... service--throughout their designated service area. ETCs also must provide Lifeline service throughout...
Lifescience Database Archive (English)
Full Text Available 5060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds. 626 0.0 8 AC1170...bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 254 4e-77 AC117076_18( AC1
In vitro antimicrobial properties of friedelan-3-one from Pterocarpus ...
African Journals Online (AJOL)
MRS I.C ODEH
2016-04-06
Apr 6, 2016 ... purchased from Sigma-Aldrich® with the exception of Silica gel 60. F254 Thin Layer ... The powder was obtained using mortar and pestle. ... The extracts were concentrated and allowed to dry in a fume hood to give the crude ...
Historiografie biologie a jejich grande dame Ilse Jahnová (1922-2010)
Czech Academy of Sciences Publication Activity Database
Hermann, Tomáš; Šimůnek, Michal V.
2010-01-01
Roč. 43, č. 4 (2010), s. 249-254 ISSN 0300-4414 R&D Projects: GA ČR GPP410/10/P550 Institutional research plan: CEZ:AV0Z80630520 Keywords : Ilse Jahn * historiography of biology * history of science Subject RIV: AB - History
Linkage and association analysis of CACNG3 in childhood absence epilepsy
DEFF Research Database (Denmark)
Everett, Kate V; Chioza, Barry; Aicardi, Jean
2007-01-01
Childhood absence epilepsy (CAE) is an idiopathic generalised epilepsy characterised by absence seizures manifested by transitory loss of awareness with 2.5-4 Hz spike-wave complexes on ictal EEG. A genetic component to aetiology is established but the mechanism of inheritance and the genes...
Czech Academy of Sciences Publication Activity Database
Arokiasamy, J.; Ball, M.; Barnett, D.; Bearman, M.; Bemmel van, J.; Douglas, J.; Fisher, P.; Garrie, R.; Gatewood, L.; Goossen, W.; Grant, A.; Hales, J.; Hasman, A.; Haux, R.; Hovenga, E.; Johns, M.; Knaup, P.; Leven, F. J.; Lorenzi, N.; Murray, P.; Neame, R.; Protti, D.; Power, M.; Richard, J.; Schuster, E.; Swinkels, W.; Yang, J.; Zelmer, L.; Zvárová, Jana
2001-01-01
Roč. 40, č. 5 (2001), s. 267-277 ISSN 0026-1270 Institutional research plan: AV0Z1030915 Keywords : health informatics * medical informatics * education * recommendations * International Medical Informatics Association * IMIA Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.254, year: 2001
The Eagle in the Desert: The Origins of the U.S.Saudi Arabian Security Partnership
2015-09-01
projects that 15 percent of Saudi Arabia’s power will 254 Angus Miller and Shamil Yenikeyeff...Studies 31, no. 1 (2004): 5–23. http://www.jstor.org/stable/4145533. Miller, Angus and Shamil Yenikeyeff. “Oil’s Well in Central Asia.” Foreign Affairs
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:
Musica, identita e mitografie nazionali dei cechi nel dicianovesimo secolo
Czech Academy of Sciences Publication Activity Database
Slavický, Tomáš
2016-01-01
Roč. 12, č. 1 (2016), s. 45-56. ISBN 978-961-254-915-2. ISSN 1854-3405 Institutional support: RVO:68378076 Keywords : Czech national music * Czech historical myths * Panslavism * Austroslavism Subject RIV: AL - Art, Architecture, Cultural Heritage; AL - Art, Architecture, Cultural Heritage (UEF-S)
Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD
Assessment of knowledge and attitudes toward Complementary and ...
African Journals Online (AJOL)
There were also statistically significant differences about the knowledge of those methods (acupuncture, acupressure, yoga, reiki, prayer, meditation massage, dietary, spa). Prayer was the most known modality in all medical classes' students (first year students: 254, sixth year students: 192). The students who participated ...
An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials
Czech Academy of Sciences Publication Activity Database
Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.
2017-01-01
Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016
BioRadBase: A database for bioremediation of radioactive waste
African Journals Online (AJOL)
Windows User
2012-05-01
May 1, 2012 ... 16(3): 254-260. Llyod JR, Chesnes J, Glasauer S, Bunker DJ, Livens FR, Lovely DR ... Macaskie LE, Lloyd JR, Thomas RAP, Tolley MR (1996). The use of ... Carroll S, He Z, Gu B, Luo J, Criddle CS, Watson DB, Jardine PM,.
78 FR 3904 - Center for Scientific Review; Notice of Closed Meetings
2013-01-17
... personal privacy. Name of Committee: Center for Scientific Review Special Emphasis Panel; Member Conflict... Emphasis Panel; Member Conflict: Drug Discovery for the Nervous System. Date: February 8, 2013. Time: 1:00... 20892, 301-254-9975, [email protected] . Name of Committee: Integrative, Functional and Cognitive...
75 FR 39671 - Publication of State Plan Pursuant to the Help America Vote Act
2010-07-12
... ELECTION ASSISTANCE COMMISSION Publication of State Plan Pursuant to the Help America Vote Act... plan previously submitted by South Dakota. DATES: This notice is effective upon publication in the... 254(a)(12), all the state plans submitted for publication provide information on how the respective...
Tuning the conductance of benzene-based single-molecule junctions
Czech Academy of Sciences Publication Activity Database
Kaminski, W.; Topolnicki, R.; Hapala, Prokop; Jelínek, Pavel; Kucharczyk, R.
2016-01-01
Roč. 34, Jul (2016), s. 254-261 ISSN 1566-1199 R&D Projects: GA ČR(CZ) GA14-02079S Institutional support: RVO:68378271 Keywords : molecular electronics * DFT * NEGF * transport Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.399, year: 2016
Preschool Gifted Education: Perceived Challenges Associated with Program Development
Kettler, Todd; Oveross, Mattie E.; Salman, Rania C.
2017-01-01
This descriptive study investigated the challenges related to implementing gifted education services in preschool centers. Participants were 254 licensed preschool center directors in a southern state. Participants completed a researcher-created survey including both selected response items and constructed response items to examine the perceived…
Angele, S.; Romestaing, P.; Moullan, N.; Vuillaume, M.; Chapot, B.; Friesen, M.; Jongmans, W.; Cox, D.G.; Pisani, P.; Gerard, J.P.; Hall, J.
2003-01-01
The ATM gene, mutated in the cancer-prone and radiation-sensitive syndrome ataxia-telangiectasia (AT), could predispose to breast cancer (BC) development and adverse radiotherapy responses. Sixteen ATM variants were genotyped in 254 BC cases, 70 of whom were adverse radiotherapy responders (RS-BC),
Významný slezský rodák Květoň Čermák (1911-1981)
Czech Academy of Sciences Publication Activity Database
Novotný, Gustav
2007-01-01
Roč. 56, č. 3 (2007), s. 254-288 ISSN 1211-3131 R&D Projects: GA ČR(CZ) GA404/06/0167 Institutional research plan: CEZ:AV0Z80150510 Keywords : history of forestry * czech agricultural education * biography * ergonomics Subject RIV: AB - History
EST Table: FY739073 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FY739073 E_FL_famL_07K17_F_0 11/11/04 35 %/254 aa ref|XP_001600679.1| PREDICTED: si...milar to conserved hypothetical protein [Nasonia vitripennis] 11/11/04 30 %/250 aa FBpp0153473|DgriGH19567-P
HEALTH COMPLAINTS, SOCIAL COMPARISONS, AND ABSENTEEISM
GEURTS, SA; BUUNK, BP; SCHAUFELI, WB
1994-01-01
In this study the relationship between health problems and objectively recorded absence frequency is investigated from a social psychological perspective in a prospective design. By employing LISREL, a model is developed (tested and revised) among blue-collar workers in Plant North (N = 254) of a
2010-12-03
... absolve schools and libraries of their obligation to adhere to the Children's Internet Protection Act.... Section 254(h)(1)(B) requires telecommunications carriers to provide universal service to schools and... schools and libraries the same services that a traditional telecommunications carrier can provide a school...
2011-07-20
... National Average Payments for free, reduced price and paid afterschool snacks as part of the National...; Hawaii--free lunch-- 294 cents, reduced price lunch--254 cents. Afterschool Snacks in Afterschool Care Programs--The payments are: Contiguous States--free snack--76 cents, reduced price snack--38 cents, paid...
Book review Information and Communication Technologies for ...
African Journals Online (AJOL)
Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256. Article Metrics. No metrics ...
Association between Cigarette Smoking and Metabolic Syndrome in ...
African Journals Online (AJOL)
Purpose: To investigate the relationship between metabolic syndrome as defined by using the modified NCEP/ATP III criteria [modified the National Cholesterol Education Program (NCEP)/Adult Treatment Panel III (ATP III) criteria] and cigarette smoking in Thai subjects. Methods: This study was carried out among 254 ...
Lifescience Database Archive (English)
Full Text Available phosphopyruvate hydratase (EC 4.2.1.11) - liver f... 264 1e-69 AM279157_1( AM279157 |pid:none) Echinostoma capron...i mRNA for enola... 254 9e-67 DQ869009_1( DQ869009 |pid:none) Echinostoma caproni enolase mRNA, ... 25
Design, synthesis and antibacterial activity of a novel hybrid ...
African Journals Online (AJOL)
ajl user 1
2012-01-26
Jan 26, 2012 ... 1College of Animal Science and Technology, Northeast Agricultural University, Harbin 150030, China. ... Antimicrobial peptides produced by many tissues and cell types of invertebrates, insects and humans as part of ..... In nature, almost all kinds of plants, animals and micro- .... Biopolymers, 65: 254-262.
Personality as Correlate of Perceived Job Stress Among Electoral ...
African Journals Online (AJOL)
This study examined the relationship of personality (conscientiousness dimension) with electoral officers perceived job stress during election. The survey utilised the expost facto research design. A total of 346 participants responded to the questionnaires. In all, 254 (70.4%) were males and 101 (29.6%) were females.
Tan, Cheng Yong
2018-01-01
The present study examined indirect effects of principal leadership on the mathematics achievement of 254,475 15-year-old students from 10,313 schools in 32 OECD economies. Results showed that the students could be divided into three categories ("Disadvantaged," "Average," and "Privileged") differing in levels of…
77 FR 58540 - Notice of Debarment
2012-09-21
... available for public inspection and copying during regular business hours at the FCC Reference Information... Commission's duplicating inspection and copying during regular business hours at the contractor, Best Copy......... Missouri 7,672.77 Red Cloud Community School Nebraska 2,254.52 District. SAU 41--Hollis Brookline Schools...
African Journals Online (AJOL)
Items 1 - 50 of 254 ... Sexual Behaviour and Reproductive Health Among Female Senior Secondary ... Vol 24, No 3-4 (2012), Assessment of Lipid Profile in HIV Seropositive Pregnant Women ... Vol 17, No 3 (2005), Bacteriology of asymptomatic bacteriuria in ... progression and treatment assessment in HIV/AIDS subjects?
Nucci, Larry; Creane, Michael W.; Powers, Deborah W.
2015-01-01
Eleven teachers and 254 urban middle-school students comprised the sample of this study examining the social and moral development outcomes of the integration of social cognitive domain theory within regular classroom instruction. Participating teachers were trained to construct and implement history lessons that stimulated students' moral…
Preliminary gut content and dentition analysis reveal subtle resource ...
African Journals Online (AJOL)
use
been hypothesized to have contributed to the evolution and adaptive .... nets with stretched mesh sizes (25.4 to 203.2 mm) during both day and night hours .... Embryos, Eggs. Unicuspid (Deeply embended). 3. Hypotrophic. Sucking. A. alluaudi. Molluscs. Subequally – Unequally bicuspid. 3. Hypertrophic. Crushing. A. nubila.
Economic Efficiency of Maize Production in Yola North Local ...
African Journals Online (AJOL)
user
Table 2. mean effects of two location on the properties of the undisturbed soil samples. Location ... 12.0. 37.8. LSD. NS. NS. NS. NS. NS. CV. 32.8. 12.9. 26.8. 25.4. 31.6. BD: Bulk density. ... brain damage; produce tumour. 0.01. Nickel.
Czech Academy of Sciences Publication Activity Database
Bujalský, L.; Jirka, V.; Zemek, František; Frouz, J.
2018-01-01
Roč. 32, č. 4 (2018), s. 254-263 ISSN 1748-0930 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : temperature * normalised difference * vegetation index (NDVI) * vegetation cover * remote sensing Subject RIV: DF - Soil Science Impact factor: 1.078, year: 2016
Indian Academy of Sciences (India)
Admin
The purity determination of the starting materials and reaction monitoring was accomplished by thin-layer chromatography (TLC) on Merck silica gel G F254 plates. .... Brown liquid, 1H NMR (400 MHz, CDCl3):δ 8.78 (d, J = 8 Hz, 2H), 8.00 (d, ...
Multilocus phylogeny of arvicoline voles (Arvicolini, Rodentia) shows small tree terrace size
Czech Academy of Sciences Publication Activity Database
Martínková, Natália; Moravec, J.
2012-01-01
Roč. 61, 3-4 (2012), s. 254-267 ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : divergence * evolutionary history * supertree * supermatrix * phylogenetic tree terrace * Microtus * Arvicolinae Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012
Method for removal of mercury from various gas streams
Granite, E.J.; Pennline, H.W.
2003-06-10
The invention provides for a method for removing elemental mercury from a fluid, the method comprising irradiating the mercury with light having a wavelength of approximately 254 nm. The method is implemented in situ at various fuel combustion locations such as power plants and municipal incinerators.
Czech Academy of Sciences Publication Activity Database
Moreira, J.; Scholz, Tomáš; Luque, J.L.
2015-01-01
Roč. 60, č. 2 (2015), s. 254-260 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Monogenea * Dactylogyridae * Urocleidoides * Erythrinidae * Hoplias aimara * Xingu River * Brazil Subject RIV: EG - Zoology Impact factor: 1.293, year: 2015
Czech Academy of Sciences Publication Activity Database
Matys Grygar, Tomáš; Elznicová, J.; Tůmová, Štěpánka; Faměra, Martin; Balogh, M.; Kiss, T.
2016-01-01
Roč. 254, FEB (2016), s. 41-56 ISSN 0169-555X R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : Floodplain architecture * Fades assignment * Electric resistivity imaging * Floodplain recyclation Subject RIV: DD - Geochemistry Impact factor: 2.958, year: 2016
Lewis, Michael A., Robert L. Quarles, Darrin D. Dantin and James C. Moore. 2004. Evaluation of a Coastal Golf Complex as a Local and Watershed Source of Bioavailable Contaminants. Mar. Pollut. Bull. 48(3-4):254-262. (ERL,GB 1183). Contaminant fate in coastal areas impacte...
Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides
Czech Academy of Sciences Publication Activity Database
Ivanova, Z.G.; Zavadil, Jiří; Kostka, P.; Djouama, T.; Reinfelde, M.
2017-01-01
Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985882 Keywords : caesium halides * chalcohalide glasses * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016
Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides
Czech Academy of Sciences Publication Activity Database
Ivanova, Z.G.; Zavadil, Jiří; Kostka, Petr; Djouama, T.; Reinfelde, M.
2017-01-01
Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985891 Keywords : caesium halides * chalcohalide glasses * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016
A combined experimental and theoretical study on the complexation of Li+ with valinomycin
Czech Academy of Sciences Publication Activity Database
Makrlík, E.; Dybal, Jiří; Vaňura, P.
2009-01-01
Roč. 140, č. 3 (2009), s. 251-254 ISSN 0026-9247 R&D Projects: GA AV ČR 1ET400500402 Institutional research plan: CEZ:AV0Z40500505 Keywords : antibiotics * macrocycles * stability constant Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.312, year: 2009
7 CFR 1755.508 - Customer access location protection.
2010-01-01
... customer access locations are remote from the borrower's headquarters, use of maximum duty gas tube primary... 1 in. = 25.4 mm. (z) Grounding conductors shall be separated from non-telecommunications company... equivalent statement: “Call the telecommunications company if this connector or grounding conductor is loose...
Effectiveness of matured Morus nigra L. (black mulberry) fruit extract ...
African Journals Online (AJOL)
ajl yemi
2011-11-14
Nov 14, 2011 ... Morin, a form of flavonoid that is highly found in black mulberry, has been ... determined by the method of Shimoi et al. (1994) with the .... quantified by DAD following HPLC separation at 280 nm for CA and. NA, 254 nm for RU, ...
Masuda, Akihiko; Anderson, Page L.; Twohig, Michael P.; Feinstein, Amanda B.; Chou, Ying-Yi; Wendell, Johanna W.; Stormo, Analia R.
2009-01-01
The study examined African American, Asian American, and European American college students' previous direct and indirect experiences of seeking professional psychological services and related attitudes. Survey data were collected from 254 European American, 182 African American and 82 Asian American college students. Results revealed that fewer…
Corrosion properties of plasma deposited high-alloy steel
Czech Academy of Sciences Publication Activity Database
Voleník, Karel; Pražák, M.; Kalabisová, E.; Kreislová, K.; Neufuss, Karel
2002-01-01
Roč. 47, - (2002), s. 243-254 ISSN 0001-7043 R&D Projects: GA ČR GA106/99/0298 Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma deposits, high-alloy steel, polarization curves, corrosion test Subject RIV: BL - Plasma and Gas Discharge Physics
Czech Academy of Sciences Publication Activity Database
Rusch, G. M.; Wilmann, B.; Klimešová, Jitka; Evju, M.
2011-01-01
Roč. 46, 2-3 (2011), 237-254 ISSN 1211-9520 R&D Projects: GA ČR GA526/07/0808 Institutional research plan: CEZ:AV0Z60050516 Keywords : clonal traits * bud bank * SLA Subject RIV: EH - Ecology, Behaviour Impact factor: 1.500, year: 2011
Czech Academy of Sciences Publication Activity Database
Sláma, Jiří; Walderhaug, O.; Fonneland, H.; Kosler, J.; Pederson, R. B.
2011-01-01
Roč. 238, 3/4 (2011), s. 254-267 ISSN 0037-0738 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentary * Eastern Greenland * provenance * U-Pb and Lu-Hf * zircon * Jan Mayen Island * North Atlantic Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.537, year: 2011
Directory of Open Access Journals (Sweden)
Luis Gómez Canseco
2015-01-01
Full Text Available Review of José Manuel Lucía Megías, ed., Lope de Vega en la piel de Brugalla. La Colección Lope de Vega de la Biblioteca Histórica Municipal, Ayuntamiento de Madrid, Madrid, 2013, 254 pp. ISBN: 9788478127627.
Czech Academy of Sciences Publication Activity Database
Hoferek, L.; Mistřík, J.; Trivedi, R.; Chen, K. S.; Peřina, Vratislav; Čech, V.
2014-01-01
Roč. 254, SEP (2014), s. 49-53 ISSN 0257-8972 R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : multilayer * Gradient film * Plasma polymerization * ellipsometry * nanoindentation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.998, year: 2014