Chemistry of berkelium: a review
International Nuclear Information System (INIS)
Hobart, D.E.; Peterson, J.R.
1985-01-01
Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity
Berkelium (4) and cerium (4) extraction with tertiary amines
International Nuclear Information System (INIS)
Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.
1978-01-01
Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
Nesaraja, C. D.
2017-12-01
Available information pertaining to the nuclear structure of ground and excited states for all known nuclei with mass numbers A=244 have been compiled and evaluated. The adopted level and decay schemes, as well as the detailed nuclear properties and configuration assignments based on experimental data are presented for these nuclides. When there are insufficient data, expected values from systematics of nuclear properties and/or theoretical calculations are quoted. Unexpected or discrepant experimental results are also noted. Information provided in 244U is tentative as it is from the possible production in the study of 1960Di03 of debris of the first large-scale thermonuclear test (Ivy Mike) of November 1, 1952 in the Pacific Ocean. No new experimental data are available for 244Np with the information for g.s Jπ considered tentative. Experimental work is needed for 244Np as theoretical work and systematics along with the Gallagher-Moszkowski rules that suggest either Jπ=2+ or 7-. Jπ = (7-) g.s has been considered by the evaluator due to population of high spin states in the beta decay study. In 244Pu, a new K isomer was identified and in addition rotational bands built on the isomer have been observed via the deep inelastic excitation. However, there has been no new measurements since the last evaluation to determine the ratio of the energy levels of the first 4+ state to the first 2+ state (E4+/E2+) in 244Pu that showed a discrepancy from a typical value of 3.333. In the current evaluation, the evaluator has considered the 110γ measured in the 244Np β-decay questionable. Further research into the determination of the gammas depopulating these levels is necessary. In 244Am, specifically the (d,p) transfer reaction and in the (n, γ) secondary γ's, there are a large number of gammas that are unplaced. Since its last measurement in 1966, the electron capture dataset has been updated with a tentative partial level scheme for 244Cm which also provided a new half
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFK244 (Link to dictyBase) - - - Contig-U16513-1 VFK244E (Link to Original site) VFK2...44F 710 VFK244Z 703 VFK244P 1393 VFK244E 1166 Show VFK244 Library VF (Link to library) Clone ID VFK2...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-B/VFK244Q.Seq.d/ Re...presentative seq. ID VFK244E (Link to Original site) Representative DNA sequence >VFK244 (VFK244Q) /CSM/VF/VFK2-B/VFK2...nsif*nlsnqnklnlfrk*k*ikkkn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFK244 (VFK2
8 CFR 244.4 - Ineligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 244.4 Section 244.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.4 Ineligible aliens. An alien is ineligible for Temporary...
49 CFR 244.3 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 244.3 Section 244.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MERGERS, AND ACQUISITIONS OF CONTROL General § 244.3 Preemptive effect. Under 49 U.S.C. 20106, issuance of...
12 CFR 24.4 - Investment limits.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment limits. 24.4 Section 24.4 Banks and... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.4 Investment limits. (a) Limits on aggregate outstanding investments. A national bank's aggregate outstanding investments under...
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Travel abroad. 244.15 Section 244.15 Aliens... NATIONALS OF DESIGNATED STATES § 244.15 Travel abroad. (a) After the grant of Temporary Protected Status... to travel abroad. Permission to travel may be granted by the director pursuant to the Service's...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Applicability. 24.4 Section 24.4 Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE REQUIREMENTS FOR...; Maternal and Child Health Services; Social Services; Low-Income Home Energy Assistance; States' Program of...
10 CFR 600.244 - Termination for convenience.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Termination for convenience. 600.244 Section 600.244 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform... Requirements § 600.244 Termination for convenience. Except as provided in § 600.443 awards may be terminated in...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFH244 (Link to dictyBase) - - - - VFH244F (Link to Original s...ite) VFH244F 594 - - - - - - Show VFH244 Library VF (Link to library) Clone ID VFH244 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...is centranthoides cDNA clone hj81f04, mRNA sequence. 36 3e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-
48 CFR 244.403 - Contract clause.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause. 244.403... OF DEFENSE CONTRACT MANAGEMENT SUBCONTRACTING POLICIES AND PROCEDURES Subcontracts for Commercial Items and Commercial Components 244.403 Contract clause. (1) 252.225-7009, Restriction on Acquisition of...
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFH244 (Link to dictyBase) - - - Contig-U16381-1 CFH244F (Link... to Original site) CFH244F 124 - - - - - - Show CFH244 Library CF (Link to library) Clone ID CFH244 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...ts) Value N AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, compl...ete sequence. 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict
42 CFR 456.244 - Data sources for studies.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Data sources for studies. 456.244 Section 456.244 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES...: Medical Care Evaluation Studies § 456.244 Data sources for studies. Data that the committee uses to...
27 CFR 70.244 - Payroll period.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Payroll period. 70.244... Excise and Special (Occupational) Tax Limitations § 70.244 Payroll period. For purpose of determining the... established calendar period regularly used by the employer or other person levied upon for payroll or payment...
12 CFR 19.244 - Automatic removal, suspension, and debarment.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Automatic removal, suspension, and debarment. 19.244 Section 19.244 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES... Services § 19.244 Automatic removal, suspension, and debarment. (a) An independent public accountant or...
40 CFR 52.244 - Motor vehicle emissions budgets.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Motor vehicle emissions budgets. 52.244... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.244 Motor vehicle emissions budgets. (a) Approval of the motor vehicle emissions budgets for the following ozone rate-of-progress and...
48 CFR 1852.244-70 - Geographic participation in the aerospace program.
2010-10-01
... the aerospace program. 1852.244-70 Section 1852.244-70 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.244-70 Geographic participation in the aerospace program. As prescribed in 1844.204-70, insert the following clause: Geographic Participation in the Aerospace Program (APR 1985) (a...
27 CFR 24.244 - Use of acid to stabilize standard wine.
2010-04-01
... standard wine. 24.244 Section 24.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.244 Use of acid to stabilize standard wine. Standard wine other than citrus wine, regardless of the fixed...
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.17 Procedures. (a) Each applicant shall file one...
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.19 Disposition. (a) Standard of review. FRA reviews an...
Tank 244A tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
The Double-Shell Tank (DST) System currently receives waste from the Single-Shell Tank (SST) System in support of SST stabilization efforts or from other on-site facilities which generate or store waste. Waste is also transferred between individual DSTs. The mixing or commingling of potentially incompatible waste types at the Hanford Site must be addressed prior to any waste transfers into the DSTs. The primary goal of the Waste Compatibility Program is to prevent the formation of an Unreviewed Safety Question (USQ) as a result of improper waste management. Tank 244A is a Double Contained Receiver Tank (DCRT) which serves as any overflow tank for the East Area Farms. Waste material is able to flow freely between the underground storage tanks and tank 244A. Therefore, it is necessary to test the waste in tank 244A for compatibility purposes. Two issues related to the overall problem of waste compatibility must be evaluated: Assurance of continued operability during waste transfer and waste concentration and Assurance that safety problems are not created as a result of commingling wastes under interim storage. The results of the grab sampling activity prescribed by this Tank Characterization Plan shall help determine the potential for four kinds of safety problems: criticality, flammable gas accumulation, energetics, and corrosion and leakage
49 CFR 244.11 - Contents of a Safety Integration Plan.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Contents of a Safety Integration Plan. 244.11 Section 244.11 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD...
Crippling load test of Budd Pioneer Car 244, test 3.
2013-04-01
This report summarizes Test 3, a crippling load test on Budd Pioneer Car 244, conducted on June 28, 2011. Before the crippling load test, Transportation Technology Center, Inc., conducted two 800,000-pound (lb) quasi-static tests on Car 244 in accord...
8 CFR 244.5 - Temporary treatment benefits for eligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Temporary treatment benefits for eligible aliens. 244.5 Section 244.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... for eligible aliens. (a) Prior to the registration period. Prior to the registration period...
9 CFR 354.244 - Temperatures and cooling and freezing procedures.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Temperatures and cooling and freezing procedures. 354.244 Section 354.244 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... and cooling and freezing procedures. Temperatures and procedures which are necessary for cooling and...
International Nuclear Information System (INIS)
Esch, R.A.
1997-01-01
This document is the final report for the double-contained receiver tank (DCRT) 244-TX grab samples. Three grabs samples were collected from riser 8 on May 29, 1997. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in a table
Preparation of additional supplies of 244Pu
International Nuclear Information System (INIS)
Bigelow, J.E.; Newman, E.; Alexander, C.W.
1985-01-01
In the mid-1970s, gram quantities of the man-made isotope 244 Pu were produced in high purity for basic research as a by-product of a program to prepare gram quantities of 252 Cf. Because 244 Pu is not produced in appreciable quantities in standard power reactor fuel, this nuclide has become extremely useful in the application of isotope dilution mass spectrometry (IDMS), a high-precision analytical technique, to problems of plutonium accountability in support of international safeguards agreements. Although only a small amount (a fraction of a microgram) is needed for each analysis, the present supply of certified nuclear reference standard SRM-996 is expected to last only an additional 3 to 5 years. Three options for producing additional supplies of this rare and valuable material were examined. The options encompassed the production of from 1 to 8.5 g during time spans of from 3 to 10 years. Unit costs ranged from $2300 to $7200 per mg of plutonium of >97% 244 Pu. While the paper concludes that the short-term option can be pursued along with further study of the longer-term options, this should not be regarded as an offer or a commitment on the part of the US Department of Energy (USDOE) to furnish the described material
244-AR Vault Interim Stabilization Project Plan
International Nuclear Information System (INIS)
LANEY, T.
2000-01-01
The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated
Preparation of additional supplies of 244Pu
International Nuclear Information System (INIS)
Bigelow, J.E.; Newman, E.; Alexander, C.W.
1985-01-01
In the mid-1970s, gram quantities of the man-made isotope 244 Pu were produced in high purity for basic research as a by-product of a program to prepare gram quantities of 252 Cf. Because 244 Pu is not produced in appreciable quantities in standard power reactor fuel, this nuclide has become extremely useful in the application of isotope dilution mass spectrometry (IDMS), a high-precision analytical technique, to problems of plutonium accountability in support of international safeguards agreements. Although only a small amount (a fraction of a microgram) is needed for each analysis, the present supply of certified nuclear reference standard SRM-996 is expected to last only an additional 3 to 5 years. Three options for producing additional supplies of this rare and valuable material were examined. The options encompassed the production of from 1 to 8.5 g during time spans of from 3 to 10 years. Unit costs ranged from $2300 to $7200 per mg of plutonium of >97% 244 Pu. While the paper concludes that the short-term option can be pursued along with further study of the longer-term options, this should not be regarded as an offer or a commitment on the part of the U.S. Department of Energy (USDOE) to furnish the described material. (author)
Infrared spectrum of curium-244
International Nuclear Information System (INIS)
Conway, J.G.; Blaise, J.; Verges, J.
1974-09-01
The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI 3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels
Unsafe Coulomb excitation of $^{240-244}Pu$
Wiedenhöver, I; Hackman, L; Ahmad, I; Greene, J P; Amro, H; Carpenter, M P; Nisius, D T; Reiter, P; Lauritsen, T; Lister, C J; Khoo, T L; Siem, S; Cizewski, J A; Seweryniak, D; Uusitalo, J; Macchiavelli, A O; Chowdhury, P; Seabury, E H; Cline, D; Wu, C Y
1999-01-01
The high spin states of /sup 240/Pu and /sup 244/Pu have been investigated with GAMMASPHERE at ATLAS, using Coulomb excitation with a /sup 208/Pb beam at energies above the Coulomb barrier. Data on a transfer channel leading to /sup 242/Pu were obtained as well. In the case of /sup 244/Pu, the yrast band was extended to 34h(cross), revealing the completed pi i/sub 13/2/ alignment, a "first" for actinide nuclei. The yrast sequence of /sup 242/Pu was also extended to higher spin and a similar backbend was delineated. In contrast, while the ground state band of /sup 240/Pu was measured up to the highest rotational frequencies ever reported in the actinide region (~300 keV), no sign of particle alignment was observed. (11 refs).
8 CFR 244.11 - Renewal of application; appeal to the Board of Immigration Appeals.
2010-01-01
... of Immigration Appeals. 244.11 Section 244.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.11 Renewal of application; appeal to the Board of Immigration Appeals. If a charging document is served on the alien with a...
49 CFR 244.21 - Compliance and Enforcement.
2010-10-01
... Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.21 Compliance and Enforcement. (a...
Magnetic susceptibility of 244Cm metal and 249Cf metal
International Nuclear Information System (INIS)
Fujita, D.K.; Parsons, T.C.; Edelstein, N.; Noe, M.; Peterson, J.R.
1975-07-01
The first magnetic susceptibility measurements made on the expanded fcc phase of 249 Cf metal are reported. Further measurements are needed on other Cf metal phases. Another measurement of the magnetic susceptibility of 244 Cm metal in a limited temperature range has been reported. The result does not agree with previously reported values. Further work is continuing on the synthesis of 244 Cm metal and 248 Cm metal and magnetic measurements on these samples. (auth)
Involvement of CD244 in regulating CD4+ T cell immunity in patients with active tuberculosis.
Directory of Open Access Journals (Sweden)
Bingfen Yang
Full Text Available CD244 (2B4 is a member of the signaling lymphocyte activation molecule (SLAM family of immune cell receptors and it plays an important role in modulating NK cell and CD8(+ T cell immunity. In this study, we investigated the expression and function of CD244/2B4 on CD4(+ T cells from active TB patients and latent infection individuals. Active TB patients had significantly elevated CD244/2B4 expression on M. tuberculosis antigen-specific CD4(+ T cells compared with latent infection individuals. The frequencies of CD244/2B4-expressing antigen-specific CD4(+ T cells were significantly higher in retreatment active TB patients than in new active TB patients. Compared with CD244/2B4-dull and -middle CD4(+ T cells, CD244/2B4-bright CD4(+ T cell subset had significantly reduced expression of IFN-γ, suggesting that CD244/2B4 expression may modulate IFN-γ production in M. tuberculosis antigen-responsive CD4(+ T cells. Activation of CD244/2B4 signaling by cross-linking led to significantly decreased production of IFN-γ. Blockage of CD244/2B4 signaling pathway of T cells from patients with active TB resulted in significantly increased production of IFN-γ, compared with isotype antibody control. In conclusion, CD244/2B4 signaling pathway has an inhibitory role on M. tuberculosis antigen-specific CD4(+ T cell function.
Hazard Evaluation for 244-CR Vault
Energy Technology Data Exchange (ETDEWEB)
GRAMS, W.H.
1999-08-19
This document presents the results of a hazards identification and evaluation performed on the 244-CR Vault to close a USQ (USQ No.TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed In HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities.
Hazard Evaluation for 244-CR Vault
International Nuclear Information System (INIS)
GRAMS, W.H.
1999-01-01
This document presents the results of a hazards identification and evaluation performed on the 244-CR Vault to close a USQ (USQ No.TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed In HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities
International Nuclear Information System (INIS)
Kuroda, P.K.; Myers, W.A.
1992-01-01
Re-examination of a vast amount of lead and xenon isotope data that have been accumulated since the Apollo 11 landing on the moon in July 1969 reveals that some of the lunar fines and breccia started to retain their radiogenic lead and fissiogenic xenon isotopes about 5 billion years ago when the ratios of 235 U and 244 Pu to 238 U in the early solar system were approximately 4 and 2 atoms per 10 atoms of 238 U, respectively. (author) 11 refs.; 8 figs.; 5 tabs
Evaluation of nuclear data of 244Pu and 237Pu
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Konshin, V.A.
1995-10-01
The evaluation of nuclear data for 244 Pu and 237 Pu was made in the neutron energy region from 10 -5 eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for 244 Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author)
Above-threshold structure in {sup 244}Cm neutron-induced fission cross section
Energy Technology Data Exchange (ETDEWEB)
Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)
1997-03-01
The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)
2010-10-01
... associates and consultants (Architect-engineer services). 52.244-4 Section 52.244-4 Federal Acquisition... consultants (Architect-engineer services). As prescribed in 44.204(b), insert the following clause: Subcontractors and Outside Associates and Consultants (Architect-Engineer Services) (AUG 1998) Any subcontractors...
Hazard evaluation for 244-AR vault facility
International Nuclear Information System (INIS)
BRAUN, D.J.
1999-01-01
This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities
Unsafe Coulomb excitation of 240-244Pu
International Nuclear Information System (INIS)
Ahmad, I.; Amro, H.; Carpenter, M. P.; Chowdhury, P.; Cizewski, J.; Cline, D.; Greene, J. P.; Hackman, G.; Janssens, R. V. F.; Khoo, T. L.; Lauritsen, T.; Lister, C. J.; Macchiavelli, A. O.; Nisius, D. T.; Reiter, P.; Seabury, E. H.; Seweryniak, D.; Siem, S.; Uusitalo, J.; Wiedenhoever, I.; Wu, C. Y.
1999-01-01
The high spin states of 240 Pu and 244 Pu have been investigated with GAMMASPHERE at ATLAS, using Coulomb excitation with a 208 Pb beam at energies above the Coulomb barrier. Data on a transfer channel leading to 242 Pu were obtained as well. In the case of 244 Pu, the yrast band was extended to 34h b ar revealing the completed πi 13/2 alignment, a ''first'' for actinide nuclei. The yrast sequence of 242 Pu was also extended to higher spin and a similar backbend was delineated. In contrast, while the ground state band of 240 Pu was measured up to the highest rotational frequencies ever reported in the actinide region (approximately300 keV), no sign of particle alignment was observed. In this case, several observable such as the large B(E1)/B(E2) branching ratios in the negative parity band, and the vanishing energy staggering between the negative and positive parity bands suggest that the strength of octupole correlations increases with rotational frequency. These stronger correlations may well be responsible for delaying or suppressing the πi 13/2 particle alignment
Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction
Energy Technology Data Exchange (ETDEWEB)
Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)
OXA-244-Producing Escherichia coli Isolates, a Challenge for Clinical Microbiology Laboratories.
Hoyos-Mallecot, Yannick; Naas, Thierry; Bonnin, Rémy A; Patino, Rafael; Glaser, Philippe; Fortineau, Nicolas; Dortet, Laurent
2017-09-01
OXA-244 is a single-point-mutant derivative of OXA-48 displaying reduced carbapenemase activity. Here, we report the microbiological features of seven OXA-244-producing Escherichia coli isolates. Only one isolate grew on ChromID Carba Smart medium (bioMérieux), but six of the seven isolates grew on ChromID extended-spectrum-β-lactamase (ESBL) medium (bioMérieux), as they coproduced an ESBL and/or a plasmid-encoded cephalosporinase. The production of a carbapenemase was detected in 57.1%, 71.4%, 71.4%, and 100% of the E. coli isolates using the Carba NP test, the Rapidec Carba NP test (bioMérieux), a matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS) hydrolysis assay (Bruker), and the OXA-48 K-SeT assay (Coris BioConcept), respectively. Our results indicate that OXA-244-producing E. coli isolates are difficult to detect, which may lead to their silent spread. Copyright © 2017 American Society for Microbiology.
Neutron spectra of /sup 242/Cm-Be and /sup 244/Cm-Be neutron sources
Energy Technology Data Exchange (ETDEWEB)
Kumar, A; Nagarajan, P S [Bhabha Atomic Research Centre, Bombay (India). Div. of Radiation Protection
1977-02-15
Neutron spectra of /sup 242/Cm-Be(..cap alpha..,n) and /sup 244/Cm-Be(..cap alpha..,n) sources have been calculated including the spontaneous fission contribution which is negligible for /sup 242/Cm and amounts to about 4% for /sup 244/Cm. The agreement of the present work with experimental results is poor.
244-AR vault cooling water stream-specific report
International Nuclear Information System (INIS)
1990-08-01
The proposed wastestream designation for the 244-AR Vault cooling water wastestream is that this stream is not a dangerous waste, pursuant to the Washington (State) Administration Code (WAC) 173-303, Dangerous Waste Regulations. A combination of process knowledge and sampling data was used to make this determination. 21 refs., 6 figs., 7 tabs
48 CFR 252.244-7000 - Subcontracts for Commercial Items and Commercial Components (DoD Contracts).
2010-10-01
... under this contract: (a) 252.225-7009 Restriction on Acquisition of Certain Articles Containing... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracts for Commercial Items and Commercial Components (DoD Contracts). 252.244-7000 Section 252.244-7000 Federal...
A 244Pu spike reference material CBNM IRM-042A
International Nuclear Information System (INIS)
Verbruggen, A.; Gallet, M.; Hendrickx, F.; Bievre, P. de
1991-01-01
An highly enriched 244 Pu isotopic reference material (CBNM IRM-042a) has been prepared and certified for 244 Pu isotope concentration. The certified value of (2.257 7 ± 0.004 4).10 18 atoms 242 Pu.kg -1 of solution has been established by isotope dilution mass spectrometry. The plutonium isotopic composition has been determined by thermal ionization mass spectrometry and calibration of these measurements by means of synthetic 242 Pu/ 239 Pu mixtures. The isotopic reference material is supplied in a sealed glass ampoule containing approximately 10 g of a 5M nitric acid solution at an approximate concentration of 1 μg Pu per g solution. This isotopic reference material is part of a systematic CBNM programme to supply spike isotopic reference materials of various isotopes at different concentrations
Efforts to save 244Pu in Mark 18A targets for use in international safeguards measurements
International Nuclear Information System (INIS)
Goldberg, Steven A.; Cappis, John; Clarke, Stephanie; Whitesel, Robert
2001-01-01
Full text: The Office of Arms Control and Nonproliferation and the Office of Security and Emergency Operations are working collaboratively to evaluate the disposition of a large quantity of the 244 Pu isotope contained in 65 Mark ISA targets at the Savannah River Site (SRS). 244 Pu is used as a standard reference material for plutonium analytical measurements required for both domestic and international safeguards. 244 Pu is particularly valuable for high accuracy measurements of plutonium in small samples containing trace quantities of plutonium (environmental analysis) and for measurements of material through-put in bulk processing facilities handling large volumes of plutonium and plutonium-bearing materials. In October 2000, an assessment team was tasked by the U.S. Department of Energy (DOE) Under Secretary to evaluate pathways and costs for the chemical separation and isotopic enrichment of the 244 Pu identified in the targets. Even though the target materials have recently been designated as a National Resource, they are scheduled for waste disposal unless funds can be identified and assigned to the project. Background information on the Mark ISA targets and a review of the assessment process are presented below to inform other organizations and governments of current efforts to examine potential disposition options and to solicit international cooperation for the extraction of the 244 Pu. Background - The United States possesses the bulk of the world's supply of the rare isotope 244 Pu. This isotope was produced by extremely long neutron irradiation of 242 Pu in a high-flux reactor during experiments used primarily to create isotopes of medical interest. In its separated enriched form, 244 Pu is regarded as the most accurate and desirable spike for safeguards, forensics, and environmental analysis of plutonium, allowing the simultaneous measurement of a sample for isotopic abundances and elemental concentration. Such measurements are a critical component of
47 CFR 1.244 - Designation of a settlement judge.
2010-10-01
... Proceedings Presiding Officer § 1.244 Designation of a settlement judge. (a) In broadcast comparative cases... Administrative Law Judge for action. (c) If, in the discretion of the Chief Administrative Law Judge, it appears... Commission's Administrative Law Judges are eligible to act as settlement judges, except that an...
Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu
Energy Technology Data Exchange (ETDEWEB)
Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1995-10-01
The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).
The measurement of prompt neutron spectrum in spontaneous fission of {sup 244}Cm
Energy Technology Data Exchange (ETDEWEB)
Batenkov, O.I.; Boykov, G.S.; Drapchinsky, L.V.; Majorov, M.Ju.; Trenkin, V.A. [V.G. Khlopin Radium Inst., Saint Petersburg (Russian Federation)
1997-03-01
Under the Program of Measurements of Prompt Fission Neutron Spectra of Minor Actinides for Transmutation Purposes the integral neutron spectrum in spontaneous fission of {sup 244}Cm has been measured by the time-of-flight method in the energy range of 0.1-15 MeV relative to the standard neutron spectrum in {sup 252}Cf spontaneous fission. Essential attention was paid to revealing of possible systematic errors. It is shown, that the {sup 244}Cm spectrum shape may be well described by using Mannhart evaluation with appropriate parameter of Maxwell temperature T{sub M} = 1.37 MeV. (author)
Estimation of 244Cm intake by bioassay measurements following a contamination incident
International Nuclear Information System (INIS)
Thein, M.; Bogard, J.S.; Eckerman, K.F.
1990-01-01
An employee was contaminated with radioactive material consisting primarily of 244 Cm and 246 Cm as a consequence of handling a curium nitrate solution at a reprocessing facility. In vivo gamma analysis and in vitro (urine and fecal) bioassay measurements were performed. A sample of the curium solution from the workplace was obtained to confirm that the nitrate was the chemical form and to identify the isotopes of curium present. The mass ratio of 244 Cm/ 246 Cm was determined to be 91 to 7. Observed excretion rates were consistent with available information on curium. The results of the in vivo and in vitro measurements are presented and intake estimates for the incident are developed. (author) 11 refs.; 3 figs.; 2 tabs
Thomson, Jodi M; Distler, Anne M; Bonomo, Robert A
2007-10-09
Amino acid changes at Ambler position R244 in class A TEM and SHV beta-lactamases confer resistance to ampicillin/clavulanate, a beta-lactam/beta-lactamase inhibitor combination used to treat serious infections. To gain a deeper understanding of this resistance phenotype, we investigated the activities of sulbactam and two novel penem beta-lactamase inhibitors with sp2 hybridized C3 carboxylates and bicyclic R1 side chains against a library of SHV beta-lactamase variants at the 244 position. Compared to SHV-1 expressed in Escherichia coli, all 19 R244 variants exhibited increased susceptibility to ampicillin/sulbactam, an important difference compared to ampicillin/clavulanate. Kinetic analyses of SHV-1 and three SHV R244 (-S, -Q, and -L) variants revealed the Ki for sulbactam was significantly elevated for the R244 variants, but the partition ratios, kcat/kinact, were markedly reduced (13 000 -->
HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy
Directory of Open Access Journals (Sweden)
Fahrmann Michael G.
2014-01-01
Full Text Available HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability as they pertain to the intended use in rings and seals of advanced gas turbines.
27 CFR 28.244a - Shipment to a customs bonded warehouse.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to a customs... Export Consignment § 28.244a Shipment to a customs bonded warehouse. Distilled spirits and wine withdrawn for shipment to a customs bonded warehouse shall be consigned in care of the customs officer in charge...
Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm
International Nuclear Information System (INIS)
Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.
1977-01-01
An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience
Trabesinger, Andreas
2017-09-01
The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.
The early solar system abundance of 244Pu as inferred from the St. Severin chondrite
International Nuclear Information System (INIS)
Hudson, G.B.; Kennedy, B.M.; Podosek, F.A.; Hohenberg, C.M.
1987-03-01
We describe the analysis of Xe released in stepwise heating of neutron-irradiated samples of the St. Severin chondrite. This analysis indicates that at the time of formation of most chondritic meteorites, approximately 4.56 x 10 9 years ago, the atomic ratio of 244 Pu/ 238 U was 0.0068 +- 0.0010 in chondritic meteorites. We believe that this value is more reliable than that inferred from earlier analyses of St. Severin. We feel that this value is currently the best available estimate for the early solar system abundance of 244 Pu. 42 refs., 2 tabs
Isotopic yield in cold binary fission of even-even 230-244U isotopes
International Nuclear Information System (INIS)
Cyriac, Annu; Krishnan, Sreejith; Santhosh, K.P.
2017-01-01
The binary fission of even-even 230-244 U isotopes has been studied using the concept of cold reaction valley which was introduced in relation to the structure of minima in the so called driving potential
Design analysis report for the 244-AR vault Interim Stabilization interior transfer system
International Nuclear Information System (INIS)
CARLSON, A.B.
2002-01-01
The purpose of this calculation note is to verify that the 244-AR Vault Interior Transfer System piping installed in the vault meets ASME B31.3 code requirements. This calculation also evaluates the pipe support loads
Operability test procedure for 244-U DCRT. Revision 1
International Nuclear Information System (INIS)
Erhart, M.F.
1995-01-01
This OPT will insure the operability of various systems and their general equipment, used in the operation of the 244-U DCRT. Systems that will be tested include the following: Leak Detection Systems; Heat Trace System; Vessel Temperature Measurement System; Dip Tube Water System; Weight Factor and Specific Gravity System; Instrument Air System; Vessel Liquid Level System; Vessel Liquid Transfer System; and Exhauster Differential Pressure Indicating Controller System. The tests will cover checks on equipment operation and electrical interlocks, but will not cover checks on associated annunciator alarms which are covered in a separate OTP
The early solar system abundance of /sup 244/Pu as inferred from the St. Severin chondrite
Energy Technology Data Exchange (ETDEWEB)
Hudson, G.B.; Kennedy, B.M.; Podosek, F.A.; Hohenberg, C.M.
1987-03-01
We describe the analysis of Xe released in stepwise heating of neutron-irradiated samples of the St. Severin chondrite. This analysis indicates that at the time of formation of most chondritic meteorites, approximately 4.56 x 10/sup 9/ years ago, the atomic ratio of /sup 244/Pu//sup 238/U was 0.0068 +- 0.0010 in chondritic meteorites. We believe that this value is more reliable than that inferred from earlier analyses of St. Severin. We feel that this value is currently the best available estimate for the early solar system abundance of /sup 244/Pu. 42 refs., 2 tabs.
CM-244 as multiplier and breeder in a ThO/sub 2/ hybrid blanket driven by a (D,T) source
International Nuclear Information System (INIS)
Sahin, S.; Al-Kusayer, T.A.
1986-01-01
The safeguard aspects of Cm-244 - a nuclear waste product in LWRs - in a cylindrical hybrid blanket, driven by a (D,T) fusion neutron source have been analyzed. Cm-244 is investigated for two different applications: 1) as a neutron multiplier between the first wall and the fuel zone in a blanket with ThO/sub 2/; and 2) as a component of the mixed fuel, ThO/sub 2/-Cm/sup 244/O/sub 2/, used for power flattening in a hybrid blanket. The calculations show that a relatively small driven with 100 MW/sub th/ fusion power could produce about 5 kg/year Cm-245, enough to provide nuclear fuel for up to 50 explosives. The study suggests an extension of the safe-guarding regulations prior to the commercial introduction of fusion reactors in the energy market
The comparative carcinogenicity of 239Pu, 241Am, and 244Cm in the rat
International Nuclear Information System (INIS)
Taylor, D.M.
1986-01-01
Five completed studies compared the effects of 239 Pu, 241 Am, and 244 Cm in August-Marshall F 1 hybrid rats. Osteosarcomas were observed in all the treated groups but not in any control group. More than 70% of the osteosarcomas occurred in the lumber or thoracic vertebrae, the femur, or the tibia with all three radionuclides, but there is an indication that a smaller proportion of the tumors arises in the vertebrae after 239 Pu administration than after either of the other two radionuclides. Risk coefficients are 239 Pu, 487 +- 52; 241 Am, 175 +- 32; 244 Cm, 162 +- 45. These risk coefficients suggest that in the rat 239 Pu is about three times more effective for bone tumor induction than the other two radionuclides. A small number of leukemias, mainly of myelogenous origin, and a small number of other soft-tissue tumors were observed in the radionuclide-injected groups. No leukemias were observed in many hundreds of control animals. 14 refs., 4 tabs
Bioaccumulation, distribution, and dose of 241Am, 244Cm, and 238Pu in developing fish embryos
International Nuclear Information System (INIS)
Till, J.E.; Frank, M.L.
1977-01-01
The dose from several actinide elements to a sensitive stage in the development of one type of aquatic biota, the fish egg, was assessed. An investigation was made of the uptake and distribution of 241 Am, 244 Cm and 238 Pu by developing embryos of fish. Eggs from ripe carp, Cyprinos carpio, that had been spawned in the laboratory were placed in dishes containing 241 Am(III)- 244 Cm(III)-, or 238 Pu(IV)-citrate in solution at an activity concentration of approximately 10 -3 μCi/ml. Samples of eggs were taken at seven intervals during the 72-hour period of embryogenesis. Egg contents were separated from the membrane prior to analysis to quantify the activity that penetrated the chorion. Autoradiographs of 16-μm thick egg sections confirmed that alpha radioactivity was present in the egg contents and permitted the distribution of activity to be determined. Concentration factors were calculated based on activity ratios for the egg contents (excluding the chorion) over the development period. Maximum concentration factors occurred at hatching and were found to be 25, 40 and 3 for 241 Am, 244 Cm and 238 Pu, respectively. Collectively, these data were used to estimate the dose from americium, curium and plutonium in natural ecosystems to developing fish eggs which have similar embryological characteristics as carp
International Nuclear Information System (INIS)
YEH, T.
2002-01-01
This document reports on the analysis, testing and conclusions of the software verification and validation for the 244-AR Vault Interim Stabilization ventilation system. Automation control system will use the Allen-Bradley software tools for programming and programmable logic controller (PLC) configuration. The 244-AR Interim Stabilization Ventilation System will be used to control the release of radioactive particles to the environment in the containment tent, located inside the canyon of the 244-AR facility, and to assist the waste stabilization efforts. The HVAC equipment, ducts, instruments, PLC hardware, the ladder logic executable software (documented code), and message display terminal are considered part of the temporary ventilation system. The system consists of a supply air skid, temporary ductwork (to distribute airflow), and two skid-mounted, 500-cfm exhausters connected to the east filter building and the vessel vent system. The Interim Stabilization Ventilation System is a temporary, portable ventilation system consisting of supply side and exhaust side. Air is supplied to the containment tent from an air supply skid. This skid contains a constant speed fan, a pre-filter, an electric heating coil, a cooling coil, and a constant flow device (CFD). The CFD uses a passive component that allows a constant flow of air to pass through the device. Air is drawn out of the containment tent, cells, and tanks by two 500-cfm exhauster skids running in parallel. These skids are equipped with fans, filters, stack, stack monitoring instrumentation, and a PLC for control. The 500CFM exhaust skids were fabricated and tested previously for saltwell pumping activities. The objective of the temporary ventilation system is to maintain a higher pressure to the containment tent, relative to the canyon and cell areas, to prevent contaminants from reaching the containment tent
29 CFR 779.244 - “Covered enterprises” of interest to retailers of goods or services.
2010-07-01
... part 776 of this chapter. The statutory definitions of enterprises of interest to retailers under the... Apply; Enterprise Coverage Covered Retail Enterprise § 779.244 “Covered enterprises” of interest to retailers of goods or services. Retailers of goods or services are primarily concerned with the enterprises...
Evaluation of two cases of 244Cm inhalation
International Nuclear Information System (INIS)
Parkinson, W.W.; Henley, L.C.; Goans, R.E.; Good, W.M.
1976-01-01
Chest and systematic burdens have been estimated for two employees who inhaled largely soluble compounds of 244 Cm. Chest burdens by whole body counting were: Case A, 28 nCi; Case B, 34 nCi. The urinary excretion of the employees appeared to conform to a series of exponentials similar to those reported for blood and whole body retention of Am in baboons. Accordingly, retention functions composed of a series of exponentials having 4, 12-17, and 72 day half-times were derived from urinary excretion and used to calculate body burdens, Case A - 7 nCi an Case B - 16 nCi. Cumulative fecal excretion by Case B was some 20 times that by Case A (63 nCi vs. 3.2) probably due to differences in deposition in the respiratory tract. Calculated organ doses for the first year were approximately 20% of recommended maxima
Directory of Open Access Journals (Sweden)
Irina Yu. Petrushanko
2017-10-01
Full Text Available Our previous findings suggested that reversible thiol modifications of cysteine residues within the actuator (AD and nucleotide binding domain (NBD of the Na,K-ATPase may represent a powerful regulatory mechanism conveying redox- and oxygen-sensitivity of this multifunctional enzyme. S-glutathionylation of Cys244 in the AD and Cys 454-458-459 in the NBD inhibited the enzyme and protected cysteines’ thiol groups from irreversible oxidation under hypoxic conditions. In this study mutagenesis approach was used to assess the role these cysteines play in regulation of the Na,K-ATPase hydrolytic and signaling functions. Several constructs of mouse α1 subunit of the Na,K-ATPase were produced in which Cys244, Cys 454-458-459 or Cys 244-454-458-459 were replaced by alanine. These constructs were expressed in human HEK293 cells. Non-transfected cells and those expressing murine α1 subunit were exposed to hypoxia or treated with oxidized glutathione (GSSG. Both conditions induced inhibition of the wild type Na,K-ATPase. Enzymes containing mutated mouse α1 lacking Cys244 or all four cysteines (Cys 244-454-458-459 were insensitive to hypoxia. Inhibitory effect of GSSG was observed for wild type murine Na,K-ATPase, but was less pronounced in Cys454-458-459Ala mutant and completely absent in the Cys244Ala and Cys 244-454-458-459Ala mutants. In cells, expressing wild type enzyme, ouabain induced activation of Src and Erk kinases under normoxic conditions, whereas under hypoxic conditions this effect was inversed. Cys454-458-459Ala substitution abolished Src kinase activation in response to ouabain treatment, uncoupled Src from Erk signaling, and interfered with O2-sensitivity of Na,K-ATPase signaling function. Moreover, modeling predicted that S-glutathionylation of Cys 458 and 459 should prevent inhibitory binding of Src to NBD. Our data indicate for the first time that cysteine residues within the AD and NBD influence hydrolytic as well as receptor
Production and testing of 244Cm-labeled fluorescent polystyrene latex microspheres
International Nuclear Information System (INIS)
Guilmette, R.A.; Mueller, H.L.; Brodbeck, R.D.
1988-01-01
To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating 244 Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to μm-size (AMAD) 239 Pu0 2 particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)
30 CFR 250.244 - What geological and geophysical (G&G) information must accompany the DPP or DOCD?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... Operations Coordination Documents (docd) § 250.244 What geological and geophysical (G&G) information must accompany the DPP or DOCD? The following G&G information must accompany your DPP or DOCD: (a) Geological...
International Nuclear Information System (INIS)
Brusilovets, A.I.; Rusanov, Eh.B.; Chernega, A.N.
1995-01-01
Complex of zirconium tetrachloride with 1-tert.-butyl-2,4,4-trimethyl--2-thio-3-trimethyl-silyl-1,3,2,4-diazaphosphasilatedine interacts with methylene chloride with formation of bis[3-tert.-butyl-2,4,4-trimethyl-1--trimethylsilyl-2-chloremethylthio-1,3,2,4-diazaphosphasilatedinium] decachlorodizirconate. Specific features of crystal and molecular structure of the compound prepared have been studied by X-ray diffraction method. 21 refs.; 2 figs.; 2 tabs
Energy Technology Data Exchange (ETDEWEB)
Ahmad, I.; Kondev, F. G.; Greene, J. P.; Zhu, S.
2018-01-01
Electron capture decays of Bk-243 and Bk-244 have been studied by measuring the gamma-ray spectra of mass-separated sources and level structures of Cm-243 and Cm-244 have been deduced. In Cm-243, the electron capture population to the ground state, 1/2(+)[631], and 1/2(+)[620] Nilsson states have been observed. The octupole K-pi = 2(-) band was identified in Cm-244 at 933.6 keV. In addition, spins and parities were deduced for several other states and two-quasiparticle configurations have been tentatively assigned to them
Table of radionuclides (Vol. 5 - A = 22 to 244)
International Nuclear Information System (INIS)
Be, M.M.; Chiste, V.; Dulieu, C.; Mougeot, X.; Browne, E.; Chechev, V.; Kuzmenko, N.; Kondev, F.; Luca, A.; Galan, M.; Arinc, A.; Huang, X.
2010-01-01
methodologies to be used and the CD-ROM included with this monograph contains the evaluators' comments for each radionuclide in addition to the data tables included in the monograph. This volume includes the evaluation of the following radionuclides: 22 Na, 40 K, 75 Se, 124 Sb, 207 Bi, 211 Bi, 217 At, 222 Ra, 225 Ac, 228 Ra, 231 Th, 232 Th, 233 Th, 233 Pa, 234 Th, 235 U, 237 U, 238 Pu, 240 Pu, 241 Am, 242 Pu, 242 Am, 243 Am, 244 Am, 244 Am m . Primary recommended data comprise half-lives, decay modes, X-rays, gamma-rays, electron emissions, alpha -and beta- particle transitions and emissions, and their uncertainties
Energy Technology Data Exchange (ETDEWEB)
Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)
1997-03-01
The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)
Production and testing of {sup 244}Cm-labeled fluorescent polystyrene latex microspheres
Energy Technology Data Exchange (ETDEWEB)
Guilmette, R A; Mueller, H L; Brodbeck, R D
1988-12-01
To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating {sup 244}Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to {mu}m-size (AMAD) {sup 239}Pu0{sub 2} particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)
Estimation of radioactive contaminants in Cm242 and Cm244 isotopic fuels
International Nuclear Information System (INIS)
Terent'ev, V.P.; Makarenko, A.I.
1972-01-01
The radiation properties of Cm 242 and Cm 244 preparations and the effect on them of possible contaminants are considered. One of the most important requirements for K alpha active fuels for radioisotope thermoelectric batteries is ensuring a low ionizing radiation background. In determining the effect of impurities on the radiation properties of a preparation, quantitative evaluation of certain factors is sufficient. In a Cm 242 preparation it is possible to show that Am 241 and Cm 243 are undesirable impurities. The presence of Am 241 increases the soft gamma output by 20%. The presence of Cm 243 may double the dose rate from an unshielded preparation and increase the hard gamma output 10-fold. The properties of Cm 242 preparations deteriorate when Am 243 and Cm 243 are present
Vo, Van; Tanthmanatham, Ontida; Han, Haesook; Bhowmik, Pradip K; Spangelo, Bryan L
2013-08-01
A series of [Pt(II)Cl2(4,4'-dialkoxy-2,2'-bipyridine)] complexes of the general formula of [Pt(II)Cl2(4,4'-bis(RO)-2,2'-bipyridine)] (where R = -(CH2)n-1CH3, n = 2-6, 8) were synthesized and characterized using (1)H NMR, (13)C NMR spectroscopy, elemental analysis, mass spectroscopy, and differential scanning calorimetry measurements. The in vitro anti-proliferative activities of these compounds were evaluated against human cancer cell lines A549 (lung adenocarcinoma), DU145 (prostate carcinoma), MCF-7 (breast adenocarcinoma), and MDA-MB-435 (melanoma) using the MTS cell proliferation assay. Several Pt(II) coordination compounds were found to have greatly enhanced activity compared to cisplatin after a one hour treatment in all cell lines tested. A structure-activity relationship was observed, that is, the activity increases as the carbon chain length of the alkyl group increases. The activity was maximum when the carbon chain length reached four or five carbons and decreased with the longer carbon chain length. Fluorescence microscopy and flow cytometry data indicate that the main mode of cell death is through apoptosis with some necrotic responses.
Changing trends in blood transfusion: an analysis of 244,013 hospitalizations.
Shehata, Nadine; Forster, Alan; Lawrence, Nadine; Rothwell, Deanna M; Fergusson, Dean; Tinmouth, Alan; Wilson, Kumanan
2014-10-01
Identifying recipients of blood transfusion and the trends in transfusion are needed to properly identify and target clinical services in need of patient blood management strategies. We determined the proportion of admissions to each clinical service that received blood, the mean number of units utilized, and the 5-year trends in utilization. We used a large administrative database, a repository for three campuses of one university-affiliated hospital, and included all adults that were hospitalized from November 1, 2006, to June 2012. The data were analyzed as the proportion of admissions transfused and the mean number units transfused per admission. Of 244,013 hospitalizations, 38,265 received at least one transfusion (29,165 for red blood cells [RBCs], 6760 for plasma, and 5795 for platelets [PLTs]). Although there has been a gradual decrease in the mean number of RBCs transfused (percent change, -9.8%; p = 0.002), an increase in the proportion of admissions receiving RBCs (17.2% increase, p conservation strategies. © 2014 AABB.
Isotopic composition of primary xenon and the fission of Pu-244
Energy Technology Data Exchange (ETDEWEB)
Levskii, L K
1983-05-01
The hypothesis that the origin of xenon on earth is due to the fission of uranium and/or transuranium elements is examined. The isotopic composition of primary xenon on earth is calculated using a model (Levskii, 1980) of the isotopic composition of rare gases which is based on the hypothesis of the heterogeneity of the isotopic composition of the elements of the solar system. The isotopic composition of fission-produced xenon in the atmosphere and solid earth is determined to correspond to the abundance of xenon isotopes as a result of the spontaneous fission of Pu-244 (half-life of 8.2 x 10 to the 7th years). The amount of fission-produced xenon in the atmosphere is shown to amount to about 30 percent (Xe-136). Under certain conditions, the degree of the degassing of the solid earth for xenon is 25 percent, which corresponds to a ratio of Kr-84/Xe-130 45 for the earth as a whole.
Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986
International Nuclear Information System (INIS)
Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.
1986-04-01
This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances
Marr, Joachim; Niknian, Minoo; Shulman, Lee P; Lynen, Richard
2011-07-01
A combined oral contraceptive comprising ethinylestradiol (EE) 20 mcg/drospirenone 3 mg in a 24/4 regimen has been clinically shown to alleviate the symptoms associated with premenstrual dysphoric disorder (PMDD). However, previous studies did not report data according to cycle-by-cycle improvement. This was a subanalysis of a Phase III, double-blind, multicenter, United States-based study. Women with confirmed PMDD were randomized to EE 20 mcg/drospirenone 3 mg 24/4 or placebo for three treatment cycles. Ten of the 21 emotional and physical items on the Daily Record of Severity of Problems scale were grouped to define three symptom clusters: (a) negative emotions, (b) food cravings and (c) water retention-related symptoms. The change from baseline at each treatment cycle was compared between groups using a weighted analysis of covariance model. The full analysis set comprised 449 women. Daily Record of Severity of Problems scores for each symptom cluster were significantly reduced from baseline with both EE 20 mcg/drospirenone 3 mg 24/4 and placebo (pemotions, food cravings and water retention-related symptoms to a significantly greater extent than placebo during all three cycles of treatment. Copyright © 2011 Elsevier Inc. All rights reserved.
2012-05-08
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-74,850; TA-W-74,850A] StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc., 1250 H Street, Greeley, CO; Amended... workers and former workers of StarTek USA, Inc., Greeley, Colorado. The Department's notice of...
Directory of Open Access Journals (Sweden)
Bitzer J
2015-05-01
Full Text Available Johannes Bitzer,1 Maria Jesusa Banal-Silao,2 Hans-Joachim Ahrendt,3 Jaime Restrepo,4 Marion Hardtke,5 Ulrike Wissinger-Graefenhahn,6 Dietmar Trummer7 1Department of Obstetrics and Gynecology, University Hospital of Basel, Basel, Switzerland; 2University of the Philippines College of Medicine, Manila, Philippines; 3Praxis für Frauenheilkunde, Klinische Forschung und Weiterbildung (Clinical Research and Further Education, Magdeburg, Germany; 4Centro de Investigación Clínica, Clinica Medellin Poblado, Medellin, Colombia; 5Global Clinical Development Operations, Bayer Pharma AG, Berlin, Germany; 6Global Medical Affairs Women’s Healthcare, Bayer Pharma AG, Berlin, Germany; 7Clinical Statistics Europe, Bayer Pharma AG, Berlin, Germany Objective: To assess whether the combined oral contraceptive (COC ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4-day regimen (ie, 4-day hormone-free interval is more effective than an EE 20 µg/desogestrel (DSG 150 µg COC taken in a 21/7-day regimen (ie, 7-day hormone-free interval in reducing hormone withdrawal-associated symptoms (HWAS.Methods: This double-blind, randomized study (NLM identifier: NCT01076582 was conducted at 34 centers in 12 countries. Otherwise healthy women who experienced ≥2 HWAS of headache, pelvic pain, and/or bloating when using their current COCs in a 21/7-day regimen were recruited. Subjects rated the severity of their HWAS daily on a seven-point Likert scale during a baseline cycle and during four 28-day cycles with EE/drospirenone 24/4 (n=290 or EE/DSG 21/7 (n=304. The primary variable was the mean change from baseline to cycle 4 in the composite HWAS score (sum of scores for all three symptoms during cycle days 22–28.Results: In the EE/drospirenone 24/4 group, the mean (standard deviation composite HWAS score during cycle days 22–28 was reduced from 42.2 (24.8 at baseline to 12.8 (13.4 at cycle 4 (change from baseline: -30.3 [22.9]. In the EE/DSG 21/7 group, the
2018-02-01
Retracted Review article: Nucleophagy in Human Disease: Beyond the Physiological Role. [Tohoku J. Exp. Med., 2018, 244 (1), 75-81. doi: 10.1620/tjem.244.75.] The above Review article was published online on January 27, 2018. Soon after its publication (on February 1, 2018), Dr. Nian Fu and Prof. Linxi Chen informed the Editor-in-Chief, The Tohoku Journal of Experimental Medicine (TJEM), about serious violation of publication ethics. Indeed, Dr. Nian Fu and Prof. Linxi Chen were astonished to find their names as coauthors of this Review article, because they were not involved in the submission process of this Review article and they do not know any of other coauthors. In addition, the Review article is similar to their unpublished manuscript. After a thorough investigation in accordance with the recommendations of the Committee on Publication Ethics (COPE), the Editor-in-Chief of TJEM decided to retract this Review article. The reasons for Retraction are summarized below: forged authors and an unexpected case of plagiarism. Forged authors: Dr. Nian Fu and Prof. Linxi Chen were added as co-authors of the Review article without their knowledge. In fact, the signature provided by Prof. Linxi Chen is apparently different from the signature of a coauthor, named Linxi Chen, on the AUTHORS’ RESPONSIBILITY FORM, provided by the corresponding author of the Review article. More critically, the signature provided by Dr. Nian Fu is completely different from the signature of Nian Fu, because the Chinese characters are different between the two signatures. In addition, the replies from three authors (Ming Zhou, Hongwen Ji and Yong Xia) clearly indicate that they misunderstand the identity of Dr. Nina Fu. We also attempted to contact two authors, named Nian Fu and Linxi Chen, via e-mail. As expected, the forged authors did not respond to our inquiries, despite that their e-mail addresses appear to be active. An unexpected case of plagiarism: This Review article is similar to the
International Nuclear Information System (INIS)
Carrell, D.J.
1997-01-01
This document serves as a notice of construction (NOC), pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to construct, pursuant to 40 Code of Federal Regulations (CFR) 61.96, a portable exhauster at the 244-AR Vault. The exhauster would be used during air jetting of accumulated liquids from the cell sumps into the tanks and to make transfers among the tanks within the vault when needed. The 244-AR Vault is considered to be a double-contained receiver tank (OCRT) based on its functional characteristics, although it is not listed as one of the five designated DCRTs in the 200 Area Tank Farm systems. Process operations at the vault have been inactive since 1978 and the vault's two stacks have not operated since 1993. Since cessation of vault operations an extremely large amount of rain water and snow melt have accumulated in the cell sumps. The water level in the sumps is substantially above their respective operating levels and there is concern for leakage to the environment through containment failure due to corrosion from backed-up sump liquid. Active ventilation is required to provide contamination control during air jetting operations within the vault. It has been determined that it would not be cost effective to repair the existing exhaust systems to an operational condition; thus, a portable exhauster will be used to support the intermittent operations
Vo, Van; Tanthmanatham, Ontida; Han, Haesook; Bhowmik, Pradip K.; Spangelo, Bryan L.
2013-01-01
A series of [Pt(II)Cl2(4,4′-dialkoxy-2,2′-bipyridine)] complexes of the general formula of[Pt(II)Cl2(4,4′-bis(RO)-2,2′-bipyridine)] (where R = −(CH2)n−1CH3, n = 2–6,8) were synthesized and characterized using 1H NMR, 13C NMR spectroscopy, elemental analysis, mass spectroscopy, and differential scanning calorimetry measurements. The in vitro anti-proliferative activities of these compounds were evaluated against human cancer cell lines A549 (lung adenocarcinoma), DU145 (prostate carcinoma), MCF-7 (breast adenocarcinoma), and MDA-MB-435 (melanoma) using the MTS cell proliferation assay. Several Pt(II) coordination compounds were found to have greatly enhanced activity compared to cisplatin after a one hour treatment in all cell lines tested. A structure-activity relationship was observed, that is, the activity increases as the carbon chain length of the alkyl group increases. The activity was maximum when the carbon chain length reaches four or five carbons and decreased with the longer carbon chain length. Fluorescence microscopy and flow cytometry data indicate that the main mode of cell death is through apoptosis with some necrotic responses. PMID:23817622
Energy Technology Data Exchange (ETDEWEB)
Costa, Danilo Manuel Cerqueira; Salvadori, Priscila Silveira; Monjardim, Rodrigo da Fonseca; Bretas, Elisa Almeida Sathler; Torres, Lucas Rios; Caldana, Rogerio Pedreschi; Shigueoka, David Carlos; Medeiros, Regina Bitelli; D' ippolito, Giuseppe, E-mail: giuseppe_dr@uol.com.br [Universidade Federal de Sao Paulo (EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Departamento de Diagnostico por Imagem
2013-06-15
Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)
Directory of Open Access Journals (Sweden)
Jiaxi Chen, Jing Sun*, Jufang Kong, Wenxiu Chen and Hongqing Hao*
2015-03-01
Full Text Available Abstract: A new Ru(II polypyridyl complex, [Ru(phen2(4,4'-dicarboxy-2,2'-bipyridine]PF6·1.5H2O, was synthesized andcharacterized by single crystal X-ray diffraction, elementalanalyses, electrospray ionization mass spectrometry, infraredspectra, ultraviolet (UV spectra, and emission spectra. Thestructure of the cation [Ru(phen2(4,4'-(COO-,(COOH-2,2'-bpy]+ consists of a six-coordinated ruthenium atom chelated bytwo phen ligands and one 4,4'-dicarboxy-2,2'-bipyridine ligand.The absorption spectrum of the Ru(II complex is characterizedby two intense ligand-centered transitions in the UV region andone metal to ligand charge transfer in the visible region. Moreover,the complex can display luminescence in water at roomtemperature, with maximum emission at 623 nm.Supporting information: Cif file
Matsjeh, Sabirin; Swasono, Respati Tri; Anwar, Chairil; Solikhah, Eti Nurwening; Lestari, Endang
2017-03-01
The compound 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone have been synthesized through Claisen-Schmidt reaction from 2-hydroxyacetophenone and 2,4-dihydroxyacetophenone with 4-hydroxy-3-methoxy benzaldehida (vanillin) in aqueous KOH 40% and KSF montmorillonite as catalyst in methanol. All these products were characterized by FT-IR, TLC Scanner, GC-MS, MS-Direct, and 1H-NMR and 13C-NMR spectrometer. Both of these compounds were tested citotoxycity activity as an anticancer against cervical, colon, and breast cancer cells (Hela, WiDr, and T47D cell lines) using MTT assay in vitro. Dose series given test solution concentration on Hela, WiDr, and T47D cells started from 6,25; 25; 50 and 100 µg/mL with incubation treatment for 24 hours. The result of study showed that the 2',4-dihydroxy-3-methoxychalcone as bright yellow crystal with the melting point of 114-115 °C and the yield of 13.77% and the 2',4',4-trihydroxy-3-methoxychalcone as bright yellow crystals with the melting point of 195-197 °C and the yield of 6%. Other 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone also exhibited cytotoxic activity against the cancer cell lines, with the 2',4',4-trihydroxy-3-methoxychalcone showed greater activities than the 2',4-dihydroxy-3-methoxychalcone in WiDr cell lines. The 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone exhibited strong anticancer activities with IC50 value below 20 µg/mL. The activity of 2',4',4-trihydroxy-3-methoxychalcone showed the most active against Hela and WiDr cell lines with IC50 value 8.53 and 2.66 µg/mL respectively, than T47D cell lines with IC50 value 24.61 µg/mL. The test results cytotoxic of 2',4-dihydroxy-3-methoxychalcone showed the most active against Hela and WiDr cell lines with IC50 value 12.80, 19.57 µg/mL than T47D cell lines with IC50 value of 20.73 µg/mL. IC50 value indicated that 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
[The effect of occupational stress on depression symptoms among 244 policemen in a city].
Gu, Guizhen; Yu, Shanfa; Wu, Hui; Zhou, Wenhui
2015-10-01
To explore the influence of occupational stress related factors on depression symptoms among 244 policemen in a city in China. In May 2011, 287 policemen from a city public security bureau were recruited to this survey by cluster sampling method. We deleted questionnaires which include missing variables on demographic characteristics and factors associated with occupational stress questionnaires which include over 3 missing items. 244 policemen were included in this study. Depression symptoms and occupational stressors were measured using Chinese version of depression self-reported questionnaire, job content questionnaire, Chinese version of effort-reward imbalances questionnaire, job hazard scale and occupational stress inventory. Depression symptom scores and the relationship between the variables and occupational stress were analyzed by Spearman correlation analysis and multiple regression analysis. The Median (P25-P75) of depression symptom scores of all respondents was 16.50 (11.00-25.00). 144 were policemen with no depression symptoms and 100 were with depression symptoms. The median (P25-P75) of depression symptoms scores among policemen with length of serves stress and negative affectivity among policemen with depression symptoms were 17.00 (8.00-26.00), 16.00 (11.00-24.50), 19.00 (12.00-27.00), and 12.00 (6.25-15.00), respectively, which were higher than those with no depression symptoms (24.00 (22.00-25.00), 8.00 (5.00-13.00), 8.00 (6.00-10.00), 1.00 (0-2.75)), and the differences were significant (Z=3.82, 5.39, 5.15, 6.41, Pstress, negative affectivity and job hazards scores. Correlations coefficient were 0.44, 0.28, 0.28, 0.33, 0.38, 0.44, and 0.38, respectively (Pstress and negative affectivity had bigger contribution on the depression symptoms scores. The standard regression coefficient was -0.46, 0.19 and 0.13, respectively (Pstress, negative affectivity and job hazards scores were the inducement of depression symptoms for policemen. To reduce the
International Nuclear Information System (INIS)
Stepanov, A.; Belyaev, B.; Buljanitsa, L.
1989-11-01
The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233 U, 236 U, 242 Pu and 244 Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233 U/ 236 U ratio and the 236 U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235 U/ 238 U ratio of NBS500 used as internal standard. The coefficients of variation of the 244 Pu/ 242 Pu ratio and the 242 Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240 Pu/ 239 Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs
International Nuclear Information System (INIS)
Odintsov, A.A.; Sazhenyuk, A.D.
2004-01-01
The paper deals with data of research on the distribution of the radionuclides 137Cs, 90Sr, 239+240Pu, 241Am and 244Cm of ''the Chornobyl rains'' by the fractions of the organic matters of derno-podzolic sandy, derno-meadow and peat soils sampled in the alienation zone of the Chornobyl NPP. Functioning of organic matters was carried according to Tyurin's method. It is stressed that, independently on soil type, 137Cs is connected with the mineral contituent by 80-95%. It is found out that, independently on the soil type, 50-70% 137Sr and 15-45% 241Am are associated with fulvic acid fractions. The 241Am and 244Cm distribution according to organic acids taking into account deviations while carrying out determinations is unambiguous. It is found out that in all the soils tested the main quality of 239+24Pu is connected with humic acids
The synthesis of superheavy nuclei in the 48Ca + 244Pu reaction
International Nuclear Information System (INIS)
Oganesyan, Yu.Ts.; Utenkov, V.K.; Lobanov, Yu.V.
1999-01-01
In the bombardment of a 244 Pu target with 48 Ca ions, we observed a decay sequence consisting of an implanted heavy atom, three subsequent α-decays, and a spontaneous fission, all correlated in time and position. The measured α-energies and corresponding time intervals were: E α = 9.71 MeV (Δt = 30.4 s), 8.67 MeV (Δt = 15.4 min) and 8.83 MeV (Δt = 1.6 min); for the spontaneous fission (Δt = 16.5 min) the total deposited energy was approximately 190 MeV. The large alpha-particle energies together with the long decay times and spontaneous fission terminating the chain offer evidence of the decay of nuclei with high atomic numbers. This decay chain is a good candidate for originating from the α-decay of the parent nucleus 289 114, produced in the 3n-evaporation channel with a cross section of about 1 pb. The significant increase in the lifetimes of the new Z = 112 and 110 daughters of the Z = 114 nuclide (by a factor of ∼ 10 6 ) with respect to the known heaviest isotopes of elements 112 and 110 can be considered as a direct proof of the existence of the 'island of stability' of superheavy elements
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
International Nuclear Information System (INIS)
Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.
2013-01-01
Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)
DEFF Research Database (Denmark)
Kirchhoff, Maria; Bisgaard, Anne-Marie; Stoeva, Radka
2009-01-01
Partial deletions of the long arm of chromosome 13 lead to variable phenotypes dependant on the size and position of the deleted region. In order to update the phenotypic map of chromosome 13q21.1-qter deletions, we applied 244k Agilent oligonucleotide-based array-CGH to determine the exact break......-genotype correlation on chromosome 13. In contrast to previous reports of carriers of 13q32 band deletions as the most seriously affected patients, we present two such individuals with long-term survival, 28 and 2.5 years....
Zhou, Wen-Juan; Luo, Zhen-Ni; Tang, Chang-Min; Zou, Xiao-Xu; Zhao, Lu; Fang, Peng-Qian
2016-10-01
The improvement of antibiotic rational use in China was studied by usage analysis of combination antibiotic therapy for type I incisions in 244 hospitals. Five kinds of hospitals, including general hospital, maternity hospital, children's hospital, stomatological hospital and cancer hospital, from 30 provinces were surveyed. A systematic random sampling strategy was employed to select outpatient prescriptions and inpatient cases in 2011 and 2012. A total of 29 280 outpatient prescriptions and 73 200 inpatient cases from 244 hospitals in each year were analyzed. Data were collected with regards to the implementation of the national antibiotic stewardship program (NASP), the overall usage and the prophylactic use of antibiotic for type I incisions. Univariate analysis was used for microbiological diagnosis rate before antimicrobial therapy, prophylactic use of antibiotics for type I incision operation, and so on. For multivariate analysis, the use of antibiotics was dichotomized according to the guidelines, and entered as binary values into logistic regression analysis. The results were compared with the corresponding criteria given by the guidelines of this campaign. The antibiotic stewardship in China was effective in that more than 80% of each kind of hospitals achieved the criteria of recommended antibiotics varieties. Hospital type appeared to be a factor statistically associated with stewardship outcome. The prophylactic use of antibiotics on type I incision operations decreased by 16.22% (Pbench marking. More efforts addressing the root cause of antibiotics abuse would continue to improve the rational use of antibiotics in China.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
International Nuclear Information System (INIS)
Singh, Manpreet; Sengupta, Arijit; Murali, M.S.; Adya, V.C.; Kadam, R.M.
2016-01-01
Room temperature ionic liquid has been world-wide considered as the potential 'green' alternatives to the molecular diluents. A comparative study was carried out for studying selective separation of uranium from radioactive waste solution using Bis(2,4,4-trimethylpentyl phosphinic) acid in molecular diluent (xylene) and ionic liquid (C 8 mimNTf 2 ). For ionic liquid based system, the extraction kinetics was found to be slower compared to the molecular diluents. This was attributed to the higher viscosity of ionic liquid. In ionic liquid the extraction occurs with the predominance of 'ion exchange' mechanism through (UO 2 (NO 3 ). 2L) + species, while for xylene based system 'solvation' mechanism predominates at higher feed acidity. The extraction process in ionic liquid was found to be thermodynamically more favoured than in xylene. The nature of the extracted species was found to be different in ionic liquid and xylene as obtained from difference in luminescence emission profiles and lifetime of the extracted complex. Ionic liquid based system was found to be radiolytically more stable than the molecular diluents based solvent system. Na 2 CO 3 solution was found to back extract the uranyl ion almost quantitatively (99.9 %) from the loaded organic phase but overall stripping from ionic liquid phase is comparatively poorer than that of xylene phase. The processing of Simulated High Level Waste (SHLW) of Pressurized Heavy Water Reactor (PHWR) or Research Reactor (RR) origin revealed that bis(2,4,4-trimethylpentyl phosphinic) acid can effectively be used for the preferential extraction of U with better selectivity for ionic liquid phase. But the ion exchange mechanism is one of the disadvantages for its plant scale application. (author)
Chelation and stabilization of berkelium in oxidation state +IV
Czech Academy of Sciences Publication Activity Database
Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.
2017-01-01
Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016
Table of radionuclides (Vol.3 - Α = 3 to 244)
International Nuclear Information System (INIS)
Be, M.M.; Chiste, V.; Dulieu, Ch.; Browne, E.; Baglin, C.; Chechev, V.; Kuzmenko; Helmer, R.; Kondev, F.; MacMahon, T.D.; Lee, K.B.
2006-01-01
evaluating nuclear data is on-going and the recommended values are updated on the LNHB web site at http://www.nucleide.org/DDEP WG/DDEPdata.htm. The publication of further volumes of Monographie 5 is envisaged as and when necessary to add new radionuclide data or re-evaluations in a more permanent format that can be referenced easily. Although other data sets may still be used when evaluating radionuclide activity, use of this common, recommended data set should help to reduce the uncertainties in activity evaluations and lead to more coherent results for comparisons. This volume includes the evaluation of the following radionuclides: 3 H, 55 Fe, 56 Co, 60 Co, 63 Ni, 65 Zn, 79 Se, 90 Sr, 90 Y, 90 Y m , 108 Ag, 108 Ag mn 111 In, 125 Sb, 137 Cs, 153 Sm, 159 Gd, 203 Pb, 233 Pa, 233 Th, 234 U, 236 Np, 236 Np m , 237 U, 238 U, 242 Cm, 243 Am, 244 Cm. Primary recommended data comprise half-lives, decay modes, X-rays, gamma-rays, electron emissions, alpha- and beta-particle transitions and emissions, and their uncertainties. (authors)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Evolving role of 2B4/CD244 in T and NK cell responses during virus infection
Directory of Open Access Journals (Sweden)
Stephen Noel Waggoner
2012-12-01
Full Text Available The signaling lymphocyte activation molecule (SLAM family receptor, 2B4/CD244, was first implicated in anti-viral immunity by the discovery that mutations of the SLAM-associated protein, SAP/SH2D1A, impaired 2B4-dependent stimulation of T and natural killer (NK cell anti-viral functions in X-linked lymphoproliferative (XLP syndrome patients with uncontrolled Epstein-Barr virus (EBV infections. Engagement of 2B4 has been variably shown to either activate or inhibit lymphocytes which express this receptor. While SAP expression is required for stimulatory functions of 2B4 on lymphocytes, it remains unclear whether inhibitory signals derived from 2B4 can predominate even in the presence of SAP. Regardless, mounting evidence suggests that 2B4 expression by NK and CD8 T cells is altered by virus infection in mice as well as in humans, and 2B4-mediated signaling may be an important determinant of effective immune control of chronic virus infections. In this review, recent findings regarding the expression and function of 2B4 as well as SAP on T and NK cells during virus infection is discussed, with a focus on the role of 2B4-CD48 interactions in crosstalk between innate and adaptive immunity.
Indian Academy of Sciences (India)
tribpo
et al. 1994) or by using high frequency chopping mechanism (like the ZIMPOL, Povel. 1995) which eliminates seeing induced spurious polarisation signals. In an earlier attempt at the KTT (Ananth et al. 1994), a chopping scheme was utilised with a peltier cooled CCD detector achieving a rate of 0.5 Hz. However, this CCD ...
Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition
International Nuclear Information System (INIS)
Henderson, R.A.
2009-01-01
This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update
Bordes, J; Loheas, D; Benois, A
2015-01-01
The pratice of intensive care in Africa is marked by a wide variety of health care delivery. Only a few centers offer specialized intensive care units, as cardiac or neurological units. That may explain the need for aeromedical evacuations for patients whose condition exceeds local capacity. Our objective was to assess whether the proportion of patients admitted to intensive care and evacuated had increased between 1997 and 2013 in a developing country, Djibouti. We examined the activity register of Bouffard Hospital intensive care unit in Djibouti to determine the number and characteristics of patients evacuated by air ambulance during a 16 years period. From January 1997 to December 2013, a total of 244 patients were evacuated. The evacuation rate was 5.74ù of the patients admitted to the entire duration of the study. The rate of patients evacuated was not different between 1997 and 2013 (5,69ù versus 8,33ù respectively, p = 0,269). However, the rate of djiboutian evacuated patients was statistically different between 1997 and 2013 (0,96ù versus 4,46ù, p = 0,02). The main causes were severe trauma injuries, cardiovascular diseases and neurological diseases. The aeromedical evacuation of a critically ill patient in a developing country is a process requiring heavy logistics and depending on the medical skills available in the area, and financial resources that can be implemented for the patient. Our study shows that medical evacuations in favor of Djiboutian patients are marginal but are increasing over the past decade.
International Nuclear Information System (INIS)
Akhter, Nasima; Shiba, Kazuhiro; Ogawa, Kazuma; Kinuya, Seigo; Nakajima, Kenichi; Mori, Hirofumi
2007-01-01
In this study, the (+)-enantiomer of radioiodinated 2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 125 I]-p-iodovesamicol] [(+)-[ 125 I]pIV], which is reported to bind with high affinity to σ-1 receptors in vitro, was tested for its usefulness in imaging σ-1 receptors in the central nervous system (CNS) in vivo. In biodistribution studies, significant amounts (approximately 3% of the injected dose) of (+)-[ 125 I]pIV accumulated in rat brain, and its retention was prolonged. In blocking studies, the accumulation of (+)-[ 125 I]pIV in the rat brain was significantly reduced by the coadministration of σ-ligands such as pentazocine (5.0 μmol), haloperidol (0.5 μmol) or SA4503 (0.5 μmol). The blocking effect of pentazocine (selective σ-1 ligand) was similar to the blocking effects of SA4503 and haloperidol [nonselective σ (σ-1 and σ-2) ligands]. Ex vivo autoradiography of the rat brain at 45 min following intravenous injection of (+)-[ 125 I]pIV showed high localization in brain areas rich in σ-1 receptors. Thus, the distribution of (+)-[ 125 I]pIV was thought to bind to σ-1 receptors in the CNS in vivo. These results indicate that radioiodinated (+)-pIV may have the potential to image σ-1 receptors in vivo
Artun, Ozan
2017-07-01
In this paper, we intend to extend the nuclear data of 244Cm, 241Am, 238Pu, 210Po, 147Pm, 137Cs, 90Sr and 63Ni nuclei used in nuclear battery technology, because, these nuclei are quite important for space investigations in radioisotope thermoelectric generator (RTG) and for microelectronic technologies in betavoltaic batteries. Therefore, the nuclear structure properties of nuclei such as separation energies, neutron skin thicknesses, proton, charge and neutron density distributions as a function of radius, the root mean square (rms) proton, charge and neutron radii, binding energies per particle, have been investigated by Hartree-Fock with eight different Skyrme forces. The obtained results have been compared with the experimental data in literature and relativistic mean field theory (RMFT) results.
International Nuclear Information System (INIS)
Endo, A.; Sato, T.
2013-01-01
Absorbed doses, linear energy transfers (LETs) and quality factors of secondary charged particles in organs and tissues, generated via the interactions of the spontaneous fission neutrons from. 252 Cf and. 244 Pu within the human body, were studied using the Particle and Heavy Ion Transport Code System (PHITS) coupled with the ICRP Reference Phantom. Both the absorbed doses and the quality factors in target organs generally decrease with increasing distance from the source organ. The analysis of LET distributions of secondary charged particles led to the identification of the relationship between LET spectra and target-source organ locations. A comparison between human body-averaged mean quality factors and fluence-averaged radiation weighting factors showed that the current numerical conventions for the radiation weighting factors of neutrons, updated in ICRP103, and the quality factors for internal exposure are valid. (authors)
Fursova, Nadezhda K; Astashkin, Eugeny I; Knyazeva, Anastasia I; Kartsev, Nikolay N; Leonova, Ekaterina S; Ershova, Olga N; Alexandrova, Irina A; Kurdyumova, Natalia V; Sazikina, Svetlana Yu; Volozhantsev, Nikolay V; Svetoch, Edward A; Dyatlov, Ivan A
2015-11-02
The spread of carbapenemase-producing Enterobacteriaceae (CPE) is a great problem of healthcare worldwide. Study of the spread for bla OXA-48-like genes coding epidemically significant carbapenemases among hospital pathogens is important for the regional and global epidemiology of antimicrobial resistance. Antibacterial resistant isolates of Klebsiella pneumoniae (n = 95) from 54 patients, P. mirabilis (n = 32) from 20 patients, Enterobacter aerogenes (n = 6) from four patients, and Enterobacter cloacae (n = 4) from four patients were collected from January, 2013 to October, 2014 in neurosurgical intensive care unit (ICU) of the Burdenko Neurosurgery Institute, Moscow. Characteristics of the isolates were done using susceptibility tests, PCR detection of the resistance genes, genotyping, conjugation, DNA sequencing, and bioinformatic analysis. Major strains under study were multi drug resistant (MDR), resistant to three or more functional classes of drugs simultaneously-98.9 % K. pneumoniae, 100 % P. mirabilis, one E. aerogenes isolate, and one E. cloacae isolate. Molecular-genetic mechanism of MDR in K. pneumoniae and P. mirabilis isolates were based on carrying of epidemic extended-spectrum beta-lactamase bla CTX-M-15 gene (87.2 and 90.6 % accordingly), carbapenemase bla OXA-48-like gene (55.3 and 23.3 % accordingly), and class 1 (54.8 and 31.3 % accordingly) and class 2 (90.6 % P. mirabilis) integrons. The bla OXA-48-like-positive K. pneumoniae were collected during whole two-year surveillance period, while P. mirabilis and Enterobacter spp. carrying bla OXA-48-like genes were detected only after four and 18 months after the research start, respectively. The bla OXA-48-like gene acquisition was shown for P. mirabilis isolates collected from five patients and for E. cloacae isolate collected from one patient during their stay in the ICU, presumably from bla OXA-48-like-positive K. pneumoniae. The source of the bla OXA-244 gene acquired by E
International Nuclear Information System (INIS)
Tahmasebi, Elham; Yamini, Yadollah
2012-01-01
Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe 3 O 4 -Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: ► A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. ► Silver was coated on Fe 3 O 4 nanoparticles (MNPs) by reduction of AgNO 3 with NaBH 4 . ► Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. ► Size, morphology, composition and properties of the nanoparticles were characterized. ► Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe 3 O 4 nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 °C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 μL of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05–100 μg L −1 (R 2 > 0.9980) and the LODs (S/N = 3) were obtained in the range of 0.02–0.10 μg L −1 . Relative standard deviations (RSDs) for intra- and inter-day precision were 2.6–4.2% and 3.6–8
International Nuclear Information System (INIS)
Ageyev, V.A.; Sajeniouk, A.D.
2005-01-01
Routine analytical procedures have been developed for the reliable simultaneous determination of 90 Sr, 238 Pu, 239+240 Pu, 241 Am and 242-244 Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90 Sr in a Mineral Matrix' and 'Proficiency Test for 239 Pu, 241 Pu and 241 Am Measurement in a Mineral Matrix' accuracy and precision for 90 Sr, 239 Pu and 241 Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)
International Nuclear Information System (INIS)
Reber, E.L.; Gehrke, R.J.; Aryaeinejad, R.; Hartwell, J.K.
2005-01-01
Gamma-ray spectrometry measurements have been made of the fission yields of selected γ -rays emitted by the spontaneously fissioning isotopes 252 Cf and 244 Cm. The measured γ-rays were selected based on their relative abundance in the spectrum and their freedom from interference or, in a few instances, ease of interference correction. From these data and the cumulative and independent yield data of England and Rider, those γ-rays that are primarily produced by radioactive decay, as opposed to direct yield, were converted into the decays per spontaneous fission expressed in percent and compared to cumulative yield values of England and Rider. For those γ-rays whose production is dominated by direct (independent) yield, the ratio of γ-rays per spontaneous fission is reported. The γ-ray yield can be compared to the independent yield values of England and Rider when 100% of the direct feeding passes through the γ-ray. In those cases where both cumulative and independent yields contribute to the observed γ-ray emission rate, a direct comparison is not possible but a method to quantify the contribution from each is proposed. (author)
Qureshi, Muhammad A; Robbie, Scott J; Hengerer, Fritz H; Auffarth, Gerd U; Conrad-Hengerer, Ina; Artal, Pablo
2018-03-01
To determine safety and visual outcomes in eyes with age-related macular degeneration (AMD) implanted with a novel intraocular lens (IOL) that delivers an optimized retinal image to all macular areas within 10 degrees of retinal eccentricity. This was a consecutive case series of 244 eyes with dry/stable wet AMD and logMAR visual acuity ≥0.3 implanted with iolAMD Eyemax mono TM (London Eye Hospital Pharma), a single-piece, injectable, hydrophobic acrylic IOL sited in the capsular bag. Primary outcome was safety. Secondary outcomes were changes in corrected distance visual acuity (CDVA) and corrected near visual acuity (CNVA) (logMAR). Mean age at surgery was 80 years. Mean duration of follow-up was 3 months (range 1-16 months). No eyes had worsening of CDVA. Frequency of perioperative complications was equivalent to standard IOL implantation. Postoperative refractive outcomes were within ±1 D of the target refraction in 88% of cases. Mean preoperative CDVA improved from 1.06 to 0.71 postoperatively (mean of differences -0.35; 95% confidence interval [CI] -0.3886 to -0.3223; p<0.0001), equating to an approximate Early Treatment Diabetic Retinopathy Study gain of 18 letters. Mean preoperative CNVA (N-point; logMAR conversion) improved from 1.36 to 0.88 postoperatively (mean of differences -0.48; 95% CI -0.53 to -0.44; p<0.0001). This novel IOL appears safe in the short to medium term. Improvements in postoperative CDVA and CNVA exceed those observed with standard implants.
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
DEFF Research Database (Denmark)
Duijkers, Ingrid J M; Heger-Mahn, Doris; Drouin, Dominique
2015-01-01
OBJECTIVES: Progestogen-only pills (POPs) are safer with respect to cardiovascular risks than contraceptives containing estrogens. Despite the increased contraceptive efficacy of a desogestrel-only pill compared with a traditional POP, POPs are still not widely used due to an unpredictable bleeding...... pattern. A new POP containing 4 mg drospirenone has been developed with a 24/4 intake regimen which may improve the bleeding pattern. The objectives of this study were to investigate ovulation inhibition with the new drospirenone-only pill in comparison with the desogestrel-only pill and, in addition......, to assess the effects on cervical mucus permeability and bleeding. METHODS: Sixty-four healthy volunteers with proven ovulatory cycles were randomised and treated with either the drospirenone-only or the desogestrel-only pill during two 28-day cycles. Follicular diameter, endometrial thickness, and serum...
International Nuclear Information System (INIS)
Gates, J. M.; Duellmann, Ch. E.; Schaedel, M.; Ackermann, D.; Block, M.; Bruechle, W.; Essel, H. G.; Hartmann, W.; Hessberger, F. P.; Huebner, A.; Jaeger, E.; Khuyagbaatar, J.; Kindler, B.; Krier, J.; Kurz, N.; Lommel, B.; Schaffner, H.; Schausten, B.; Schimpf, E.; Steiner, J.
2011-01-01
Experiments with the new recoil separator, Transactinide Separator and Chemistry Apparatus (TASCA), at the GSI were performed by using beams of 48 Ca to irradiate targets of 206-208 Pb, which led to the production of 252-254 No isotopes. These studies allowed for evaluation of the performance of TASCA when coupled to a new detector and electronics system. By following these studies, the isotopes of element 114 ( 288-291 114) were produced in irradiations of 244 Pu targets with 48 Ca beams at compound nucleus excitation energies around 41.7 and 37.5 MeV, demonstrating TASCA's ability to perform experiments with picobarn-level cross sections. A total of 15 decay chains were observed and were assigned to the decay of 288-291 114. A new α-decay branch in 281 Ds was observed, leading to the new nucleus 277 Hs.
Ozadali-Sari, Keriman; Tüylü Küçükkılınç, Tuba; Ayazgok, Beyza; Balkan, Ayla; Unsal-Tan, Oya
2017-06-01
The present study describes the synthesis, pharmacological evaluation (BChE/AChE inhibition, Aβ antiaggregation, and neuroprotective effects), and molecular modeling studies of novel 2-[4-(4-substitutedpiperazin-1-yl)phenyl]benzimidazole derivatives. The alkyl-substituted derivatives exhibited selective inhibition on BChE with varying efficiency. Compounds 3b and 3d were found to be the most potent inhibitors of BChE with IC 50 values of 5.18 and 5.22μM, respectively. The kinetic studies revealed that 3b is a partial non-competitive BChE inhibitor. Molecular modeling studies also showed that the alkyl-substituted derivatives were able to reach the catalytic anionic site of the BChE. The compounds with an inhibitory effect on BChE were subsequently screened for their Aβ antiaggregating and neuroprotective activities. Compounds 3a and 3b exerted a potential neuroprotective effect against H 2 O 2 and Aβ-induced cytotoxicity in SH-SY5Y cells. Collectively, 3b was found as the most promising compound for the development of multi-target directed ligands against Alzheimer's disease. Copyright © 2017 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Sun Xiaobo; Zhao Junmei; Meng Shulan; Li Deqian
2005-01-01
Synergistic extraction and separation of yttrium (Y) from heavy rare earths (HRE) in chloride medium using mixture of sec-octylphenoxy acetic acid (CA-12, HA) and bis(2,4,4-trimethylpentyl)phosphinic acid (Cyanex272, HL) in n-heptane has been investigated. The synergistic enhancement coefficients, R max , were obtained for Ho 3+ (5.12), Y 3+ (5.34), Er 3+ (7.04), Tm 3+ (7.50), Yb 3+ (13.12) and Lu 3+ (17.58). The separation factors (SF) between Y 3+ and HRE were obtained, and it was found that Er 3+ would form the new complex as ErH 6 A 4 L 5 in the mixture system. A cation exchange mechanism was proposed. The equilibrium constant, formation constant and thermodynamic parameters such as ΔG = -18.48 kJ/mol, ΔH = -1.36 kJ/mol and ΔS = 0.058 kJ/mol were determined. The CA-12 and Cyanex272 mixture system showed higher extraction efficiency, larger separation factors as well as excellent stripping behaviors. The application potential of the mixture system to separate Y from HRE has been discussed
Energy Technology Data Exchange (ETDEWEB)
Holste, F; Haukap, C; Kameier, F
2000-07-10
The physical phenomena of rotary instabilities in industrial compressors and high-pressure aircraft compressors were investigated, which may be a cause of compressor blade fracture. The investigations were carried out by Duesseldorf Technical University on behalf of Rolls-Royce Deutschland GmbH at the new four-stage low-pressure compressor test stand of TU Dresden University. Extensive measurements were made both in the rotary and stationary system in the third compressor stage. Rotary instabilities could be detected by increasing the clearance between the blade tip and compressor wall. Modal analyses yielded a rate of about 30 for 63 blades, i.e. a characteristic wavelength of about twice the length of a blade. So far, an accurate description of the physical mechanism was impossible. Investigations using a Snubber model showed no significant influence on the rotary instabilities. [German] Im Turbotech II Forschungsvorhaben 1.244 wurden die physikalischen Vorgaenge der rotierenden Instabilitaet untersucht, die sowohl in industriellen Verdichtern als auch in Hochdruckverdichtern von Flugtriebwerken auftreten koennen. Diese Instabilitaeten stellen eine zusaetzliche Belastung fuer die Verdichterblaetter dar und koennen damit die Ursache fuer Blattbrueche sein. Im Auftrag von Rolls-Royce Deutschland wurden die Untersuchungen von der Faachhochschule Duesseldorf durchgefuehrt. Testobjekt war der neu aufgebaute vier stufige Niedergeschwindigkeitsverdichter der TU Dresden. In enger Kooperation mit den Vorhaben 1.243 und 1.246 wurden umfangreiche Messungen sowohl im rotierenden als auch im festen System an der dritten Stufe des Verdichters durchgefuehrt. Durch Vergroesserung des Spaltes zwischen Schaufelspitze und Verdichterwandung konnten rotierenden Instabilitaeten nachgewiesen werden. Modenanalysen ergaben Umfangsordnungen von ungefaehr 30 bei einer Blattzahl von 63, wodurch die charakteristische Wellenlaenge etwa zwei Schaufelwellenlaengen entspricht. Eine exakte
International Nuclear Information System (INIS)
Akhter, Nasima; Kinuya, Seigo; Nakajima, Kenichi; Shiba, Kazuhiro; Ogawa, Kazuma; Mori, Hirofumi
2007-01-01
Full text: In this study, (+)-enantiomer of radioiodinated 2-[4-(4- iodophenyl)piperidino]cyclohexanol ((+)-[ 125 I]-p- iodovesamicol) [(+)-[ 125 I]pIV], which is reported to bind with high affinity to the sigma-1 receptor both in vitro and in vivo, was tested to compare the in vivo characteristics between high and low specific activity (+)-[ 125 I]pIV to image sigma-1 receptor in the central nervous system. In the biodistribution study, no significant difference was observed between two methods. Accumulation of (+)- [ 125 I]pIV in rat brain was significant (approximately 3% of the injected dose) and its retention was prolonged. In the blocking study, the accumulation of (+)-[ 125 I] pIV in the rat brain was significantly reduced by the co-administration of sigma ligands such as pentazocine, haloperidol or SA4503 in both methods. But the blocking effect was relatively stronger in the study using high specific activity radioiodinated (+)pIV. Though, the distribution of high and low specific activity (+)-[ 125 I] pIV was more or less similar to bind to sigma-1 receptor in the central nervous system in vivo, high specific activity radioiodinated (+) pIV might have a better specificity to bind sigma-1 receptor in brain. (author)
International Nuclear Information System (INIS)
Louwrier, K.P.; Richter, K.
1976-01-01
During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Energy Technology Data Exchange (ETDEWEB)
Kunz, S.; Schmitz, H.J.; Schrenk, D. [Kaiserslautern Univ. (Germany). Dept. of Food Chemistry and Environmental Toxicology; Buchmann, A.; Schwarz, M. [Tuebingen Univ. (Germany). Inst. of Toxicology; Schilling, B.; Paepke, O. [ERGO Research, Hamburg (Germany); Robertson, L.W.; Lehmler, H.J. [Iowa Univ, Iowa City, IA (United States). Dept. of Occupational and Environmental Health
2004-09-15
Polychlorinated biphenyls (PCBs) are potent persistent environmental pollutants exhibiting neurotoxic, teratogenic and tumor-promoting effects in experimental animal models. PCB congeners can be divided into 'dioxin-like' and 'non-dioxin-like' congeners on the basis of their ability to act as aryl hydrocarbon receptor (AhR) agonists. Like the most toxic dioxin congener 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) 'dioxin-like' PCBs bind to the AhR and show characteristic effects on the expression of AhR-regulated genes including the induction of cytochrome P450 (CYP) 1A1. On the other hand, 'non-dioxin-like' PCB congeners have a lower or no binding affinity to the AhR, but exhibit a 'phenobarbital-type' induction of CYP 2B1/2 activity. The tumor-promoting potency of several PCBs has been demonstrated in two-stage initiation-promotion experiments in rat liver. Preneoplastic cell clones, targets for tumor promotion, can be identified as phenotypically altered foci showing characteristic enzyme patterns including the decreased activity of adenosine triphosphatase (ATPase) or the increased expression of the placental form of gluthatione S-transferase (GSTP). In the present study, the effect of the 'non-dioxin-like' 2,4,4'-trichlorobiphenyl (PCB 28) and 2,2',4,5,5'-pentachlorobiphenyl (PCB 101) on the promotion of enzyme-altered hepatic foci was investigated in female Wistar rats after initiation with diethylnitrosamine (DEN).
International Nuclear Information System (INIS)
Holcomb, H.P.
1993-01-01
The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively
2010-04-01
... applicable to the registrant. (b) GAAP. GAAP refers to generally accepted accounting principles in the United... prepared in accordance with non-U.S. generally accepted accounting principles, GAAP refers to the principles under which those primary financial statements are prepared; and (2) In the case of foreign...
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND...,000 per violation may be assessed. Each day a violation continues shall constitute a separate offense...
2010-10-01
..., consistent with the safety of the ship. (xxx) The Navy shall abide by the letter of the “Stranding Response... video (if available). Based on the information provided, NMFS shall determine if, and advise the Navy.../are dead), location, time of first discovery, observed behaviors (if alive), and photo or video (if...
2010-10-01
... operations (e.g., changes in personnel, track, bridges, or communication or signal systems; or use or... deflator formula) from time to time. Corporate culture means the totality of the commitments, written and... an amalgamation of operations, or by a railroad or a corporate parent of a Class I railroad taking...
2010-01-01
... affirming that he or she is a national of the designated foreign state. A personal interview before an... nationality. During this interview, the applicant may present any secondary evidence that he or she feels... appear for a scheduled interview, without good cause, will be deemed an abandonment of the application...
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
Flood, Margaret; McDonald, Susan J; Pollock, Wendy; Cullinane, Fiona; Davey, Mary-Ann
2018-05-22
Increasing incidence and severity of postpartum haemorrhage, together with postpartum haemorrhage-associated morbidities, have been reported in many high-resource countries. In-depth analysis of such factors in Victorian births since 2002 was lacking. Our aim was to determine the incidence and trends for primary postpartum haemorrhage (World Health Organization and International Classification of Diseases 10th revision, Australian Modification definitions) for all confinements in Victoria, Australia, for the years 2003-2013 and the incidence and trends for severe postpartum haemorrhage (≥1500 mL) for 2009-2013. In this population-based cross-sectional study de-identified data from the Victorian Perinatal Data Collection were analysed for confinements (excluding terminations) from 2003 to 2013 (n = 764 244). Perinatal information for all births ≥20 weeks (or of at least 400 g birthweight if gestation was unknown) were prospectively collected. One in five women (21.8%) who gave birth between 2009 and 2013 experienced a primary postpartum haemorrhage and one in 71 women (1.4%) experienced a severe primary postpartum haemorrhage. The increasing trends in incidence of primary postpartum haemorrhage, severe primary postpartum haemorrhage, blood transfusion, admission to an intensive care or high dependency unit and peripartum hysterectomy were significant (P primary postpartum haemorrhage. The highest incidence was experienced by women who had an unplanned caesarean section birth. Women who had a forceps birth had the highest incidence of severe primary postpartum haemorrhage. The incidence of primary postpartum haemorrhage, severe primary postpartum haemorrhage and associated maternal morbidities have increased significantly over time in Victoria. © 2018 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.
Identification of the new isotope sup 2 sup 4 sup 1 Bk
Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M
2003-01-01
A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
Publications | Page 244 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
A new window on the world for women. Jertrudes is a vendor in a small municipal market just off the main street in Manhiça, Mozambique. The single mother of eight begins her day at 4:00 a.m. By 6:30, she is standing in her market stall, waiting for the first customer of.
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Ma, Xiao-Hong; Zhao, Ling; Lin, Zhi-Rong; Dong, Yuan-Hua
2016-04-01
Detoxification by chemical oxidation of polychlorinated biphenyls (PCBs) in contaminated soils is very difficult and inefficient because PCBs typically associate with the solid phase or exist as non-aqueous-phase liquids due to their low solubility and slow desorption rates, and thus, they are difficult to remove from soils by using traditional, water-based elution techniques. Surfactant can enhance washing efficiency of PCBs from contaminated soils. This study used Brij 58, Brij 30, Tween 80, and 2-hydroxypropyl-β-cyclodextrin (HPCD) to solubilize 2,4,4'-trichlorodiphenyl (PCB28) from soil contaminated with capacitor oil into solution. The feasibility of PCB28 oxidation in soil washing wastewater through a Fe(3+)-catalyzed Fenton-like reaction was subsequently examined. Washing with 10 g L(-1) Brij 58 solution showed the highest extraction efficiency (up to 61.5 %) compared with that of the three other surfactants. The total concentration of PCB28 in contaminated soil at 25 °C after 48-h extraction was 286 mg L(-1). In contrast to conditions in which no washing agent was added, addition of the four washing agents decreased the efficiency of PCB28 degradation by the Fenton-like reaction, with the decrease due to addition of 10 g L(-1) Brij 58 solution being the smallest. The optimal concentration of H2O2 for preventing its useless decomposition was found to be 50 mM. The efficiency of PCB28 removal was lower when the initial concentration of PCB28 treated in the Fenton-like reaction was higher. The degradation efficiencies of PCB28 at initial concentrations of 0.1, 10, and 176 mg L(-1) in 10 g L(-1) Brij 58 solution at 25 °C and pH 3.0 and 9 h of reaction using 50 mM H2O2 were 64.1, 42.0, and 34.6 %, respectively. This result indicates that soil washing combined with Fenton-like oxidation may be a practical approach for the remediation of PCB-contaminated soil.
Human Diversity in a Cell Surface Receptor that Inhibits Autophagy.
Chaudhary, Anu; Leite, Mara; Kulasekara, Bridget R; Altura, Melissa A; Ogahara, Cassandra; Weiss, Eli; Fu, Wenqing; Blanc, Marie-Pierre; O'Keeffe, Michael; Terhorst, Cox; Akey, Joshua M; Miller, Samuel I
2016-07-25
Mutations in genes encoding autophagy proteins have been associated with human autoimmune diseases, suggesting that diversity in autophagy responses could be associated with disease susceptibility or severity. A cellular genome-wide association study (GWAS) screen was performed to explore normal human diversity in responses to rapamycin, a microbial product that induces autophagy. Cells from several human populations demonstrated variability in expression of a cell surface receptor, CD244 (SlamF4, 2B4), that correlated with changes in rapamycin-induced autophagy. High expression of CD244 and receptor activation with its endogenous ligand CD48 inhibited starvation- and rapamycin-induced autophagy by promoting association of CD244 with the autophagy complex proteins Vps34 and Beclin-1. The association of CD244 with this complex reduced Vps34 lipid kinase activity. Lack of CD244 is associated with auto-antibody production in mice, and lower expression of human CD244 has previously been implicated in severity of human rheumatoid arthritis and systemic lupus erythematosus, indicating that increased autophagy as a result of low levels of CD244 may alter disease outcomes. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
Liao, Hua-Xin; Tomaras, Georgia D.; Bonsignori, Mattia; Tsao, Chun-Yen; Hwang, Kwan-Ki; Chen, Haiyan; Lloyd, Krissey E.; Bowman, Cindy; Sutherland, Laura; Jeffries, Thomas L.; Kozink, Daniel M.; Stewart, Shelley; Anasti, Kara; Jaeger, Frederick H.; Parks, Robert; Yates, Nicole L.; Overman, R. Glenn; Sinangil, Faruk; Berman, Phillip W.; Pitisuttithum, Punnee; Kaewkungwal, Jaranit; Nitayaphan, Sorachai; Karasavva, Nicos; Rerks-Ngarm, Supachai; Kim, Jerome H.; Michael, Nelson L.; Zolla-Pazner, Susan; Santra, Sampa; Letvin, Norman L.; Harrison, Stephen C.
2013-01-01
An immune correlates analysis of the RV144 HIV-1 vaccine trial revealed that antibody responses to the gp120 V1/V2 region correlated inversely with infection risk. The RV144 protein immunogens (A244-rp120 and MN-rgp120) were modified by an N-terminal 11-amino-acid deletion (Δ11) and addition of a herpes simplex virus (HSV) gD protein-derived tag (gD). We investigated the effects of these modifications on gp120 expression, antigenicity, and immunogenicity by comparing unmodified A244 gp120 with both Δ11 deletion and gD tag and with Δ11 only. Analysis of A244 gp120, with or without Δ11 or gD, demonstrated that the Δ11 deletion, without the addition of gD, was sufficient for enhanced antigenicity to gp120 C1 region, conformational V2, and V1/V2 gp120 conformational epitopes. RV144 vaccinee serum IgGs bound more avidly to A244 gp120 Δ11 than to the unmodified gp120, and their binding was blocked by C1, V2, and V1/V2 antibodies. Rhesus macaques immunized with the three different forms of A244 gp120 proteins gave similar levels of gp120 antibody titers, although higher antibody titers developed earlier in A244 Δ11 gp120-immunized animals. Conformational V1/V2 monoclonal antibodies (MAbs) gave significantly higher levels of blocking of plasma IgG from A244 Δ11 gp120-immunized animals than IgG from animals immunized with unmodified A244 gp120, thus indicating a qualitative difference in the V1/V2 antibodies induced by A244 Δ11 gp120. These results demonstrate that deletion of N-terminal residues in the RV144 A244 gp120 immunogen improves both envelope antigenicity and immunogenicity. PMID:23175357
Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol
International Nuclear Information System (INIS)
Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.
1983-01-01
Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe
8 CFR 244.20 - Waiver of fees.
2010-01-01
... 103.7(b) which relate to applications to the district director or service center director for... expenditures, such as essential medical expenses, or expenses for clothing, laundry, and child care, to the... officer in support of a fee waiver request are subject to verification by the Service. (i) In requiring...
244-IJBCS-Article-Dr Obodai E A
African Journals Online (AJOL)
RHUMSIKI
differences among the biochemical compositions of the five fish species studied. Moisture content ranged .... grounds, fishing season, sex of the fish, feed intake and .... dry skim milk and calf's brain that are ... The Chemical Biology of. Fishes.
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
International Nuclear Information System (INIS)
Timofeev, G.A.; Kalygin, V.V.; Privalova, P.A.
1986-01-01
By molar ratios of 243 Cm mixture with 244 Cm and Pu nuclides formed as a result of Cm nuclides α-decay the 243 Cm half-life T α243 is determined. The 244 Cm half-life is measured earlier with high accuracy. The 243 Cm/ 244 Cm ratio measured by means of a mass spectrometer equals 0.989+-0.004. The obtained value T α243 =29.20+-0.14 years
Lortz, S; Lenzen, S; Mehmeti, I
2015-03-01
Disulfide bond formation during protein folding of nascent proteins is associated with the generation of H2O2 in the endoplasmic reticulum (ER). Approaches to quantifying H2O2 directly within the ER failed because of the oxidative environment in the ER lumen, and ER-specific catalase expression to detoxify high H2O2 concentrations resulted in an inactive protein owing to N-glycosylation. Therefore, the N-glycosylation motifs at asparagine-244 and -439 of the human catalase protein were deleted by site-directed mutagenesis. The ER-targeted expression of these variants revealed that the deletion of the N-glycosylation motif only at asparagine-244 (N244) was associated with the maintenance of full enzymatic activity in the ER. Expression of catalase N244 in the ER (ER-Catalase N244) was ER-specific and protected the cells significantly against exogenously added H2O2. With the expression of ER-Catalase N244, a highly effective H2O2 inactivation within the ER was achieved for the first time. Catalase has a high H2O2-inactivation capacity without the need of reducing cofactors, which might interfere with the ER redox homeostasis, and is not involved in protein folding. With these characteristics ER-Catalase N244 is an ideal tool to explore the impact of ER-generated H2O2 on the generation of disulfide bonds or to study the induction of ER-stress pathways through protein folding overload and accumulation of H2O2. Copyright © 2014 Elsevier Inc. All rights reserved.
Marr, Joachim; Huang, Zirong; Wang, Baoxi; Zhang, Hongyan; Roth, Katrin
2015-01-01
While combined oral contraceptives are a popular choice in developed Western countries, they are used by only 1% of women who are married or in a relationship in the People's Republic of China. The purpose of this review is to describe the efficacy and safety of the combined oral contraceptive containing ethinylestradiol (EE) 20 µg/drospirenone 3 mg taken in a 24/4 regimen (YAZ ® ; Bayer HealthCare Pharmaceuticals, Berlin, Germany) by Chinese women and to compare these results with those in women assessed in the international studies. Studies of EE 20 µg/drospirenone 3 mg in three different indications (contraception, acne, and premenstrual dysphoric disorder [PMDD]) have been conducted in Chinese women. The results of these three studies indicate that the EE 20 µg/drospirenone 3 mg combined oral contraceptive is a good long-term contraceptive option in Chinese women, providing 99% contraceptive protection over the observed 1-year treatment period, and additionally had a favorable effect on moderate acne vulgaris and relieved the symptoms of PMDD. The contraceptive efficacy, improvement in acne, and relief from PMDD symptoms observed in these studies did not differ from the effects observed in other international studies of EE 20 µg/drospirenone 3 mg, indicating that EE 20 µg/drospirenone 3 mg is as effective in Chinese women as in other ethnicities. Further, EE 20 µg/drospirenone 3 mg demonstrated a similar safety and tolerability profile in women enrolled in the Chinese and international trials, with no unexpected adverse events reported in any of the three Chinese trials. Overall, the efficacy, tolerability, and degree of non-contraceptive benefits with EE 20 µg/drospirenone 3 mg appear similar in Chinese women when compared with those reported in larger studies done at other international centers.
Jin, Huo-Xi; OuYang, Xiao-Kun; Hu, Zhong-Ce
2017-05-01
An effective epoxide hydrolase (EH) production strain was mutagenized using 60 Co gamma and UV irradiation. Among positive mutant strains, the EH activity of C2-44 reached 33.7 U/g, which was 267% as much as that of the original Aspergillus niger ZJB-09103. Compared with the wild type, there were significant changes in morphology for C2-44, including the color of mycelia on the slants and the shape of conidial head. In addition, glucose and soybean cake were the optimal carbon and nitrogen source in terms of EH activity for the mutant C2-44 instead of soluble starch and peptone for the wild-type strain. The reaction time required to reach 99% enantiomeric excesses of (S)-epichlorohydrin from racemic substrate was shortened significantly by the mutant C2-44. This phenomenon was probably explained by the higher V max for hydrolysis of racemic epichlorohydrin by C2-44 compared with Aspergillus niger ZJB-09103. © 2016 International Union of Biochemistry and Molecular Biology, Inc.
Structural studies of f-element complexes with soft donor extractants
International Nuclear Information System (INIS)
Jensen, Mark P.; Bond, Andrew H.; Nash, Kenneth L.
2000-01-01
To better understand the unique features and structural implications of An-soft donor interactions, we used solvent extraction, extended x-ray absorption fine structure (Exafs), and optical spectroscopy to study both the lanthanide and actinide complexes of a series of dialkylphosphinic acid extractants, bis(2,4,4-trimethylpentyl)phosphinic acid, bis(2,4,4-trimethylpentyl)monothiophosphinic acid, and bis(2,4,4- trimethylpentyl)dithiophosphinic acid, which are the primary components of the commercial extractants Cyanex 272, Cyanex 302, and Cyanex 301
Radioactivity studies. Progress report. Volume II
International Nuclear Information System (INIS)
Cohen, N.
1981-09-01
The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures
International Nuclear Information System (INIS)
Behrens, R.G.; Roth, S.B.; Jones, S.R.
1991-01-01
Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig
Lifescience Database Archive (English)
Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(
Indian Academy of Sciences (India)
x
what constitutes evidence of a new particle. Rita Bernabei of ... Women are poorly represented in physics, mak- ing up just 10% of ... at an experiment at one of America's highest- ... records to chart the careers of 57 postdoctoral ... nent northeastern public university, tried to ter- ... Schefer says that things will start to become.
Dark Galaxies and Lost Baryons (IAU S244)
Davies, Jonathan I.; Disney, Michael J.
2008-05-01
Preface; Conference prelims; The HI that barked in the night M. J. Disney; The detection of dark galaxies in blind HI surveys J. I. Davies; Red haloes of galaxies - reservoirs of baryonic dark matter? E. Zackrisson, N. Bergvall, C. Flynn, G. Ostlin, G. Micheva and B. Baldwell; Constraints on dark and visible mass in galaxies from strong gravitational lensing S. Dye and S. Warren; Lost baryons at low redshift S. Mathur, F. Nicastro and R. Williams; Observed properties of dark matter on small spatial scales R. Wyse and G. Gilmore; The mass distribution in spiral galaxies P. Salucci; Connecting lost baryons and dark galaxies via QSO absorption lines T. Tripp; ALFALFA: HI cosmology in the local universe R. Giovanelli; The ALFALFA search for (almost) dark galaxies across the HI mass function M. Haynes; HI clouds detected towards Virgo with the Arecibo Legacy Fast ALFA Survey B. Kent; Cosmic variance in the HI mass function S. Schneider; The Arecibo Galaxy Environments Survey - potential for finding dark galaxies and results so far R. Minchin et al.; Free-floating HI clouds in the M81 group E. Brinks, F. Walter and E. Skillman; Where are the stars in dark galaxies J. Rosenberg, J. Salzer and J. Cannon; The halo by halo missing baryon problem S. McGaugh; The local void is really empty R. Tully; Voids in the local volume: a limit on appearance of a galaxy in a dark matter halo A. Tikhonov and A. Klypin; Dim baryons in the cosmic web C. Impey; A census of baryons in galaxy clusters and groups A. Gonzalez, D. Zaritsky and A. Zabludo; Statistical properties of the intercluster light from SDSS image stacking S. Zibetti; QSO strong gravitational lensing and the detection of dark halos A. Maccio; Strong gravitational lensing: bright galaxies and lost dark-matter L. Koopmans; Mapping the distribution of luminous and dark matter in strong lensing galaxies I. Ferreras, P. Saha, L. Williams and S. Burles; Tidal debris posing as dark galaxies P. Duc, F. Bournaud and E. Brinks; Numerical simulation of the dwarf companions of giant galaxies A. Nelson and P. Williams; Delayed galaxies C. Struck, M. Hancock, B. Smith, P. Appleton, V. Charmandaris and M. Giroux; Probe of dark galaxies via disturbed/lopsided isolated galaxies I. Karachentsev, V. Karachentseva, W. Huchtmeier, D. Makarov and S. Kaisin; Star formation thresholds J. Schaye; Scaling relations of dwarf galaxies without supernova-driven winds K. Tassis, A. Kravtsov and N. Gnedin; Star formation in massive low surface brightness galaxies K. O'Neil; Linking clustering properties and the evolution of low surface brightness galaxies D. Bomans and S. Rosenbaum; Too small to form a galaxy: how the UV background determines the baryon fraction M. Hoeft, G. Yepes and S. Gottlober; Star formation in damped Lyman selected galaxies L. Christensen; Dark-matter content of early-type galaxies with planetary nebulae N. Napolitano et al.; Hunting for ghosts: low surface brightnesses from pixels R. Scaramella and S. Sabatini; Baryonic properties of the darkest galaxies E. Grebel; The dwarf low surface brightness population in different environments of the local universe S. Sabatini, J. Davies, S. Roberts and R. Scaramella; Mass modelling of dwarf spheroidal galaxies J. Klimentowski et al.; Evolution of dwarf galaxies in the Centaurus A Group L. Makarova and D. Makarov; A flat faint end of the Fornax cluster galaxy luminosity function S. Mieske, M. Hilker, L. Infante and C. Mendes de Oliveira; Can massive dark halos destroy the discs of dwarf galaxies? B. Fuchs and O. Esquivel; 'Dark galaxies' and local very metal-poor gas-rich galaxies: possible interrelations S. Pustilnik; Morphology and environment of dwarf galaxies in the local universe H. Ann; Arecibo survey of HI emission from disk galaxies at redshift z 0.2 B. Catinella, M. Haynes, J. Gardner, A. Connolly and R. Giovanelli; AGES observations of
Lifescience Database Archive (English)
Full Text Available vliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms... Frame A: vgkvliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms
29 CFR 1952.244 - Level of Federal enforcement.
2010-07-01
... OSHA authority to issue citations for violation of such standards under sections 5(a)(2) and 9 of the... proceedings in contested cases under section 10; to institute proceedings to correct imminent dangers under.... (b) In accordance with section 18(e), final approval relinquishes Federal OSHA authority only with...
Dietary Supplements and Young Teens: Misinformation and Access Provided by Retailers.
Herriman, Maguire; Fletcher, Laura; Tchaconas, Alexis; Adesman, Andrew; Milanaik, Ruth
2017-02-01
Despite the American Academy of Pediatrics' recommendations against pediatric use of creatine and testosterone boosters, research suggests that many young teenagers take these dietary supplements. Our objective was to determine to what extent health food stores would recommend and/or sell creatine and testosterone boosters to a 15-year-old boy customer. Research personnel posing as 15-year-old high school athletes seeking to increase muscle strength contacted 244 health food stores in the United States via telephone. Researchers asked the sales attendant what supplements he/she would recommend. If a sales attendant did not mention creatine or testosterone boosters initially, each of these supplements was then specifically asked about. Supplement recommendations were recorded. Sales attendants were also asked if a 15-year-old could purchase these products on his own in the store. A total of 67.2% (164/244) of sales attendants recommended creatine: 38.5% (94/244) recommended creatine without prompting, and an additional 28.7% (70/244) recommended creatine after being asked specifically about it. A total of 9.8% (24/244) of sales attendants recommended a testosterone booster. Regarding availability for sale, 74.2% (181/244) of sales attendants stated a 15-year-old was allowed to purchase creatine, whereas 41.4% (101/244) stated one could purchase a testosterone booster. Health food store employees frequently recommend creatine and testosterone boosters for boy high school athletes. In response to these findings, pediatricians should inform their teenage patients, especially athletes, about safe, healthy methods to improve athletic performance and discourage them from using creatine or testosterone boosters. Retailers and state legislatures should also consider banning the sale of these products to minors. Copyright © 2017 by the American Academy of Pediatrics.
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-420. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance. This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
Liu, Mei; Luo, Tao; Yang, Chongguang; Liu, Qingyun; Gao, Qian
2015-10-01
To identify a variable number of tandem repeats (VNTR) typing method that is suitable for molecular epidemiological study of tuberculosis in China. We systematically evaluated the commonly used VNTR typing methods, including 4 methods (MIRU-12, VNTR-15/VNTR-24 and VNTR "24+4") proposed by foreign colleagues and 2 methods (VNTR-L15 and VNTR"9+3") developed by domestic researchers using population-based collection of 891 clinical isolates from 5 provinces across the country. The order (from high to low) of discriminatory power for the 6 VNTR typing methods was VNTR"24+4", VNTR"9+3", VNTR-24, VNTR-15, VNTR-L15 and MIRU-12. The discriminatory power of VNTR"9+3" was comparable with VNTR"24+4" and higher than that of VNTR-15/24. The concordance for defining clustered and unique genotypes between VNTR"9+3" and VNTR"24+4" was 96.59%. Our results suggest that VNTR"9+3" is a suitable method for molecular typing of M. tuberculosis in China by considering its high discriminatory power, high consistency with VNTR"24+4" and relative small number of VNTR locus.
Synthesis, Structure, and Fluorescence of a Novel Cadmium Compound
Yao, Zhong-Liang; Chen, Wen-Tong
2017-12-01
A novel cadmium compound, [(CdI3)2(μ2-I)]2(Me2-4,4'-H2bipy)3 (1) (Me = methyl; 4,4'-bipy = 4,4'-bipyridine) with the Me2-4,4'-H2bipy moiety generated in situ, has been prepared through a solvothermal reaction and structurally characterized by X-ray single crystal diffraction analysis. Compound 1 is characterized by an isolated structural motif, consisting of [(CdI3)2(μ2-I)]3- anions and Me2-4,4'-H2bipy2+ cations. The [(CdI3)2(μ2-I)]3- anions and Me2-4,4'-H2bipy2+ cations interconnect together via C-H···I hydrogen-bonding interactions to complete a three-dimensional (3D) supramolecular network. Solid state fluorescent spectrum reveals an emission band in the violet region.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Homi Bhabha Centre for Science Education: Admission to PhD Programme in Science Education - 2018 · More Details Abstract Fulltext PDF. pp 244-244 Information and Announcements. Physics Training and Talent Search · More Details Abstract Fulltext PDF. pp 245-245 Flowering Trees. Gymnosporia montana Benth.
A 31-residue peptide induces aggregation of tau's microtubule-binding region in cells
Stöhr, Jan; Wu, Haifan; Nick, Mimi; Wu, Yibing; Bhate, Manasi; Condello, Carlo; Johnson, Noah; Rodgers, Jeffrey; Lemmin, Thomas; Acharya, Srabasti; Becker, Julia; Robinson, Kathleen; Kelly, Mark J. S.; Gai, Feng; Stubbs, Gerald; Prusiner, Stanley B.; Degrado, William F.
2017-09-01
The self-propagation of misfolded conformations of tau underlies neurodegenerative diseases, including Alzheimer's. There is considerable interest in discovering the minimal sequence and active conformational nucleus that defines this self-propagating event. The microtubule-binding region, spanning residues 244-372, reproduces much of the aggregation behaviour of tau in cells and animal models. Further dissection of the amyloid-forming region to a hexapeptide from the third microtubule-binding repeat resulted in a peptide that rapidly forms fibrils in vitro. We show that this peptide lacks the ability to seed aggregation of tau244-372 in cells. However, as the hexapeptide is gradually extended to 31 residues, the peptides aggregate more slowly and gain potent activity to induce aggregation of tau244-372 in cells. X-ray fibre diffraction, hydrogen-deuterium exchange and solid-state NMR studies map the beta-forming region to a 25-residue sequence. Thus, the nucleus for self-propagating aggregation of tau244-372 in cells is packaged in a remarkably small peptide.
Erwinia teleogrylli sp. nov., a Bacterial Isolate Associated with a Chinese Cricket.
Directory of Open Access Journals (Sweden)
Bo Liu
Full Text Available A bacterial isolate (SCU-B244T was obtained in China from crickets (Teleogryllus occipitalis living in cropland deserted for approximately 10 years. The isolated bacteria were Gram-negative, facultatively anaerobic, oxidase-negative rods. A preliminary analysis of the 16S rRNA gene sequence indicated that the strain belongs to either the genus Erwinia or Pantoea. Analysis of multilocus sequence typing based on concatenated partial atpD, gyrB and infB gene sequences and physiological and biochemical characteristics indicated that the strain belonged to the genus Erwinia, as member of a new species as it was distinct from other known Erwinia species. Further analysis of the 16S rRNA gene showed SCU-B244T to have 94.71% identity to the closest species of that genus, Erwinia oleae (DSM 23398T, which is below the threshold of 97% used to discriminate bacterial species. DNA-DNA hybridization results (5.78±2.52% between SCU-B244T and Erwinia oleae (DSM 23398T confirmed that SCU-B244T and Erwinia oleae (DSM 23398T represent different species combined with average nucleotide identity values which range from 72.42% to 74.41. The DNA G+C content of SCU-B244T was 55.32 mol%, which also differs from that of Erwinia oleae (54.7 to 54.9 mol%. The polyphasic taxonomic approach used here confirmed that the strain belongs to the Erwinia group and represents a novel species. The name Erwinia teleogrylli sp. nov. is proposed for this novel taxon, for which the type strain is SCU-B244T (= CGMCC 1.12772T = DSM 28222T = KCTC 42022T.
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Characterization of a Viking Blade Fabricated by Traditional Forging Techniques
Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.
2016-12-01
A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
48 CFR 52.244-6 - Subcontracts for Commercial Items.
2010-10-01
... clauses in subcontracts for commercial items: (i) 52.203-13, Contractor Code of Business Ethics and.... (e) To the maximum extent practicable, when the Contractor acts as a purchasing agent for the Government with respect to a purchase that exceeds the simplified acquisition threshold, the Contractor shall...
18 CFR 367.2440 - Account 244, Derivative instrument liabilities.
2010-04-01
..., Derivative instrument liabilities. This account must include the change in the fair value of all derivative instrument liabilities not designated as cash flow or fair value hedges. Account 426.5, Other deductions... the fair value of the derivative instrument. ...
40 CFR 98.244 - Monitoring and QA/QC requirements.
2010-07-01
... NIST Handbook 44 (2009) (incorporated by reference, see § 98.7) or follow procedures specified by the... Natural Gas by Gas Chromatography (incorporated by reference, see § 98.7). (ii) ASTM D6060-96 (Reapproved..., Other Hydrocarbons, and Carbon Dioxide in High-Purity Ethylene by Gas Chromatography (incorporated by...
All projects related to | Page 244 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-02-07
Research aimed at policymakers in Ukraine, Russia, and Belarus will highlight how tobacco taxation policies can serve public health goals and reduce the burden of tobacco-related diseases and deaths. Start Date: February 7, 2012. End Date: March 12, 2013. Topic: TOBACCO, SMOKING, TAXATION, PUBLIC HEALTH.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Physics Training and Talent Search. Information and Announcements Volume 23 Issue 2 February 2018 pp 244-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/023/02/0244-0244. Abstract ...
Indian Academy of Sciences (India)
Plant Pathology
Supplementary data: Table 1. Identification of various virulence factors in R. solanacearum: Rs-09-161, Rs-10-244, GMI1000. Gene name Rs-09-161 locus tag*. Accession no. Rs-10-244 locus tag*. Accesion no. GMI1000 locus tag. Location. Gene description. Exopolysacharide. epsA. RALSO161_m00209880 KY661391 ...
Applications of Text Analysis Tools for Spoken Response Grading
Crossley, Scott; McNamara, Danielle
2013-01-01
This study explores the potential for automated indices related to speech delivery, language use, and topic development to model human judgments of TOEFL speaking proficiency in second language (L2) speech samples. For this study, 244 transcribed TOEFL speech samples taken from 244 L2 learners were analyzed using automated indices taken from…
African Journals Online (AJOL)
Items 201 - 244 of 244 ... ... The incidence of external male genital defects in Enugu State of Nigeria: an estimate based on the prevalence among secondary school students, Abstract. Oyiogu FN Ozoemena, Anthony U Mbah. Vol 23, No 1-4 (2011), The mind is sick, the body cries out: a review of childhood conversion disorder ...
DEFF Research Database (Denmark)
Christiansen, Christian O.; Cockburn, Patrick Joseph
2014-01-01
Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk).......Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk)....
Morgan, P. E. D.; Ratto, J. J.; Housley, R. M.; Porter, J. R.
1988-01-01
EDXS performed on isolated particles of the Bi-Ca-Sr-Cu-O high-temperature ceramic superconductor has verified the presence of significant elemental exchange between the Ca and Sr, and, to a lesser extent, between Cu and Bi. Two primary preparations, identified as primarily 24.4 A and 30.6 A, respectively, are identified. The Cu:Bi ratio in the 30.6 A material is approximately 1:1 for most particles, although only a few particles of the nominally 24.4 A material have the expected 1:2 ratio. No unequivocal assignment of atomic composition to the predominantly 24.4 A or 30.6 A appears possible, if major syntactic problems are present.
Syntactic intergrowth problems with BCSCO and fabrication difficulties therefrom
International Nuclear Information System (INIS)
Morgan, P.E.D.; Ratto, J.J.; Housley, R.M.; Porter, J.R.
1988-01-01
EDXS performed on isolated particles of the Bi-Ca-Sr-Cu-O high-temperature ceramic superconductor has verified the presence of significant elemental exchange between the Ca and Sr, and, to a lesser extent, between Cu and Bi. Two primary preparations, identified as primarily 24.4 A and 30.6 A, respectively, are identified. The Cu:Bi ratio in the 30.6 A material is approximately 1:1 for most particles, although only a few particles of the nominally 24.4 A material have the expected 1:2 ratio. No unequivocal assignment of atomic composition to the predominantly 24.4 A or 30.6 A appears possible, if major syntactic problems are present. 22 references
Energy Technology Data Exchange (ETDEWEB)
Zhao, Qing; Li, Chuanyong; Li, Shu Jie, E-mail: shujieli@nankai.edu.cn
2015-01-02
Highlights: • The α-helical content of the C-terminus is decreased with a pH increase. • The thermostability of the C-terminus is decreased with a pH increase. • Zn{sup 2+} binds to His{sup 244} and His{sup 266} residues within the C-terminal domain. • The binding of Zn{sup 2+} to His{sup 244} residue is an endothermic heat reaction. • The binding of Zn{sup 2+} to His{sup 266} residue is an exothermic heat reaction. - Abstract: The voltage-gated proton channel Hv1 is strongly sensitive to Zn{sup 2+}. The H{sup +} conduction is decreased at a high concentration of Zn{sup 2+} and Hv1 channel closing is slowed by the internal application of Zn{sup 2+}. Although the recent studies demonstrated that Zn{sup 2+} interacts with the intracellular C-terminal domain, the binding sites and details of the interaction remain unknown. Here, we studied the pH-dependent structural stability of the intracellular C-terminal domain of human Hv1 and showed that Zn{sup 2+} binds to His{sup 244} and His{sup 266} residues. The thermodynamics signature of Zn{sup 2+} binding to the two sites was investigated by isothermal titration calorimetry. The binding of Zn{sup 2+} to His{sup 244} (mutant H266A) and His{sup 266} (mutant H244A) were an endothermic heat reaction and an exothermic heat reaction, respectively.
International Nuclear Information System (INIS)
Paul, M.; Valenta, A.; Ahman, I.
2005-01-01
Short-lived radionuclides with halflives of a few 10 7 years, now-extinct in the solar system, are expected to be present in the interstellar medium (ISM) as freshly synthesized matter in supermovae. Grains of ISM origin recently discovered in the inner solar system and at Earth orbit may accrete onto Earth after ablation in the atmosphere. As pointed out by one of the authors (K.S.) in 1974, a favorable matrix of detection of such extraterrestrial material is deep-sea sediments with very low sedimentation rates of ∼1 mm.ky -1 . We report here a search for the 'live' Pu-244 in a 1 kg-deep-sea dry sediment collected in 1992 in the North Pacific. After a 546 day a-counting of a Pu fraction chemically separated from the alkaline-fused sediment sample at Kanazawa Univ. AMS analysis was performed at Hebrew Univ. and Weizmann Institute. Only one count of Pu-244 with no background ions was detected, indicating no excess over the expected stratospheric man-made fallout. A limit of 0.2 Pu-244 atoms cm -2 .y -1 for extra terrestrial deposition was set under reasonable assumptions and it was then concluded from this result and the available data on ISM that the abundance of Pu-244 in the ISM is less than 2 X 10 -11 g-Pu-244 (g ISM) -1 . Implications of the present result will be discussed.
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-01-15
POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007.
Directory of Open Access Journals (Sweden)
Nigel J Dimmock
Full Text Available Influenza A viruses are a major cause of morbidity and mortality in the human population, causing epidemics in the winter, and occasional worldwide pandemics. In addition there are periodic outbreaks in domestic poultry, horses, pigs, dogs, and cats. Infections of domestic birds can be fatal for the birds and their human contacts. Control in man operates through vaccines and antivirals, but both have their limitations. In the search for an alternative treatment we have focussed on defective interfering (DI influenza A virus. Such a DI virus is superficially indistinguishable from a normal virus but has a large deletion in one of the eight RNAs that make up the viral genome. Antiviral activity resides in the deleted RNA. We have cloned one such highly active DI RNA derived from segment 1 (244 DI virus and shown earlier that intranasal administration protects mice from lethal disease caused by a number of different influenza A viruses. A more cogent model of human influenza is the ferret. Here we found that intranasal treatment with a single dose of 2 or 0.2 µg 244 RNA delivered as A/PR/8/34 virus particles protected ferrets from disease caused by pandemic virus A/California/04/09 (A/Cal; H1N1. Specifically, 244 DI virus significantly reduced fever, weight loss, respiratory symptoms, and infectious load. 244 DI RNA, the active principle, was amplified in nasal washes following infection with A/Cal, consistent with its amelioration of clinical disease. Animals that were treated with 244 DI RNA cleared infectious and DI viruses without delay. Despite the attenuation of infection and disease by DI virus, ferrets formed high levels of A/Cal-specific serum haemagglutination-inhibiting antibodies and were solidly immune to rechallenge with A/Cal. Together with earlier data from mouse studies, we conclude that 244 DI virus is a highly effective antiviral with activity potentially against all influenza A subtypes.
Properties of the transitions populating and depopulating the 279 keV level in /sup 75/As
Energy Technology Data Exchange (ETDEWEB)
Puri, V S; Khurana, C S; Sahota, H S [Punjabi Univ., Patiala (India). Nuclear Science Labs.
1977-09-01
The low-energy gamma-ray spectrum of /sup 75/As from /sup 75/Sc has been investigated using a 6 mm x 6 mm Si(Li) spectrometer. The intensity of the 24.4 keV transition has been found to be 0.07 +- 0.01. No evidence has been found for the presence of a 14.9 keV transition. From directional correlation measurements involving the 24.4 keV transition detected in the Si(Li) detector, the multipolarity of this transition has been found to be delta(E3/M2)sub(24.4) =0.18 +- 0.02. The internal conversion process of the 279 keV transition seems to be normal. No effect of the chemical environment has been observed on the (121 ..gamma..-279..gamma..) directional correlation coefficients.
People and things. CERN Courier, May 1984, v. 24(4)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1984-05-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The peak energy collision energy in the PETRA electron-positron ring at the German DESY Laboratory continues to be nudged higher. One of the talking points at last summer's conferences was a new measurement of the mass of the F meson by the CLEO group at the CESR electron-positron ring at Cornell, USA. The CERN Accelerator School, the European Committee for Future Accelerators (ECFA) and the Italian INFN are organizing a workshop on the generation of high fields for particle acceleration to very high energies, to be held at Frascati from 25 September to 1 October. From 23 June to 13 July, a meeting is being organized at Snowmass (Colorado) for the US high energy physics community to help contribute towards the definition of the proposed Superconducting Super Collider (SSC)
Process for the recovery of curium-244 from nuclear waste
International Nuclear Information System (INIS)
Posey, J.C.
1980-10-01
A process has been designed for the recovery of curium from purex waste. Curium and americium are separated from the lanthanides by a TALSPEAK extraction process using differential extraction. Equations were derived for the estimation of the economically optimum conditions for the extraction using laboratory batch extraction data. The preparation of feed for the extraction involves the removal of nitric acid from the Purex waste by vaporization under reduced pressure, the leaching of soluble nitrates from the resulting cake, and the oxalate precipitation of a pure lanthanide-actinide fraction. Final separation of the curium from americium is done by ion-exchange. The steps of the process, except ion-exchange, were tested on a laboratory scale and workable conditions were determined
Fuzzy Itand#244; Integral Driven by a Fuzzy Brownian Motion
Directory of Open Access Journals (Sweden)
Didier Kumwimba Seya
2015-11-01
Full Text Available In this paper we take into account the fuzzy stochastic integral driven by fuzzy Brownian motion. To define the metric between two fuzzy numbers and to take into account the limit of a sequence of fuzzy numbers, we invoke the Hausdorff metric. First this fuzzy stochastic integral is constructed for fuzzy simple stochastic functions, then the construction is done for fuzzy stochastic integrable functions.
People and things. CERN Courier, May 1984, v. 24(4)
International Nuclear Information System (INIS)
Anon.
1984-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The peak energy collision energy in the PETRA electron-positron ring at the German DESY Laboratory continues to be nudged higher. One of the talking points at last summer's conferences was a new measurement of the mass of the F meson by the CLEO group at the CESR electron-positron ring at Cornell, USA. The CERN Accelerator School, the European Committee for Future Accelerators (ECFA) and the Italian INFN are organizing a workshop on the generation of high fields for particle acceleration to very high energies, to be held at Frascati from 25 September to 1 October. From 23 June to 13 July, a meeting is being organized at Snowmass (Colorado) for the US high energy physics community to help contribute towards the definition of the proposed Superconducting Super Collider (SSC)
40 CFR 421.244 - Standards of performance for new sources.
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Nickel... all times. (c) Acid reclaim leaching belt filter backwash. NSPS for the Secondary Nickel Subcategory...
Determination of 241Am and 244Cm in environmental samples
International Nuclear Information System (INIS)
Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.
1998-01-01
The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)
Poweo 2006 consolidated revenue at euro 244 million, up 121%
International Nuclear Information System (INIS)
2007-01-01
POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007
The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests
International Nuclear Information System (INIS)
Raoelina Andriambololona
1976-01-01
Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr
Tributyltin disrupts feeding and energy metabolism in the goldfish (Carassius auratus).
Zhang, Jiliang; Sun, Ping; Yang, Fan; Kong, Tao; Zhang, Ruichen
2016-06-01
Tributyltin (TBT) can induce obesogen response. However, little is known about the adverse effects of TBT on food intake and energy metabolism. The present study was designed to investigate the effects of TBT, at environmental concentrations of 2.44 and 24.4 ng/L (1 and 10 ng/L as Sn), on feeding and energy metabolism in goldfish (Carassius auratus). After exposure for 54 d, TBT increased the weight gain and food intake in fish. The patterns of brain neuropeptide genes expression were in line with potential orexigenic effects, with increased expression of neuropeptide Y and apelin, and decreased expression of pro-opiomelanocortin, ghrelin, cocaine and amphetamine-regulated transcript, and corticotropin-releasing factor. Interestingly, the energy metabolism indicators (oxygen consumption, ammonia exertion and swimming activity) and the serum thyroid hormones were all significantly increased at the 2.44 ng/L TBT group in fish. However, no changes of energy metabolism indicators or a decrease of thyroid hormones was found at the 24.4 ng/L TBT group, which indicated a complex disrupting effect on metabolism of TBT. In short, TBT can alter feeding and energy metabolism in fish, which might promote the obesogenic responses. Copyright © 2016 Elsevier Ltd. All rights reserved.
Kassam, H; Tzortziou Brown, V; O'Halloran, P; Wheeler, P; Fairclough, J; Maffulli, N; Morrissey, D
2014-12-01
Sport and exercise medicine (SEM) aims to manage sporting injuries and promote physical activity. This study explores general practitioners' (GPs) awareness, understanding and utilisation of their local SEM services. A questionnaire survey, including patient case scenarios, was administered between February and May 2011. 693 GPs working in Cardiff and Vale, Leicester and Tower Hamlets were invited to participate. 244 GPs responded to the questionnaire (35.2% response rate). Less than half (46%; 112/244) were aware of their nearest SEM service and only 38% (92/244) had a clear understanding on referral indications. The majority (82%; 199/244) felt confident advising less active patients about exercise. There were divergent management opinions about the case scenarios of patients who were SEM referral candidates. Overall, GPs were significantly more likely to refer younger patients and patients with sport-related problems rather than patients who would benefit from increasing their activity levels in order to prevent or manage chronic conditions (pHealth Service which may be resulting in suboptimal utilisation especially for patients who could benefit from increasing their activity levels. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Very Small Satellite Design for Space Sensor Networks
2008-06-01
Literature Review 25 Clyde Space Power Pumpkin Computer Microhard Comm SSTL GPS User Payload Pumpkin Structure Figure 2-10. CUTE-I CubeSat [69...Structure Pumpkin [244] Skeletonized 155 $1,350* $810* EPS Clyde Space [245] CubeSat EPS 310 $25,240* $19,252* DH Pumpkin [244] FM430 90 $1,200* $720...satellite miniaturisation since 1993 and probably before. Furthermore, the term itself has been diluted from the pure literal form, eventually
Report to the DOE Nuclear Data Committee, 1983
International Nuclear Information System (INIS)
Haight, R.C.; Struble, G.L.
1983-02-01
Measurements for nuclear data applicactions are described including branching ratio in 7 Be decay, kerma factor for carbon, photoneutron cross sections, neutron differential scattering cross sections, half-life of 77 Kr, stellar neutron capture rates for 86 87 88 Sr, neutron total cross sections, 142 143 144 Nd neutron capture nucleo-synthesis, half-life of 163 Ho, thermal neutron fission of 236 Np, revised branching ratios in 237 U and 238 Pu decays, and levels of 244 Cm populated by the beta decay of 10-hour 244 Am and 26-minute /sup 244m/Am. Calculations discussed include systematic test of microscopic optical models for nucleon scattering in the range 7 to 60 MeV, Lanczos method shell-model calculations of GamowTeller strength functions, explosive nucleosynthesis and direct radiative capture rates, and calculation of fission cross sections. Evaluated data libraries are briefly discussed
The biokinetics and radiotoxicology of curium: A comparison with americium
Energy Technology Data Exchange (ETDEWEB)
Menetrier, F. [CEA, Fontenay-aux-Roses (France); Taylor, D.M. [School of Chemistry, Cardiff University, Cardiff CF10 3AT (United Kingdom)], E-mail: davtay@btinternet.com; Comte, A. [CEA, Fontenay-aux-Roses (France)
2008-05-15
The human and animal data on the biokinetics of {sup 242}Cm and {sup 244}Cm are reviewed and shown to be very similar to those for {sup 241}Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with {sup 241}Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited {sup 244}Cm. The use of chelating agents for the treatment of accidental contamination of the human body with {sup 242,244}Cm is also discussed.
Curry, B. B.
2014-12-01
Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents
Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser
DEFF Research Database (Denmark)
Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm
2003-01-01
Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....
Golden Eagle mortality at a utility-scale wind energy facility near Palm Springs, California
Lovich, Jeffrey E.
2015-01-01
Golden Eagle (Aquila chrysaetos) mortality associated with wind energy turbines and infrastructure is under-reported and weakly substantiated in the published literature. I report two cases of mortality at a utility-scale renewable energy facility near Palm Springs, California. The facility has been in operation since 1984 and included 460 65KW turbines mounted on 24.4 m or 42.7 m lattice-style towers with 8 m rotor diameters. One mortality event involved a juvenile eagle that was struck and killed by a spinning turbine blade on 31 August, 1995. The tower was 24.4 m high. The other involved an immature female that was struck by a spinning blade on another 24.4 m tower on 17 April, 1997 and was later euthanized due to the extent of internal injuries. Other raptor mortalities incidentally observed at the site, and likely attributable to turbines, included three Red-tailed Hawks (Buteo jamaicensis) found near turbines.
ORF Alignment: NC_002935 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available QETYLKHLKGAVPRSLEGITVVVDC 180 ... Query: 244 XXXXRCLAVDAEGNVVDGDQIMAILALAMKENGELHKSTLVATVMSNLGLRLAMKEAGIE 303 ... ... ... RCLAVDAEGNVVDGDQIMAILALAMKENGELHKSTLVATVMSNLGLRLAMKEAGIE Sbjct: 241 GDADRCLAVDAEGNVVDGDQIMAILA
Poly[bis(μ2-4,4′-bipyridinebis(3-nitrobenzoatocobalt(II
Directory of Open Access Journals (Sweden)
Pei-Hsuan Chiang
2009-11-01
Full Text Available The hydrothermal reaction of cobalt nitrate with 4,4′-bipyridine and 3-nitrobenzoic acid lead to the formation of the title complex, [Co(C7H4NO42(C10H8N22]n. In the crystal structure, the CoII atoms are coordinated by two terminal carboxylate anions and four 4,4′-bipyridine ligands within slightly distorted octahedra. The CoII atom and one of the two independent 4,4′-bipyridine ligands are located on a twofold rotation axis, while the second independent 4,4′-bipyridine molecule is located on a centre of inversion. One of the two rings of one 4,4′-bipyridine ligand is disordered over two orientations and was refined using a split model [occupancy ratio 0.68 (2:0.32 (2]. The CoII atoms are connected by the 4,4′-bipyridine ligands into layers, which are located parallel to the ab plane.
Radiochemical studies of neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Moeser, Christina
2010-01-01
The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.
ORF Alignment: NC_004917 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EAITQFADKYLMHGGTIEEVKEKIA 180 ... Query: 244 LDVEVSKYDYSVSNRGLRSNLVGTAKQVAQRIKAYEEAGLNLLIVQCAPMKEELERIAKE 303 ... ... ... LDVEVSKYDYSVSNRGLRSNLVGTAKQVAQRIKAYEEAGLNLLIVQCAPMKEELERIAKE Sbjct: 241 LDVEVSKYDYSVSNRGLRSNLVGTAKQVAQRIKAYEEAGLNLLIVQCAPMKEELERIAKE 300 ...
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 75 ... Query: 185 FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 244 ... ... FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP Sbjct: 1 ... FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 60 ...
Indian Academy of Sciences (India)
2. 2.92. 2.44. 1.25. 2.54. 3.66. C57B3. 2.97. 2.44. 1.25. 2.54. 3.49. C60. LiAlH4. 2.91. 2.60. 1.64. 2.36. 3.37. C59B. 2.76. 2.63. 1.63. 2.36. 3.47. C58B2. 2.80. 2.64. 1.65. 2.32. 3.49. C57B3. 2.72. 2.61. 1.64. 2.32. 3.47. C60. LiBH4. 2.20. 2.20. 1.26.
Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force
International Nuclear Information System (INIS)
Girod, M.; Delaroche, J.P.; Romain, P.; Libert, J.
2002-01-01
The structure properties of the even-even nuclei 226, 228, 230, 232, 234 Th, 230, 232, 234, 236, 238, 240 U, 240, 242, 244, 246 Pu, and 242, 244, 246, 248 Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)
Directory of Open Access Journals (Sweden)
Cristina Femoni
2016-10-01
Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available THASGASHRLASNERLEFLGDSVLGLTVCEWLFNEYPE 60 ... Query: 185 YIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLI...RETGPD 244 ... YIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPD Sbjct: 121 YIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPD 180 ...
International Nuclear Information System (INIS)
Christen, Verena; Zucchi, Sara; Fent, Karl
2011-01-01
UV-filters are increasingly used in cosmetics and in the protection of materials against UV-irradiation, and ultimately they reach aquatic systems. The lipophilic UV-filter 2-ethyl-hexyl-4-trimethoxycinnamate (EHMC) belongs to one of the most frequently used UV-filters and accumulates in aquatic animals. Despite its ubiquitous presence in water and biota, very little is known about its potential hormonal effects on aquatic organisms. In our study, we evaluated the effects of measured water concentration of 5.4, 37.5, 244.5 and 394 μg/L EHMC on the expression of genes involved in hormonal pathways in the liver, testis and brain of male and female fathead minnows (Pimephales promelas). We compare the transcription profile with the plasma vitellogenin (VTG) content, secondary sex characteristics, and gonad histology. Transcripts of the androgen receptor (ar) were significantly down-regulated in the liver of females at 37.5, 244.5 μg/L and 394 μg/L EHMC. Additionally, the 3β-hydroxysteroid dehydrogenase (3β-HSD) transcript was significantly decreased in the liver of males at 37.5, 244.5 and 394 μg/L EHMC, and at 244.5 and 394 μg/L EHMC in females. The expressional changes were tissue-specific in most cases, being most significant in the liver. Vitellogenin plasma concentration was significantly increased at 244.5 μg/L EHMC in males. EHMC induced significant histological changes in testes and ovaries at 394 μg/L. Testes displayed a decrease in spermatocytes, and ovaries a decrease in previtellogenic oocytes. The induction of VTG plasma concentration and the histological changes in gonads suggest an estrogenic and/or antiandrogenic activity of EHMC. On the other hand, the gene expression profile shows an antiestrogenic (e.g.: down-regulation of esr1) activity of EHMC. In conclusion, our data demonstrate that EHMC displays low but multiple hormonal activities in fish.
Energy Technology Data Exchange (ETDEWEB)
Christen, Verena; Zucchi, Sara [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gruendenstrasse 40, CH-4132 Muttenz (Switzerland); Fent, Karl, E-mail: karl.fent@fhnw.ch [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gruendenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology Zuerich (ETH Zuerich), Department of Environmental Sciences, 8092 Zuerich (Switzerland)
2011-04-15
UV-filters are increasingly used in cosmetics and in the protection of materials against UV-irradiation, and ultimately they reach aquatic systems. The lipophilic UV-filter 2-ethyl-hexyl-4-trimethoxycinnamate (EHMC) belongs to one of the most frequently used UV-filters and accumulates in aquatic animals. Despite its ubiquitous presence in water and biota, very little is known about its potential hormonal effects on aquatic organisms. In our study, we evaluated the effects of measured water concentration of 5.4, 37.5, 244.5 and 394 {mu}g/L EHMC on the expression of genes involved in hormonal pathways in the liver, testis and brain of male and female fathead minnows (Pimephales promelas). We compare the transcription profile with the plasma vitellogenin (VTG) content, secondary sex characteristics, and gonad histology. Transcripts of the androgen receptor (ar) were significantly down-regulated in the liver of females at 37.5, 244.5 {mu}g/L and 394 {mu}g/L EHMC. Additionally, the 3{beta}-hydroxysteroid dehydrogenase (3{beta}-HSD) transcript was significantly decreased in the liver of males at 37.5, 244.5 and 394 {mu}g/L EHMC, and at 244.5 and 394 {mu}g/L EHMC in females. The expressional changes were tissue-specific in most cases, being most significant in the liver. Vitellogenin plasma concentration was significantly increased at 244.5 {mu}g/L EHMC in males. EHMC induced significant histological changes in testes and ovaries at 394 {mu}g/L. Testes displayed a decrease in spermatocytes, and ovaries a decrease in previtellogenic oocytes. The induction of VTG plasma concentration and the histological changes in gonads suggest an estrogenic and/or antiandrogenic activity of EHMC. On the other hand, the gene expression profile shows an antiestrogenic (e.g.: down-regulation of esr1) activity of EHMC. In conclusion, our data demonstrate that EHMC displays low but multiple hormonal activities in fish.
Christen, Verena; Zucchi, Sara; Fent, Karl
2011-04-01
UV-filters are increasingly used in cosmetics and in the protection of materials against UV-irradiation, and ultimately they reach aquatic systems. The lipophilic UV-filter 2-ethyl-hexyl-4-trimethoxycinnamate (EHMC) belongs to one of the most frequently used UV-filters and accumulates in aquatic animals. Despite its ubiquitous presence in water and biota, very little is known about its potential hormonal effects on aquatic organisms. In our study, we evaluated the effects of measured water concentration of 5.4, 37.5, 244.5 and 394 μg/L EHMC on the expression of genes involved in hormonal pathways in the liver, testis and brain of male and female fathead minnows (Pimephales promelas). We compare the transcription profile with the plasma vitellogenin (VTG) content, secondary sex characteristics, and gonad histology. Transcripts of the androgen receptor (ar) were significantly down-regulated in the liver of females at 37.5, 244.5 μg/L and 394 μg/L EHMC. Additionally, the 3β-hydroxysteroid dehydrogenase (3β-HSD) transcript was significantly decreased in the liver of males at 37.5, 244.5 and 394 μg/L EHMC, and at 244.5 and 394 μg/L EHMC in females. The expressional changes were tissue-specific in most cases, being most significant in the liver. Vitellogenin plasma concentration was significantly increased at 244.5 μg/L EHMC in males. EHMC induced significant histological changes in testes and ovaries at 394 μg/L. Testes displayed a decrease in spermatocytes, and ovaries a decrease in previtellogenic oocytes. The induction of VTG plasma concentration and the histological changes in gonads suggest an estrogenic and/or antiandrogenic activity of EHMC. On the other hand, the gene expression profile shows an antiestrogenic (e.g.: down-regulation of esr1) activity of EHMC. In conclusion, our data demonstrate that EHMC displays low but multiple hormonal activities in fish. Copyright © 2011 Elsevier B.V. All rights reserved.
A genetic study of SSV1, the prototypical fusellovirus.
Directory of Open Access Journals (Sweden)
Eric eIverson
2012-06-01
Full Text Available Viruses of thermophilic Archaea are unique in both their structures and genomic sequences. The most widespread and arguably best studied are the lemon-shaped fuselloviruses. The spindle-shaped virus morphology is unique to Archaea but widespread therein. The best studied fusellovirus is SSV1 from Beppu Japan, which infects Sulfolobus solfataricus. Very little is known about the function of the genes in the SSV1 genome. Recently we have developed genetic tools to analyze these genes. In this study, we have deleted three SSV1 open reading frames ranging from completely conserved to poorly conserved: VP2, d244, and b129. Deletion of the universally conserved ORF b129, which encodes a predicted transcriptional regulator, results in loss of infectivity. Deletion of the poorly-conserved predicted DNA binding protein gene VP2 yields viable virus that is indistinguishable from wild-type Deletion of the well-conserved ORF d244 that encodes a predicted nuclease yields viable virus. However infection of Sulfolobus solfataricus with virus lacking ORF d244 dramatically retards host growth, compared to the wild-type virus.
Measurement of curium in marine samples
Schneider, D. L.; Livingston, H. D.
1984-06-01
Measurement of environmentally small but detectable amounts of curium requires reliable, accureate, and sensitive analytical methods. The radiochemical separation developed at Woods Hole is briefly reviewed with specific reference to radiochemical interferences in the alpha spectrometric measurement of curium nuclides and to the relative amounts of interferences expected in different oceanic regimes and sample types. Detection limits for 242 Cm and 244 Cm are ultimately limited by their presence in the 243Am used as curium yield monitor. Environmental standard reference materials are evaluated with regard to curium. The marine literature is reviewed and curium measurements are discussed in relation to their source of introduction to the environment. Sources include ocean dumping of low-level radioactive wastes and discharges from nuclear fuel reporcessing activities, In particular, the question of a detectable presence of 244Cm in global fallout from nuclear weapons testing is addressed and shown to be essentially negligible. Analyses of Scottish coastal sedimantes show traces of 242Cm and 244Cm activity which are believed to originate from transport from sources in the Irish Sea.
ORF Alignment: NC_002570 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available VIPEALDGQNLIVHSQTGTGKTLAYLLPMLTK 60 ... Query: 124 VAVGTPGRILELMEMKKLKVPHVKMIVVDEADRMMEETSAWNAFENVAKRIGNEAQYLFV... 183 ... VAVGTPGRILELMEMKKLKVPHVKMIVVDEADRMMEETSAWNAFENVAKRIGNEAQYLFV Sbjc...t: 121 VAVGTPGRILELMEMKKLKVPHVKMIVVDEADRMMEETSAWNAFENVAKRIGNEAQYLFV 180 ... Query: 244 GIVFVNRLEHVAETTAKLQFKGIK
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS 297 ... VWGTKDVVVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS Sbjct: 241 VWGTKDVVVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS 294 ...A Sbjct: 121 YQFPHLVERLILVGAGGVTKDVNFVLRWASLPLGSEAIALLRLPLVLPAVQLMGRVLGTA 180 ... Query: 244 VWGTKDVVVPVRHAWMAH
ORF Alignment: NC_006177 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SRDPGKARGRVPDGVEVRAGDVTDGATLGPAL 60 ... Query: 124 QTKPWFRAKLMAEKAIRESGIPYTIFRPSWVYGPEDRSLNKFATFARLLPFVPVIGSGRT... 183 ... QTKPWFRAKLMAEKAIRESGIPYTIFRPSWVYGPEDRSLNKFATFARLLPFVPVIGSGRT Sbjc...t: 121 QTKPWFRAKLMAEKAIRESGIPYTIFRPSWVYGPEDRSLNKFATFARLLPFVPVIGSGRT 180 ... Query: 244 WLMKAAAWPLQFLPTPPLSPGAVD
Lesure, Frank G.
1981-01-01
Traces of gold and molybdenum are widely disseminated in an area approximately 35 km long and 10 km wide in northwestern Moore County, N.C. At least 2540 oz. of gold were recovered from 16 or more mines and prospects between 1880 and 1910. One hundred and ninety rock samples out of 244 collected from old gold mines, pyrophyllite deposits and along roads contain gold quantities ranging from 0.02 to 2.4 parts per million. In addition, 43 samples out of the 244 taken contain molybdenum in amounts ranging from 4 to 500 parts per million.
Comparison of fission and capture cross sections of minor actinides
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Iwamoto, Osamu
2003-01-01
The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TIMTDPAM 60 ... Query: 124 ... DTIDKAEDRSRFDKAMKDIGLECPRSGIAHSMEEANAVLEKLGFPCIIRPSFTMGGTGGG 183 ... DTIDKA...EDRSRFDKAMKDIGLECPRSGIAHSMEEANAVLEKLGFPCIIRPSFTMGGTGGG Sbjct: 121 ... DTIDKAEDRSRFDK...AMKDIGLECPRSGIAHSMEEANAVLEKLGFPCIIRPSFTMGGTGGG 180 ... Query: 244 ... GVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVETGGSNV
Lü, Xing-Qiang; Jiang, Ji-Jun; Chen, Chun-Long; Kang, Bei-Sheng; Su, Cheng-Yong
2005-06-27
The reactions of Cu(II) with the mixed nitrilotriacetic acid (H3NTA) and 4,4'-bipyridyl (4,4'-bpy) ligands in different metal-to-ligand ratios in the presence of NaOH and NaClO4 afforded two complexes, Na3[Cu2(NTA)2(4,4'-bpy)]ClO4 x 5H2O (1) and [Cu2(NTA) (4,4'-bpy)2]ClO4 x 4H2O (2). The two complexes have been characterized by elemental analysis, IR, XRD, and single-crystal X-ray diffraction. 1 contains a basic doubly negatively charged [Cu2(NTA)2(4,4'-bpy)]2- dinuclear unit which was further assembled via multiple Na-O and O-H...O interactions into a three-dimensional (3D) pillared-layer structure. 2 features a two-dimensional (2D) undulated brick-wall architecture containing a basic doubly positively charged [Cu4(NTA)2(4,4'-bpy)2]2+ tetranuclear unit. The 2D network possesses large cavities hosting guest molecules and was further assembled via O-H...O hydrogen bonds into a 3D structure with several channels running in different directions.
SU-F-T-244: Radiotherapy Risk Estimation Based On Expert Group Survey
International Nuclear Information System (INIS)
Koo, J; Yoon, M; Chung, W; Chung, M; Kim, D
2016-01-01
Purpose: To evaluate the reliability of RPN (Risk Priority Number) decided by expert group and to provide preliminary data for adapting FMEA in Korea. Methods: 1163 Incidents reported in ROSIS for 11 years were used as a real data to be compared with, and were categorized into 146 items. The questionnaire was composed of the 146 items and respondents had to valuate ‘occurrence (O)’, ‘severity (S)’, ‘detectability (D)’ of each item on a scale from 1 to 10 according to the proposed AAPM TG-100 rating scales. 19 medical physicists from 19 different organizations in Korea had participated in the survey. Because the number of ROSIS items was not evenly spread enough to be classified into 10 grades, 1–5 scale was chosen instead of 1–10 and survey result was also fit to 5 grades to compare. Results: The average O,S,D were 1.77, 3.50, 2.13, respectively and the item which had the highest RPN(32) was ‘patient movement during treatment’ in the survey. When comparing items ranked in the top 10 of each survey(O) and ROSIS database, two items were duplicated and ‘Simulation’ and ’Treatment’ were the most frequently ranked RT process in top 10 of survey and ROSIS each. The Chronbach α of each RT process were ranged from 0.74 to 0.99 and p-value was <0.001. When comparing O*D, the average difference was 1.4. Conclusion: This work indicates the deviation between actual risk and expectation. Considering that the respondents were Korean and ROSIS is mainly composed of incidents happened in European countries and some of the top 10 items of ROSIS cannot be applied in radiotherapy procedure in Korea, the deviation could have been came from procedural difference. Moreover, if expert group was consisted of experts from various parts, expectation might have been more accurate. Therefore, further research on radiotherapy risk estimation is needed.
SU-F-T-244: Radiotherapy Risk Estimation Based On Expert Group Survey
Energy Technology Data Exchange (ETDEWEB)
Koo, J; Yoon, M [Korea University, Seoul (Korea, Republic of); Chung, W; Chung, M; Kim, D [Kyung Hee University Hospital at Gangdong, Gangdong-gu, Seoul (Korea, Republic of)
2016-06-15
Purpose: To evaluate the reliability of RPN (Risk Priority Number) decided by expert group and to provide preliminary data for adapting FMEA in Korea. Methods: 1163 Incidents reported in ROSIS for 11 years were used as a real data to be compared with, and were categorized into 146 items. The questionnaire was composed of the 146 items and respondents had to valuate ‘occurrence (O)’, ‘severity (S)’, ‘detectability (D)’ of each item on a scale from 1 to 10 according to the proposed AAPM TG-100 rating scales. 19 medical physicists from 19 different organizations in Korea had participated in the survey. Because the number of ROSIS items was not evenly spread enough to be classified into 10 grades, 1–5 scale was chosen instead of 1–10 and survey result was also fit to 5 grades to compare. Results: The average O,S,D were 1.77, 3.50, 2.13, respectively and the item which had the highest RPN(32) was ‘patient movement during treatment’ in the survey. When comparing items ranked in the top 10 of each survey(O) and ROSIS database, two items were duplicated and ‘Simulation’ and ’Treatment’ were the most frequently ranked RT process in top 10 of survey and ROSIS each. The Chronbach α of each RT process were ranged from 0.74 to 0.99 and p-value was <0.001. When comparing O*D, the average difference was 1.4. Conclusion: This work indicates the deviation between actual risk and expectation. Considering that the respondents were Korean and ROSIS is mainly composed of incidents happened in European countries and some of the top 10 items of ROSIS cannot be applied in radiotherapy procedure in Korea, the deviation could have been came from procedural difference. Moreover, if expert group was consisted of experts from various parts, expectation might have been more accurate. Therefore, further research on radiotherapy risk estimation is needed.
Riding Bare-Back on unstructured meshes for 21. century criticality calculations - 244
International Nuclear Information System (INIS)
Kelley, K.C.; Martz, R.L.; Crane, D.L.
2010-01-01
MCNP has a new capability that permits tracking of neutrons and photons on an unstructured mesh which is embedded as a mesh universe within its legacy geometry capability. The mesh geometry is created through Abaqus/CAE using its solid modeling capabilities. Transport results are calculated for mesh elements through a path length estimator while element to element tracking is performed on the mesh. The results from MCNP can be exported to Abaqus/CAE for visualization or other-physics analysis. The simple Godiva criticality benchmark problem was tested with this new mesh capability. Computer run time is proportional to the number of mesh elements used. Both first and second order polyhedrons are used. Models that used second order polyhedrons produced slightly better results without significantly increasing computer run time. Models that used first order hexahedrons had shorter runtimes than models that used first order tetrahedrons. (authors)
Determination of Am-241, Cm-242 and Cm-244 in environmental samples
International Nuclear Information System (INIS)
Afsar, M.; Schuettelkopf, H.
1988-01-01
An analytical procedure for the determination of Am and Cm in environmental, liquid and gaseous effluent samples was developed. It is based on extraction chromatography with subsequent anion and cation exchange to remove matrix elements and to purify Am and Cm, which are then electrode posited from an oxalate/HCl medium. The mean value of the chemical yield is about 90%. A detection limit of 7 μBq/g is achieved. The decontamination factors for important α emitters are > 10 4 . Four analyses/week can be performed by one technician. (orig./RB) [de
Consistent evaluation of neutron cross sections for the 242-244Cm isotopes
International Nuclear Information System (INIS)
Ignatyuk, A.V.; Maslov, V.M.
1989-01-01
The knowledge of neutron cross-sections for Curium isotopes is necessary for solving the problems of the external fuel cycle. Experimental information on the cross-sections is very meager and does not satisfy requirements and existing evaluations in different libraries differ substantially for fission and (n,2n) reaction cross-sections. This situation requires a critical review of the entire set of evaluations of the neutron cross-sections for Curium. 17 refs, 3 figs
U. S. Atlantic Fleet, Eighth Amphibious Force. Operation Plan Number 2-44
1944-01-01
distributed with this Operation Order. (c) Panoramic Bench Sketches No. P-l for Boach 259 and No. P~3 for Loach 26l (South) givo viator level...To indicate tank or ID targets. (g) Green Cluster, White Cluster - Lift Artillery fire. Page 32 of 33. ANNEX KENS . GTMFIRS SUPPORT PLAN. TABLE VI...AURORA . SFCP 5 AUX GROUND SPOT - LIVERMORS SFCP 6 AUX GROUND SPOT - LA GLOIRE SFCP 7 AUX GROUND -SPOT ~ TERM- ERIC SFCP 8 AUX GROUND SPOT - ORION-KEAR
Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force
Energy Technology Data Exchange (ETDEWEB)
Girod, M.; Delaroche, J.P.; Romain, P. [CEA/DIF, DPTA/SPN, Boite Postale 12, 91680 Bruyeres-le-Chatel (France); Libert, J. [Institut de Physique Nucleaire Centre National de la Recherche Scientifique-IN2P3, F-91406 Orsay (France)
2002-10-01
The structure properties of the even-even nuclei {sup 226,} {sup 228,} {sup 230,} {sup 232,} {sup 234}Th, {sup 230,} {sup 232,} {sup 234,} {sup 236,} {sup 238,} {sup 240}U, {sup 240,} {sup 242,} {sup 244,} {sup 246}Pu, and {sup 242,} {sup 244,} {sup 246,} {sup 248}Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)
Radiochemical studies of neutron deficient actinide isotopes
Energy Technology Data Exchange (ETDEWEB)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
International Nuclear Information System (INIS)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.
2000-01-01
Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
ORF Alignment: NC_004317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... falciparum 3D7] ... Length = 244 ... Query: 116 NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTY...EGNWIDNKMN 175 ... NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTYEGNWI...DNKMN Sbjct: 1 ... NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTYEGNWIDNKMN 60 ... Query: 236 ILPFNFIKINFKNIA
ORF Alignment: NC_004342 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available interrogans serovar Copenhageni str. ... Fiocruz L1-130] ... Length = 63 ... Query: 185 IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC 244 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC Sbjct: 1 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISHHTLEDGSEEIPDTYGWLVGCDICQDVC 60 ...
ORF Alignment: NC_005823 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available interrogans serovar Copenhageni str. ... Fiocruz L1-130] ... Length = 63 ... Query: 185 IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC 244 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC Sbjct: 1 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISHHTLEDGSEEIPDTYGWLVGCDICQDVC 60 ...
Ultraviolet Resonant Raman Enhancements in the Detection of Explosives
Energy Technology Data Exchange (ETDEWEB)
Short Jr., Billy Joe [Naval Postgraduate School, Monterey, CA (United States)
2009-06-01
Raman-based spectroscopy is potentially militarily useful for standoff detection of high explosives. Normal (non-resonance) and resonance Raman spectroscopies are both light scattering techniques that use a laser to measure the vibrational spectrum of a sample. In resonance Raman, the laser is tuned to match the wavelength of a strong electronic absorbance in the molecule of interest, whereas, in normal Raman the laser is not tuned to any strong electronic absorbance bands. The selection of appropriate excitation wavelengths in resonance Raman can result in a dramatic increase in the Raman scattering efficiency of select band(s) associated with the electronic transition. Other than the excitation wavelength, however, resonance Raman is performed experimentally the same as normal Raman. In these studies, normal and resonance Raman spectral signatures of select solid high explosive (HE) samples and explosive precursors were collected at 785 nm, 244 nm and 229 nm. Solutions of PETN, TNT, and explosive precursors (DNT & PNT) in acetonitrile solvent as an internal Raman standard were quantitatively evaluated using ultraviolet resonance Raman (UVRR) microscopy and normal Raman spectroscopy as a function of power and select excitation wavelengths. Use of an internal standard allowed resonance enhancements to be estimated at 229 nm and 244 nm. Investigations demonstrated that UVRR provided ~2000-fold enhancement at 244 nm and ~800-fold improvement at 229 nm while PETN showed a maximum of ~25-fold at 244 nm and ~190-fold enhancement at 229 nm solely from resonance effects when compared to normal Raman measurements. In addition to the observed resonance enhancements, additional Raman signal enhancements are obtained with ultraviolet excitation (i.e., Raman scattering scales as !4 for measurements based on scattered photons). A model, based partly on the resonance Raman enhancement results for HE solutions, is presented for estimating Raman enhancements for solid HE samples.
The gastrointestinal absorption and urinary excretion of plutonium in male volunteers
International Nuclear Information System (INIS)
Ham, G.J.; Harrison, J.D.
2000-01-01
The gastrointestinal absorption and urinary excretion of 244 Pu have been measured in five healthy adult males in a two-stage study. Firstly, the volunteers ingested about 10 14 atoms of 244 Pu in citrate solution with a mid-day meal and urinary excretion was measured for the following 7-9 days. After a period of at least six months, the same volunteers were given an intravenous injection of 2x10 12 atoms of 244 Pu in citrate solution. Urinary excretion was then measured for the following 7-9 days and subsequently at intervals over periods up to 5-6 years. Fractional absorption of Pu from the gastrointestinal tract, calculated by comparing excretion for the two routes of administration, averaged 6x10 -4 , consistent with the ICRP value of 5x10 -4 . The results show a positive correlation between increasing age of the subjects, between 36 and 64 years of age, and increasing absorption of ingested Pu from 10 -4 to 10 -3 . In general, results for urinary excretion after injection are consistent with prediction of the current ICRP model although daily excretion after 5-6 years (3 subjects) averages 0.005% of the administered amount, about twice the predicted value. (author)
Measurements of Plutonium isotopes and the search for super-heavy elements via AMS
International Nuclear Information System (INIS)
Wallner, A.; Steier, P.; Golser, R.; Knie, K.; Kutschera, W.; Priller, A.; Hrnecek, E.; Jakopic, R.; Korschinek, G.
2006-01-01
Full text: Accelerator Mass Spectrometry (AMS) - being independent on the half-life of a radionuclide - provides a technique to determine isotope ratios with the highest sensitivity and allows the measurement of radionuclides over a wide dynamic range of concentration levels. A combination of AMS, Alpha Spectrometry and Liquid Scintillation Counting was used for the determination of the complete information on isotope ratios of Plutonium isotopes in different environmental reference samples (e.g. from the atolls of Mururoa and Fangataufa) and samples contaminated from nuclear reprocessing. Results for the isotopic ratios of the samples will be shown and the capabilities and detection limits achievable for determination of Pu will be discussed. The long-lived 244 Pu (t 1/2 = 80 Ma) and 247 Cm (t 1/2 = 15.6 Ma) have a very interesting application in astrophysics by detecting possible supernova-produced 244 Pu and 247 Cm in terrestrial archives. The expected extremely small concentrations of 244 Pu makes AMS the favorite method. The actual search for such long-lived extraterrestrial radionuclides and possible implications will be presented. The same method has also been explored for a pinprick-search of long-lived super-heavy elements in the mass region above Z=100. (author)
International Nuclear Information System (INIS)
Walker, R.L.; Botts, J.L.; Cooper, J.H.; Adair, H.L.; Bigelow, J.E.; Raman, S.
1983-10-01
The United States and the United Kingdom are engaged in a joint research program in which samples of the higher actinides are irradiated in the Dounreay Prototype Fast Reactor in Scotland. The purpose of the porogram is (1) to study the materials behavior of selected higher actinide fuels and (2) to determine the integral cross sections of a wide variety of the higher actinide isotopes. Samples of the actinides are incorporated in fuel pins inserted in the core. For the fuel study, the actinides selected are 241 Am and 244 Cm in the form of Am 2 O 3 , Cm 2 O 3 , and Am 6 Cm(RE) 7 O 21 , where (RE) represents a mixture of lanthanides. For the cross-section determinations, the samples are milligram quantities of actinide oxides of 248 Cm, 246 Cm, 244 Cm, 243 Cm, 243 Am, 241 Am, 244 Pu, 242 Pu, 241 Pu, 240 Pu, 239 Pu, 238 Pu, 237 Np, 238 U, 236 U, 235 U, 234 U, 233 U, 232 Th, 230 Th, and 231 Pa encapsulated in vanadium. Coincident with the irradiations, neutron flux and energy spectral measurements are made with vanadium-encapsulated dosimeter materials located within the same fuel pins
Stanislav Markus. Property, Predation, and Protection: Piranha Capitalism in Russia and Ukraine
Directory of Open Access Journals (Sweden)
Paul Babie
2016-09-01
Full Text Available Stanislav Markus. Property, Predation, and Protection: Piranha Capitalism in Russia and Ukraine. Cambridge: Cambridge UP, 2015. xii, 244 pp. Illustrations. Tables. Bibliography. Index. $95.00, cloth.
Protein (Cyanobacteria): 517207156 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 27:244 ... 7-cyano-7-deazaguanine reductase filamentous cyanobacterium ESFC-1 MNSMSSETEVAQTPEVKYGERAIADCELITF... WP_018395974.1 NZ_KB904821 1117:4682 ... 1150:39727 1301283:59529 44887:1731 ... 11284
Clinical Investigation Program Annual Progress Report
1989-09-30
of Stuttering and Maintenance of Fluency by Means of Airflow, Tension Reduction, and Discriminative Stimulus Control Procedures. J Fluency Disorders...244 body fat .............................. 331 bone cement ...................... 36 density ............................. 121,152
Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens
International Nuclear Information System (INIS)
Page, Richard C.; Clark, Jeffrey G.; Misra, Saurav
2011-01-01
The structure of immunoglobulin-like repeat 10 from human filamin A solved at 2.44 Å resolution suggests the potential effects of mutations correlated with otopalatodigital syndrome spectrum disorders. Filamin A (FlnA) plays a critical role in cytoskeletal organization, cell motility and cellular signaling. FlnA utilizes different binding sites on a series of 24 immunoglobulin-like domains (Ig repeats) to interact with diverse cytosolic proteins and with cytoplasmic portions of membrane proteins. Mutations in a specific domain, Ig10 (FlnA-Ig10), are correlated with two severe forms of the otopalatodigital syndrome spectrum disorders Melnick–Needles syndrome and frontometaphyseal dysplasia. The crystal structure of FlnA-Ig10 determined at 2.44 Å resolution provides insight into the perturbations caused by these mutations
van Hattem, Jarne M; Arcilla, Maris S; Bootsma, Martin Cj; van Genderen, Perry J; Goorhuis, Abraham; Grobusch, Martin P; Molhoek, Nicky; Oude Lashof, Astrid Ml; Schultsz, Constance; Stobberingh, Ellen E; Verbrugh, Henri A; de Jong, Menno D; Melles, Damian C; Penders, John
2016-07-01
The aim was to study acquisition and persistence of carbapenemase-producing Enterobacteriaceae (CPE) among travelers. Stools from 2001 travelers and 215 nontraveling household members, collected before and immediately post-travel as well as 1, 3, 6 and 12 months upon return, were screened for CPE. Five travelers, all visiting Asia outside the Indian subcontinent, acquired CPE. One traveler persistently carried the same OXA-244 CPE up to 6 months post-travel. Three months after travel, her co-traveling spouse also became positive for this OXA-244 CPE strain, suggesting clonal transmission within this household. Acquisition of CPE is not restricted to travelers to the Indian subcontinent and/or to travelers seeking healthcare during travel and can persist up to at least 6 months post-travel.
Adsorption and migration of transplutonium elements in environmental systems
Energy Technology Data Exchange (ETDEWEB)
Balukova, V.D.; Kaymin, E.P.; Ushakov, S.I.
Behavior of long decay-time transuranium and transplutonium elements in natural systems was addressed. The most dangerous among them are /sup 238/Np, /sup 241/ /sup 243/Am, /sup 244/ /sup 245/ /sup 246/Cm, and /sup 239/ /sup 240/ /sup 242/ /sup 244/Pu. Their transportation through natural deposits is tightly connected with ground water movements. The principal parameters determining behavior of these radionuclides in ground formations are coefficients of isotope distribution between various phases, adsorption capacities of component minerals, effective porosity, filtration coefficients of the liquid, etc. These data are presented in tabular and graphic forms. In carbonate-bicarbonate ground waters containing silicate minerals, the content of radionuclides could be quickly decreased by hydrolysis and formation of insoluble precipitates. 2 references, 3 figures.
The use of curium neutrons to verify plutonium in spent fuel and reprocessing wastes
International Nuclear Information System (INIS)
Miura, N.
1994-05-01
For safeguards verification of spent fuel, leached hulls, and reprocessing wastes, it is necessary to determine the plutonium content in these items. We have evaluated the use of passive neutron multiplicity counting to determine the plutonium content directly and also to measure the 240 Pu/ 244 Cm ratio for the indirect verification of the plutonium. Neutron multiplicity counting of the singles, doubles, and triples neutrons has been evaluated for measuring 240 Pu, 244 Cm, and 252 Cf. We have proposed a method to establish the plutonium to curium ratio using the hybrid k-edge densitometer x-ray fluorescence instrument plus a neutron coincidence counter for the reprocessing dissolver solution. This report presents the concepts, experimental results, and error estimates for typical spent fuel applications
Analysis of recent post irradiation tests by Japanese and French burnup analysis code systems
International Nuclear Information System (INIS)
Iwasaki, Tomohiko; Hiraizumi, Hiroaki; Youinou, Gilles
2002-01-01
Benchmark problem based on Japanese Post Irradiation Experiment (PIE) data was analyzed by Japanese burnup analysis code and French one under the cooperative research program between the Japanese University Association (JUA) in Japan and Commissariat a l'Enegie Atomique (CEA) in France. Significant discrepancies over 10% were found between the Japanese and French results for 238 Pu, 243 Am, 244 Cm, 125 Sb, 154 Eu, 134 Cs and 144 Ce. It is supposed that the difference of C/E for 243 Am and 244 Cm between Japanese results and French ones is due to the (n,gamma) reaction of 242m Am. For 125 Sb and 154 Eu, the C/E values are improved by using new cross section and fission yield libraries. (author)
Poly[[diaquabis(μ2-4,4′-bipyridinemanganese(II] bis[2-(2-carboxyphenyldisulfanylbenzoate
Directory of Open Access Journals (Sweden)
Shao-Ming Fang
2009-05-01
Full Text Available The title complex, {[Mn(C10H8N22(H2O2](C14H9O4S22}n, contains an octahedrally coordinated MnII cation and 2-(2-carboxyphenyldisulfanylbenzoate anions. The MnII center is situated on a crystallographic center of inversion and is coordinated by four 4,4′-bipyridine (4,4′-bipy ligands and two water molecules. The 4,4′-bipy ligands act as bridging ligands, producing a fishing-net-like two-dimensional framework. In the crystal structure, this positively charged framework is charge balanced by 2-(2-carboxyphenyldisulfanylbenzoate anions that form a separate anionic two-dimensional framework via intermolecular O—H...O hydrogen bonds and C—H...π stacking interactions. Additional intermolecular O—H...O hydrogen bonds link the cationic and anionic frameworks to form the three-dimensional crystal structure.
2010-05-12
... Control Number 0704-0253) AGENCY: Defense Acquisition Regulations System, Department of Defense. ACTION... proposed information collection; (c) ways to enhance the quality, utility, and clarity of the information..., withhold, or withdraw purchasing system approval at the conclusion of a purchasing system review...
25 CFR 1000.244 - May the Secretary suspend construction activities under an AFA?
2010-04-01
... construction activities under an AFA? (a) The Secretary may require a Tribe/Consortium to suspend certain work under a construction portion of an AFA for up to 30 days only if: (1) Site conditions adversely affect health and safety; or (2) Work in progress or completed fails to substantially carry out the terms of the...
Czech Academy of Sciences Publication Activity Database
Krejčová, Iva
2014-01-01
Roč. 22, 1/2 (2014), s. 225-244 ISSN 1803-456X Institutional support: RVO:68378068 Keywords : national identity * Jungmann, Josef * Czech literature Subject RIV: AJ - Letters, Mass-media, Audiovision
Indian Academy of Sciences (India)
Jadavpur), FNASc, FRCP (London). Date of birth: 2 November 1960. Specialization: Pharmacology, Immunology, Parasitology Address: Department of Pharmacology, Institute of PG Medical Education & Research, 244-B, Acharya JC Bose Road, ...
Czech Academy of Sciences Publication Activity Database
Hnídková, Vendula
2017-01-01
Roč. 96, č. 4 (2017), s. 242-244 ISSN 0042-4544 Institutional support: RVO:68378033 Keywords : modern architecture * Josep Lluis Sert * Fondation Maeght Subject RIV: AL - Art, Architecture , Cultural Heritage
Narva Elektrijaamade renoveerimine - projekti ettevalmistus, teostus ja tulemused / Mati Uus
Uus, Mati
2005-01-01
2001. a. sõlmis AS Narva Elektrijaamad tarnelepingu Soome firmaga Foster Wheeler Energia OY kahe energiaploki kompleksseks renoveerimiseks. Lepingu maksumus oli 244 miljonit eurot ning ühe ploki ehitusaeg 30 kuud
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
Německý Mácha, Óda na radost a krize evropské vize
Czech Academy of Sciences Publication Activity Database
Pokorný, Martin Z.
2013-01-01
Roč. 31, 97-98 (2013), s. 244-251 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion
Influence of substrate temperature on properties of MgF2 coatings
International Nuclear Information System (INIS)
Yu Hua; Qi Hongji; Cui Yun; Shen Yanming; Shao Jianda; Fan Zhengxiu
2007-01-01
Thermal boat evaporation was employed to prepare MgF 2 single-layer coatings upon both JGS1 and UBK7 substrates at different substrate temperatures. Microstructure, transmittance and residual stress of these coatings were measured by X-ray diffraction, spectrophotometer, and optical interferometer, respectively. Measurement of laser induced damage threshold (LIDT) of the samples was performed at 355 nm, 8 ns pulses. The results showed that high substrate temperature was beneficial to crystallization of the film. Above 244 deg. C, the refractive index increased gradually with the substrate temperature rising. Whereas, it was exceptional at 210 deg. C that the refractive index was higher than those deposited at 244 and 277 deg. C. The tensile residual stresses were exhibited in all MgF 2 films, but not well correlated with the substrate temperature. In addition, the stresses were comparatively smaller upon JGS1 substrates. A tendency could be seen that the LIDTs reached the highest values at about 244 deg. C, and the films upon JGS1 had higher LIDTs than those upon UBK7 substrates at the same temperature. Meanwhile, the damage morphologies showed that the laser damage of the coating resulted from an absorbing center at the film-substrate interface. The features of the damages were displayed by an absorbing center dominated model. Furthermore, the reason of the difference in LIDT values was discussed in detail
Rible, Radhika D; Taylor, DeShawn; Wilson, Melissa L; Stanczyk, Frank Z; Mishell, Daniel R
2009-03-01
Combined oral contraceptive (COC) formulations with 20 mcg ethinyl estradiol (EE) have a greater incidence of ovarian hormone production and follicular development, which can be managed by shortening the number of hormone-free days per COC cycle. This study evaluates differences in follicular development during a 7-day versus 4-day hormone-free interval in a COC regimen with 20 mcg EE and 1 mg norethindrone acetate. Forty-one healthy women were randomized in an open-label fashion to this formulation in either a 24/4 or a 21/7 day regimen for three cycles. Estradiol, progesterone, follicle-stimulating hormone, luteinizing hormone and inhibin B were measured daily from Cycle 2, Day 21 to Cycle 3, Day 3 and on Day 7 of Cycle 3. Follicular diameter and Hoogland score were calculated on Cycle 2, Days 21, 24 and 28 and Cycle 3, Days 3 and 7. Sixty-six percent of subjects in the 21/7 group and 70% of the subjects in the 24/4 group developed a follicle greater than 10 mm diameter. Ovarian steroid hormone levels, Hoogland scores and bleeding patterns were not statistically significant between the groups. In contrast to prior studies, this analysis suggests no difference in follicle development or bleeding patterns among women receiving a 21/7 or 24/4 regimen of a 20-mcg EE/1-mg norethindrone acetate COC.
Directory of Open Access Journals (Sweden)
Claire M. Smith
2016-08-01
Full Text Available Defective interfering (DI viruses arise during the replication of influenza A virus and contain a non-infective version of the genome that is able to interfere with the production of infectious virus. In this study we hypothesise that a cloned DI influenza A virus RNA may prevent infection of human respiratory epithelial cells with infection by influenza A. The DI RNA (244/PR8 was derived by a natural deletion process from segment 1 of influenza A/PR/8/34 (H1N1; it comprises 395 nucleotides and is packaged in the DI virion in place of a full-length genome segment 1. Given intranasally, 244/PR8 DI virus protects mice and ferrets from clinical influenza caused by a number of different influenza A subtypes and interferes with production of infectious influenza A virus in cells in culture. However, evidence that DI influenza viruses are active in cells of the human respiratory tract is lacking. Here we show that 244/PR8 DI RNA is replicated by an influenza A challenge virus in human lung diploid fibroblasts, bronchial epithelial cells, and primary nasal basal cells, and that the yield of challenge virus is significantly reduced in a dose-dependent manner indicating that DI influenza virus has potential as a human antiviral.
Species diversity in the Antrodia crassa group (Polyporales, Basidiomycota)
Czech Academy of Sciences Publication Activity Database
Spirin, V.; Runnel, K.; Vlasák, Josef; Miettinen, O.; Pöldmaa, K.
2015-01-01
Roč. 119, č. 12 (2015), s. 1291-1310 ISSN 1878-6146 Institutional support: RVO:60077344 Keywords : Host specificity * Wood-inhabiting fungi * Taxonomy Subject RIV: EF - Botanics Impact factor: 2.244, year: 2015
African Journals Online (AJOL)
MASTERPLUS
Products (Tax Stamps) Regulations (GN No. 244). Dar es ... Professor of Drama, Theatre & Development Communication ... changing World: The implications for Africa in the 21st ..... Promote arts and culture as veritable economic business.
K pojmu psychospirituální krize
Czech Academy of Sciences Publication Activity Database
Říčan, Pavel
2012-01-01
Roč. 56, č. 2 (2012), s. 194-196 ISSN 0009-062X Institutional support: RVO:68081740 Keywords : psychospiritual crisis * spirituality * transpersonal psychology Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Protein disulfide isomerase interacts with tau protein and inhibits its fibrillization.
Directory of Open Access Journals (Sweden)
Li-Rong Xu
Full Text Available BACKGROUND: Tau protein is implicated in the pathogenesis of neurodegenerative disorders such as tauopathies including Alzheimer disease, and Tau fibrillization is thought to be related to neuronal toxicity. Physiological inhibitors of Tau fibrillization hold promise for developing new strategies for treatment of Alzheimer disease. Because protein disulfide isomerase (PDI is both an enzyme and a chaperone, and implicated in neuroprotection against Alzheimer disease, we want to know whether PDI can prevent Tau fibrillization. In this study, we have investigated the interaction between PDI and Tau protein and the effect of PDI on Tau fibrillization. METHODOLOGY/PRINCIPAL FINDINGS: As evidenced by co-immunoprecipitation and confocal laser scanning microscopy, human PDI interacts and co-locates with some endogenous human Tau on the endoplasmic reticulum of undifferentiated SH-SY5Y neuroblastoma cells. The results from isothermal titration calorimetry show that one full-length human PDI binds to one full-length human Tau (or human Tau fragment Tau244-372 monomer with moderate, micromolar affinity at physiological pH and near physiological ionic strength. As revealed by thioflavin T binding assays, Sarkosyl-insoluble SDS-PAGE, and transmission electron microscopy, full-length human PDI remarkably inhibits both steps of nucleation and elongation of Tau244-372 fibrillization in a concentration-dependent manner. Furthermore, we find that two molecules of the a-domain of human PDI interact with one Tau244-372 molecule with sub-micromolar affinity, and inhibit both steps of nucleation and elongation of Tau244-372 fibrillization more strongly than full-length human PDI. CONCLUSIONS/SIGNIFICANCE: We demonstrate for the first time that human PDI binds to Tau protein mainly through its thioredoxin-like catalytic domain a, forming a 1∶1 complex and preventing Tau misfolding. Our findings suggest that PDI could act as a physiological inhibitor of Tau
Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk
Olesk, Arko, 1981-
2004-01-01
Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest
Czech Academy of Sciences Publication Activity Database
Adkins, Irena; Köberle, M.; Gröbner, S.; Bohn, E.; Autenrieth, I. B.; Borgmann, S.
2007-01-01
Roč. 297, - (2007), s. 235-244 ISSN 1438-4221 Institutional research plan: CEZ:AV0Z50200510 Keywords : yersinia * yops * dendritic cell s Subject RIV: EC - Immunology Impact factor: 2.524, year: 2007
Morphological and molecular characterisation of Geosmithia species on European elms
Czech Academy of Sciences Publication Activity Database
Pepori, A.L.; Kolařík, Miroslav; Bettini, P.P.; Vettraino, A.M.; Santini, A.
2015-01-01
Roč. 119, č. 11 (2015), s. 1063-1074 ISSN 1878-6146 Institutional support: RVO:61388971 Keywords : Geosmithia spp. * Geosmithia omnicola * Geosmithia ulmacea Subject RIV: EE - Microbiology, Virology Impact factor: 2.244, year: 2015
75 FR 10793 - FY2010 Supplemental Funding for Brownfields Revolving Loan Fund (RLF) Grantees
2010-03-09
... (213) 244- 1850. EPA Region 10, Susan Morales, AK, ID, OR, WA 1200 Sixth Avenue, Suite Morales.Susan...: March 2, 2010. David R. Lloyd, Director, Office of Brownfields and Land Revitalization, Office of Solid...
Comparison of burnup calculation results using several evaluated nuclear data files
International Nuclear Information System (INIS)
Suyama, Kenya; Katakura, Jun-ichi; Nomura, Yasushi
2002-01-01
Burn-up calculation and comparison of the results were carried out to clarify the differences among the following latest evaluated nuclear data libraries: JENDL-3.2, ENDF/B-VI and JEF-2.2. The analyses showed that the differences seen among the current evaluated nuclear data libraries are small for evaluation of the amounts of many uranium and plutonium isotopes. However, several nuclides important for evaluation of nuclear fuel cycle as 238 Pu, 244 Cm, 149 Sm and 134 Cs showed large differences among used libraries. The chain analyses for the isotopes were conducted and the reasons for the differences were discussed. Based on the discussion, information of important cross section to obtain better agreement with the experimental results for 238 Pu, 244 Cm, 149 Sm and 134 Cs was shown. (author)
Czech Academy of Sciences Publication Activity Database
Číp, Ondřej
2017-01-01
Roč. 62, č. 10 (2017), s. 243-244 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : CAS ISI * optics Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)
Sudan Journal of Medical Sciences - Vol 9, No 4 (2014)
African Journals Online (AJOL)
Hysteroscopy in Libyan women with Recurrent Pregnancy Loss · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AM Elbareg, FM Essadi, MO Elmehashi, KI Anwar, I Adam, 239-244 ...
Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)
Czech Academy of Sciences Publication Activity Database
Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk
2013-01-01
Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino
Ammonia release from heated "street" cannabis leaf and its potential toxic effects on cannabis users
Czech Academy of Sciences Publication Activity Database
Bloor, R.; Wang, T. S.; Španěl, Patrik; Smith, D.
2008-01-01
Roč. 103, č. 10 (2008), s. 1671-1677 ISSN 0965-2140 Institutional research plan: CEZ:AV0Z40400503 Keywords : ammonia * cannabis * respiratory Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.244, year: 2008
Diverzita či odlišné chování? Sociální distance od Romů, gayů, lidí s AIDS a dalších menšin
Czech Academy of Sciences Publication Activity Database
Klicperová-Baker, Martina; Košťál, J.
2012-01-01
Roč. 56, č. 4 (2012), s. 297-314 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : diversity * minorities * social distance Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Czech Academy of Sciences Publication Activity Database
Charifi, Z.; Baaziz, H.; Reshak, Ali H
2007-01-01
Roč. 244, č. 9 (2007), s. 3154-3167 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z60870520 Keywords : TRANSITION-METAL DICHALCOGENIDES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.071, year: 2007
African Journals Online (AJOL)
USER
2016-04-08
Apr 8, 2016 ... Ethiopian Journal of Environmental Studies & Management 9 (2): 235 – 244, 2016. ISSN:1998- ... the hotel industry to be socially responsible concept ... on ethical values and respect for .... major common practical areas of.
Czech Academy of Sciences Publication Activity Database
Silva, S. R.; Gibson, R.; Adamec, Lubomír; Domínguez, Y.; Miranda, V.F.O.
2018-01-01
Roč. 118, Jan2018 (2018), s. 244-264 ISSN 1055-7903 Institutional support: RVO:67985939 Keywords : bladderworts * DNA sequencing * carnivorous plants Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.419, year: 2016
Body measurement characteristics of the West African Dwarf (WAD ...
African Journals Online (AJOL)
STORAGESEVER
2008-07-18
Jul 18, 2008 ... 1Faculty of Agricultural Sciences, Department of Animal Production and Health ... Two hundred and forty four (244) West African Dwarf (WAD) Goats ..... SAS Institute Inc. SAS Campus Drive. Carry. North. Carolina, U.S.A..
Natural Formation and Degradation of Chloroacetic Acids and Volatile Organochlorines in Forest Soil
Czech Academy of Sciences Publication Activity Database
Laturnus, F.; Fahimi, I.; Gryndler, Milan; Hartmann, A.; Heal, M. R.; Matucha, M.; Schöler, H. F.; Schroll, R.; Svensson, T.
2005-01-01
Roč. 12, č. 4 (2005), s. 233-244 ISSN 0944-1344 Institutional research plan: CEZ:AV0Z50200510 Keywords : chloroacetic acids * degradation * fores decline Subject RIV: EE - Microbiology, Virology Impact factor: 1.518, year: 2005
Czech Academy of Sciences Publication Activity Database
Šálek, Martin; Spassov, N.; Anděra, M.; Enzinger, K.; Ottlecz, B.; Hegyeli, Z.
2013-01-01
Roč. 58, č. 3 (2013), s. 233-244 ISSN 0001-7051 Institutional support: RVO:68081766 Keywords : Steppe polecat * Mustela eversmanii * Distribution * Habitat associations * Population status * Europe Subject RIV: EG - Zoology Impact factor: 1.161, year: 2013
Directory of Open Access Journals (Sweden)
Michael L. Stromyer
2016-01-01
Full Text Available Three isostructural coordination networks of Ce, Pr, and Nd nitrate with 4,4′-bipyridine N,N′-dioxide (bpydo are reported, namely poly[[tris(nitrato-κ2O,O′cerium(III]-bis(μ2-4,4′-bipyridine N,N′-dioxide-κ2N:N′], [Ce(NO33(C10H8N2O22], poly[[tris(nitrato-κ2O,O′praeseodymium(III]-bis(μ2-4,4′-bipyridine N,N′-dioxide-κ2N:N′], [Pr(NO33(C10H8N2O22], and poly[[tris(nitrato-κ2O,O′neodymium(III]-bis(μ2-4,4′-bipyridine N,N′-dioxide-κ2N:N′], [Nd(NO33(C10H8N2O22]. All three compounds are isostructural to the previously reported La analogue. The asymmetric unit of [Ln(NO33(μ2-bpydo2] contains one lanthanide cation, two bpydo ligands, and three nitrate anions. Both bpydo ligands act as end-to-end μ2-bridges and display nearly ideal cis and gauche conformations, respectively. The bpydo ligands link the ten-coordinate LnIII cations, forming interdigitating 44 grid-like layers extending parallel to (-101, where interdigitation of layers is promoted by C—H...O interactions between nitrate anions and bpydo ligands. The interdigitated layers are linked to sets of neighboring layers via further C—H...O and π–π interactions.
Saariaho, Anna-Maija; Jääskeläinen, Anna-Stiina; Nuopponen, Mari; Vuorinen, Tapani
2003-01-01
Raman spectroscopy of wood and lignin samples is preferably carried out in the near-infrared region because lignin produces an intense laser-induced fluorescence background at visible excitation wavelengths. However, excitation of aromatic and conjugated lignin structures with deep ultra violet (UV) light gives resonance-enhanced Raman signals while the overlapping fluorescence is eliminated. In this study, ultra violet resonance Raman (UVRR) spectroscopy was used to define characteristic vibration bands of model compounds of p-hydroxyphenyl, guaiacyl, and syringyl lignin structures at three excitation wavelengths (229, 244, and 257 nm). The intensities of each band, relative to the intensity of the aromatic vibration band at 1600 cm-1, were defined and the most suitable excitation wavelength was suggested for each structure. p-Hydroxyphenyl structures showed intensive characteristic bands at 1217-1214 and 1179-1167 cm-1 with excitation at 244 nm, whereas the bands of guaiacyl structures were more intensive with 257 nm excitation. Most intensive characteristic bands of guaiacyl structures were found at 1289-1279, 1187-1185, 1158-1155, and 791-704 cm-1. Syringyl structures had almost identical spectra with 244 and 257 nm excitations with characteristic bands at 1514-1506, 1333-1330, and 981-962 cm-1. The characteristic bands of the three structural units were also found from the compression wood, softwood, and hardwood samples, indicating that UVRR spectroscopy can be applied for the determination of chemical structures of lignin.
Reaction /sup 140/Ce (e, e'p), (2)
Energy Technology Data Exchange (ETDEWEB)
Saito, T; Shoda, K [Tohoku Univ., Sendai (Japan). Lab. of Nuclear Science
1975-06-01
An experiment was carried out to study the character of the resonance observed at 24.4 MeV in the /sup 140/Ce (..gamma.., p) /sup 139/La reaction. The (..gamma.., p/sub 0/ + p/sub 1/) cross section was measured at the angles of 54.7/sup 0/ and 125.3/sup 0/, at which the angle-dependent term of E1 becomes zero, for the energy range between 19 and 26 MeV. Existence of a peak due to the E2 resonance around 24.4 MeV was examined. The energy of incident electrons from a linear accelerator was changed between 20 and 26.7 MeV. The target was a Ce foil of 7.3 mg/cm/sup 2/ thick. The proton spectra due to the /sup 140/Ce (e, e' p) /sup 139/La reaction were measured with a broad range magnetic spectrometer. In the determined spectra of /sup 140/Ce (..gamma.., p/sub 0/+p/sub 1/) /sup 139/La, any remarkable peak, except one at 20.5 MeV, was not seen. From the observed spectra, the total cross section and the asymmetry factor due to interference were obtained as functions of energy. The values of the asymmetry factor were almost flat in the energy range between 19 and 26 MeV. The resonance at 24.4 MeV in the total cross section may be due to the E1 resonance, and is not due to the E2.
Energy Technology Data Exchange (ETDEWEB)
Schreckhise, R E; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)
1980-05-01
Uptake of the nitrate forms of /sup 238/Pu, /sup 239/Pu, /sup 241/Am, /sup 244/Cm and /sup 237/Np from soil into selected parts of four different plant species grown under field conditions was compared Alfalfa, barley, peas and cheatgrass were grown outdoors in small weighing lysimeters filled with soil containing these radionuclides. The plants were harvested at maturity, divided into selected components and radiochemically analyzed by alpha-energy analysis. Soil concentration did not appear to affect the plant uptake of /sup 238/Pu, /sup 239/Pu, /sup 241/Am or /sup 244/Cm for the two levels utilized. The relative plant uptake of the five different transuranics was /sup 237/Np>/sup 244/Cm approximately equal /sup 241/Am>/sup 239/Pu approximately equal/sup 238/Pu. Relative uptake values of Np for various plant parts ranged from 2200 to 45,000 times as great as for Pu, while Am and Cm values were 10-20 times as great. The values for seeds were significantly lower than those for the other aboveground plant parts for all four transuranic elements. The legumes accumulated approx. 10 times more than the grasses. A comparison of the postulated radionuclide content of plants grown in soil contaminated with material from spent liquid metal fast breeder reactor fuels indicated that concentrations of isotopes of Am, Cm and Np would exceed /sup 239/Pu values.
African Journals Online (AJOL)
Items 51 - 100 of 244 ... ... Cost effectiveness of fine needle aspiration cytology for breast masses, Abstract ... for breast cancer in patients with palpable breast lump in a middle ... children with sickle cell anaemia in Enugu, Nigeria, Abstract PDF.
Heavy Metals and Physicochemical Properties of Soils in Kano ...
African Journals Online (AJOL)
and such soil properties as organic carbon, available P, total N and basic cations on the other. Keywords: ..... addition through fertilizers and agro-chemicals, their ..... Analysis of Fish Tissue for Trace Metals. Afon ... Nutrition 7(2): 244-248.
The Phaeodactylum genome reveals the evolutionary history of diatom genomes
Czech Academy of Sciences Publication Activity Database
Bowler, Ch.; Allen, A. E.; Badger, J. H.; Grimwood, J.; Jabbari, K.; Kuo, A.; Maheswari, U.; Martens, C.; Maumus, F.; Otillar, R. P.; Rayko, E.; Salamov, A.; Vandepoele, K.; Beszteri, B.; Gruber, A.; Heijde, M.; Katinka, M.; Mock, T.; Valentin, K.; Verret, F.; Berges, J. A.; Brownlee, C.; Cadoret, J.-P.; Chiovitti, A.; Choi, Ch. J.; Coesel, S.; De Martino, A.; Detter, J. Ch.; Durkin, C.; Falciatore, A.; Fournet, J.; Haruta, M.; Huysman, M. J. J.; Jenkins, B. D.; Jiroutová, Kateřina; Jorgensen, R. E.; Joubert, Y.; Kaplan, A.; Kröger, N.; Kroth, P. G.; La Roche, J.; Lindquist, E.; Lommer, M.; Martin–Jézéquel, V.; Lopez, P. J.; Lucas, S.; Mangogna, M.; McGinnis, K.; Medlin, L. K.; Montsant, A.; Oudot–Le Secq, M.-P.; Napoli, C.; Oborník, Miroslav; Schnitzler Parker, M.; Petit, J.-L.; Porcel, B. M.; Poulsen, N.; Robison, M.; Rychlewski, L.; Rynearson, T. A.; Schmutz, J.; Shapiro, H.; Siaut, M.; Stanley, M.; Sussman, M. R.; Taylor, A. R.; Vardi, A.; von Dassow, P.; Vyverman, W.; Willis, A.; Wyrwicz, L. S.; Rokhsar, D. S.; Weissenbach, J.; Armbrust, E. V.; Green, B. R.; Van de Peer, Y.; Grigoriev, I. V.
2008-01-01
Roč. 456, 13-11-2008 (2008), s. 239-244 ISSN 0028-0836 Institutional research plan: CEZ:AV0Z60220518 Keywords : Phaeodactylum * genome * evolution * diatom Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.434, year: 2008
Fractional M-band dual tree complex wavelet transform for digital ...
Indian Academy of Sciences (India)
image fusion for copy protection or water marking robust tagging applications. They considered ..... to enhance the performance and security of the images. Most of the SVD .... J. Network Computer Applications 24(4): 167–173. Dong Zheng ...
Czech Academy of Sciences Publication Activity Database
Stickley, A.; Koyanagi, A.; Koposov, R.; Blatný, Marek; Hrdlička, M.; Schwab-Stone, M.; Ruchkin, V.
2016-01-01
Roč. 16, MAY (2016), s. 1-11, č. článku 128. ISSN 1471-244X Institutional support: RVO:68081740 Keywords : Adolescent * Correlates * Loneliness * Somatic symptoms Subject RIV: AN - Psychology Impact factor: 2.613, year: 2016
Z dependence of the N=152 deformed shell gap: In-beam γ-ray spectroscopy of neutron-rich 245,246Pu
International Nuclear Information System (INIS)
Makii, H.; Ishii, T.; Asai, M.; Tsukada, K.; Toyoshima, A.; Ichikawa, S.; Matsuda, M.; Makishima, A.; Kaneko, J.; Toume, H.; Shigematsu, S.; Kohno, T.; Ogawa, M.
2007-01-01
We have measured in-beam γ rays in the neutron-rich 246 Pu 152 and 245 Pu 151 nuclei by means of 244 Pu( 18 O, 16 O) 246 Pu and 244 Pu( 18 O, 17 O) 245 Pu neutron transfer reactions, respectively. The γ rays emitted from 246 Pu ( 245 Pu) were identified by selecting the kinetic energy of scattered 16 O ( 17 O) detected by Si ΔE-E detectors. The ground-state band of 246 Pu was established up to the 12 + state. We have found that the shell gap of N=152 is reduced in energy with decreasing atomic number by extending the systematics of the one-quasiparticle energies in N=151 nuclei into those in 245 Pu. This reduction of the shell gap clearly affects the 2 + energy of the ground-state band of 246 Pu
Nutrition support in hospitalised adults at nutritional risk
DEFF Research Database (Denmark)
Feinberg, Joshua; Nielsen, Emil Eik; Korang, Steven Kwasi
2017-01-01
International Clinical Trials Registry Platform (www.who.int/ictrp); ClinicalTrials.gov; Turning Research Into Practice (TRIP); Google Scholar; and BIOSIS, as well as relevant bibliographies of review articles and personal files. All searches are current to February 2016. SELECTION CRITERIA: We include...... methodology. Our primary outcomes were all-cause mortality, serious adverse events, and health-related quality of life. MAIN RESULTS: We included 244 randomised clinical trials with 28,619 participants that met our inclusion criteria. We considered all trials to be at high risk of bias. Two trials accounted...... experimental intervention (12 trials); general nutrition support (9 trials); and fortified food (2 trials). The control interventions were treatment as usual (122 trials); no intervention (107 trials); and placebo (15 trials). In 204/244 trials, the intervention lasted three days or more.We found no evidence...
International Nuclear Information System (INIS)
Pereira, L.; Saraiva, I. H.; Coelho, R.; Newman, D. K.; Louro, R. O.; Frazão, C.
2012-01-01
Crystals of the R. ferrooxidans SW2 iron oxidoreductase FoxE were obtained and the phase problem was solved by Fe SAD at 2.44 Å resolution. FoxE is a protein encoded by the foxEYZ operon of Rhodobacter ferrooxidans SW2 that is involved in Fe II -based anoxygenic photosynthesis (‘photoferrotrophy’). It is thought to reside in the periplasm, where it stimulates light-dependent Fe II oxidation. It contains 259 residues, including two haem c-binding motifs. As no three-dimensional model is available and there is no structure with a similar sequence, crystals of FoxE were produced. They diffracted to 2.44 Å resolution using synchrotron radiation at the Fe edge. The phase problem was solved by SAD using SHELXC/D/E and the experimental maps confirmed the presence of two haems per molecule
DEFF Research Database (Denmark)
Rakhshan, Pamela; Sørensen, Holger Jelling; DeVylder, Jordan
2016-01-01
Motor abnormalities have been established as a core aspect of psychosis-spectrum disorders, with numerous studies identifying deficits prior to clinical symptom presentation. Additional research is needed to pinpoint standardized motor assessments associated with psychosis-spectrum disorders prior...... to illness onset to enhance prediction and understanding of etiology. With a long history of findings among people with diagnosable psychosis-spectrum disorders, but little research conducted during the premorbid phase, pegboard tasks are a viable and understudied measure of premorbid for psychosis motor......-spectrum disorder (n=33) were less likely to successfully complete the task within time limit relative to controls (χ(2)(2, N=244)=6.94, p=0.03, ϕ=0.17). Additionally, children who eventually developed a psychosis-spectrum disorder took significantly longer to complete the task relative to controls (χ(2)(2, N=244...
Analysis and application of heavy isotopes in the environment
Steier, Peter; Dellinger, Franz; Forstner, Oliver; Golser, Robin; Knie, Klaus; Kutschera, Walter; Priller, Alfred; Quinto, Francesca; Srncik, Michaela; Terrasi, Filippo; Vockenhuber, Christof; Wallner, Anton; Wallner, Gabriele; Wild, Eva Maria
2010-04-01
A growing number of AMS laboratories are pursuing applications of actinides. We discuss the basic requirements of the AMS technique of heavy (i.e., above ˜150 amu) isotopes, present the setup at the Vienna Environmental Research Accelerator (VERA) which is especially well suited for the isotope 236U, and give a comparison with other AMS facilities. Special emphasis will be put on elaborating the effective detection limits for environmental samples with respect to other mass spectrometric methods. At VERA, we have carried out measurements for radiation protection and environmental monitoring ( 236U, 239,240,241,242,244Pu), astrophysics ( 182Hf, 236U, 244Pu, 247Cm), nuclear physics, and a search for long-lived super-heavy elements ( Z > 100). We are pursuing the environmental distribution of 236U, as a basis for geological applications of natural 236U.
Analysis and application of heavy isotopes in the environment
International Nuclear Information System (INIS)
Steier, Peter; Dellinger, Franz; Forstner, Oliver; Golser, Robin; Knie, Klaus; Kutschera, Walter; Priller, Alfred; Quinto, Francesca; Srncik, Michaela; Terrasi, Filippo; Vockenhuber, Christof; Wallner, Anton; Wallner, Gabriele; Wild, Eva Maria
2010-01-01
A growing number of AMS laboratories are pursuing applications of actinides. We discuss the basic requirements of the AMS technique of heavy (i.e., above ∼150 amu) isotopes, present the setup at the Vienna Environmental Research Accelerator (VERA) which is especially well suited for the isotope 236 U, and give a comparison with other AMS facilities. Special emphasis will be put on elaborating the effective detection limits for environmental samples with respect to other mass spectrometric methods. At VERA, we have carried out measurements for radiation protection and environmental monitoring ( 236 U, 239,240,241,242,244 Pu), astrophysics ( 182 Hf, 236 U, 244 Pu, 247 Cm), nuclear physics, and a search for long-lived super-heavy elements (Z > 100). We are pursuing the environmental distribution of 236 U, as a basis for geological applications of natural 236 U.
Remote micro-encapsulation of curium-gold cermets
International Nuclear Information System (INIS)
Coops, M.S.; Voegele, A.L.; Hayes, W.N.; Sisson, D.H.
1980-01-01
A technique is described for fabricating minature, high-density capsules of curium-244 oxide contained in three concentric jackets of metallic gold (or silver), with the outer surface being free of alpha contamination. The completed capsules are right circular cylinders 0.2500-inch diameter and 0.125-inch tall, with each level of containment soldered (or brazed) closed. A typical capsule would contain approx. 70 mg of 244 Cm (5.7 Ci) mixed with 120 mg of gold powder in the form of a cermet wafer clad in three concentric, 0.010-inch thick, liquid tight jackets. This method of fabrication eliminates voids between the jackets and produces a minimum size, maximum density capsule. Cermet densities of 11.5 g/cc were obtained, with an overall density of 17.3 g/cc for the finished capsule
Blake, D. F.; Sarrazin, P.; Thompson, Kathleen
2017-01-01
The MapX imaging X-ray spectrometer is described and Monte Carlo modeling is used to show the efficacy of 244-Cm radioisotope sources in detecting and quantifying the biogenic elements in ices on Ocean Worlds such as Europa.
HIV self-testing practices among Health Care Workers: feasibility ...
African Journals Online (AJOL)
HIV self-testing practices among Health Care Workers: feasibility and options for ... is required to increase the rate of HIV testing and expand treatment services. ... 244(80%) of the HCWs had motivation or interest to be tested by themselves.
2010-01-12
... DEPARTMENT OF TRANSPORTATION Research and Innovative Technology Administration University..., Office of Research, Development and Technology, RDT-30, Research and Innovative Technology Administration... amended by Pub. L. 110-244) requires the Research and Innovative Technology Administration (RITA) of the U...
Czech Academy of Sciences Publication Activity Database
Sobotková, Veronika; Osecká, Terezie; Jelínek, Martin; Blatný, Marek; Hrdlička, M.
2012-01-01
Roč. 56, č. 5 (2012), s. 409-419 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : antisocial behavior * exposure to violence * school bullying Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Psychologické souvislosti ekonomické recese
Czech Academy of Sciences Publication Activity Database
Šolcová, Iva; Slezáčková, Alena; Franková, E.; Greenglass, E.
2012-01-01
Roč. 56, č. 1 (2012), s. 64-72 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : economic recession * unemployment * financial strain * mental state Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
7 CFR 2.44 - Administrator, Risk Management Agency and Manager, Federal Crop Insurance Corporation.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Risk Management Agency and Manager... Secretary for Farm and Foreign Agricultural Services to the Administrator, Risk Management Agency, and... for the transaction of the business of the Federal Crop Insurance Corporation and the Risk Management...
Contact Problem of Disk on Shaft Fixed by Induction Shrink Fit
Czech Academy of Sciences Publication Activity Database
Ulrych, B.; Kotlan, V.; Doležel, Ivo
2012-01-01
Roč. 88, 12B (2012), s. 32-34 ISSN 0033-2097 Institutional research plan: CEZ:AV0Z20760514 Keywords : induction shrink fit * contact problem * transfer of torque Subject RIV: BA - General Mathematics Impact factor: 0.244, year: 2011
Dicty_cDB: Contig-U10415-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ormation vector pOKE104, com... 243 9e-63 EF106972_17( EF106972 |pid:none) Uncultur...ecName: Full=3-methyl-2-oxobutanoate hydroxymethyltran... 244 4e-63 FJ599664_2( FJ599664 |pid:none) Transf
African Journals Online (AJOL)
abp
2013-06-09
Jun 9, 2013 ... Health Officer, Nurses, Midwives and Laboratory students, and health ... though 244(80%) of the HCWs had motivation or interest to be tested by themselves. ..... travel to distant places for VCT as they feel that VCT at their own.
effect of the whistle watch device on bronchodilator use in children ...
African Journals Online (AJOL)
The patients acted as their own controls, switching over to the other ... relatively expensive (present cost approximately R90 - R200),' and are not ... failed to comply with the study instructions after two attempts ... standard deviation (SD) ± 2.44).
Episodic memory for human-like agents and human-like agents for episodic memory
Czech Academy of Sciences Publication Activity Database
Brom, C.; Lukavský, Jiří; Kadlec, R.
2010-01-01
Roč. 2, č. 2 (2010), s. 227-244 ISSN 1793-8473 Institutional research plan: CEZ:AV0Z70250504 Keywords : episodic memory * virtual agent * modelling Subject RIV: AN - Psychology http://www.worldscinet.com/ijmc/02/0202/S1793843010000461.html
Yeo, Ronald A.; Ryman, Sephira G.; Thompson, Melissa E.; van den Heuvel, Martijn P.; de Reus, Marcel A.; Pommy, Jessica; Seaman, Brandi; Jung, Rex E.
2016-01-01
An important dimension of individual differences, independent of general cognitive ability (GCA), is specialization for verbal or spatial ability. In this study we investigated neuroanatomic, network, and personality features associated with verbal vs. spatial ability. Healthy young adults (N = 244)
355-nm hypersensitization of optical fibers
Canagasabey, A.; Canning, J.; Groothoff, N.
2003-01-01
A study is presented on 355-nm hypersensitization of optical fibers. It is found that the intrinsic 244-nm photosensitivity of boron-codoped germanosilicate optical fibers is enhanced by 355-nm hypersensitization. Hypersensitization through standard polymer coating is also demonstrated.
Czech Academy of Sciences Publication Activity Database
Pravec, Petr; Harris, A. W.; Scheirich, Peter; Kušnirák, Peter; Kotková, Lenka; Hergenrother, C.; Mottola, S.; Hicks, M. D.; Masi, G.; Krugly, Yu. N.; Shevchenko, V. G.; Nolan, M. C.; Howell, E. S.; Kaasalainen, M.; Galád, Adrián; Brown, P.; DeGraff, D. R.; Lambert, J.V.; Cooney, W.R.; Foglia, S.
2005-01-01
Roč. 1, č. 173 (2005), s. 108-131 ISSN 0019-1035 R&D Projects: GA AV ČR IAA3003204 Keywords : near-Earth objects * fast-rotating asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.244, year: 2005
Eesõigustatud merevõlad ja priviligeeritud nõuded Eesti Vabariigi seadusandluses / Indra Kaunis
Kaunis, Indra, 1966-
1995-01-01
1926. a. rahvusvahelise konventsiooni (Eesõigustatud merevõlgade ja merehüpoteekide kohta käivate määruste ühtlustamise rahvusvaheline konventsioon, RT 1928, 42, 244) ja Eesti Kaubandusliku Meresõidu Koodeksi (RT 1991, 46-48, 577) vastuoludest
semi-dwarf tef lines for high seed yield and lodging tolerance
African Journals Online (AJOL)
ACSS
Three genotypes, namely RIL- 91, RIL-244 and RIL-11, gave the highest seed yield, ranging between 4.4 to 4.7 t ha-1, compared to .... lodging tolerant tef varieties, adapting to the changing ..... moisture stress areas (Tsedey) was grouped.
Motivational structure and alcohol use of university students across four nations
Cox, W. Miles; Schippers, Gerard M.; Klinger, Eric; Skutle, Arvid; Stuchlíková, Iva; Man, Frantisek; King, Amy L.; Inderhaug, Ragnhild
2002-01-01
OBJECTIVE: The ability of motivational structure and other variables to predict alcohol consumption was assessed in university students (N = 370; 244 women) in the Czech Republic, The Netherlands, Norway and the United States. METHOD: Motivational structure was assessed with the Motivational
Seasonal pharmacological properties and alkaloid content in Cyrtanthus contractus NE Br
Czech Academy of Sciences Publication Activity Database
Ncube, B.; Nair, J. J.; Rárová, Lucie; Strnad, Miroslav; Finnie, J.F.; van Staden, J.
2015-01-01
Roč. 97, MAR 2015 (2015), s. 69-76 ISSN 0254-6299 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Acetylcholinesterase * Alkaloids * Cyrtanthus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.244, year: 2015
Czech Academy of Sciences Publication Activity Database
Matějec, Vlastimil; Bartoň, Ivo; Mrázek, Jan; Podrazký, Ondřej
2014-01-01
Roč. 27, May (2014), s. 244-252 ISSN 2306-8515 R&D Projects: GA ČR GAP102/12/2361 Institutional support: RVO:67985882 Keywords : Toluene detection * Photocatalytic decomposition * U-Shaped fiber Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Minor Actinides Recycling in PWRs
International Nuclear Information System (INIS)
Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.
2006-01-01
Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)
Aerospace Medicine and Biology. A continuing bibliography with indexes
1982-01-01
This bibliography lists 244 reports, articles, and other documents introduced into the NASA scientific and technical information system in February 1981. Aerospace medicine and aerobiology topics are included. Listings for physiological factors, astronaut performance, control theory, artificial intelligence, and cybernetics are included.
2006-06-01
elites are not particularly threatened by democraticization” since the institutions required to run the democracy “are already well established before... Philanthropy website, http://www.covekoljublje.org/proj_completed.htm (accessed 18 May 2006). 244 “More Ethnic Fighting in Kosovo Leaves Thousands
Attentional Bias for Emotional Stimuli in Borderline Personality Disorder : A Meta-Analysis
Kaiser, D.; Jacob, G.A.; Domes, G.; Arntz, A.
2016-01-01
Background: In borderline personality disorder (BPD), attentional bias (AB) to emotional stimuli may be a core component in disorder pathogenesis and maintenance. Sampling: 11 emotional Stroop task (EST) studies with 244 BPD patients, 255 nonpatients (NPs) and 95 clinical controls and 4 visual
The occurrence of PPV in cherry trees in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Navrátil, M.; Šafářová, D.; Fanigliulo, A.; Comes, S.; Petrzik, Karel; Karešová, R.
2004-01-01
Roč. 657, - (2004), 237-244 ISSN 0567-7572 R&D Projects: GA MZe(CZ) NAZV QD1407 Institutional research plan: CEZ:AV0Z5051902 Keywords : Plum pox virus * Prunus avium * sweet cherry cultivars * ELISA * RT-PCR Subject RIV: EE - Microbiology, Virology
In this section of Resonance, we invite readers to pose questions ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 3. Optimization of the Anderson Bridge Experiment. P Arun Kuldeep Kumar Mamta. Classroom Volume 15 Issue 3 March 2010 pp 244-256. Fulltext. Click here to view fulltext PDF. Permanent link:
Czech Academy of Sciences Publication Activity Database
Eichlerová, Ivana; Homolka, Ladislav; Tomšovský, M.; Lisá, Ludmila
2015-01-01
Roč. 119, č. 12 (2015), s. 1345-1353 ISSN 1878-6146 R&D Projects: GA ČR GAP504/12/0709 Institutional support: RVO:61388971 Keywords : Basidiomycetes * Cryopreservant * Liquid nitrogen Subject RIV: EE - Microbiology, Virology Impact factor: 2.244, year: 2015
Big Rock Point Nuclear Plant. Annual operating report for 1976
International Nuclear Information System (INIS)
1977-01-01
Net electrical power generated was 244,492.9 MWH with the reactor on line 4,405 hrs. Information is presented concerning operations, power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, release of radioactive materials, reportable occurrences, and fuel performance
UAV-Based Optical Granulometry as Tool for Detecting Changes in Structure of Flood Depositions
Czech Academy of Sciences Publication Activity Database
Langhammer, J.; Lendzioch, T.; Miřijovský, J.; Hartvich, Filip
2017-01-01
Roč. 9, č. 3 (2017), č. článku UNSP 240. ISSN 2072-4292 Institutional support: RVO:67985891 Keywords : granulometry * UAV * photogrammetry * fluvial geomorphology * alluvial sediment Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Physical geography Impact factor: 3.244, year: 2016
Aerospace medicine and biology. A continuing bibliography with indexes
International Nuclear Information System (INIS)
1982-03-01
This bibliography lists 244 reports, articles, and other documents introduced into the NASA scientific and technical information system in February 1981. Aerospace medicine and aerobiology topics are included. Listings for physiological factors, astronaut performance, control theory, artificial intelligence, and cybernetics are included
Schaap-Jonker, Hanneke; Eurelings-Bonekoe, Elisabeth E.M.; Jonker, Evert R.; Zock, Hetty
2008-01-01
This article presents the Dutch Questionnaire God Image (QGI), which has two theory-based dimensions: feelings towards God and perceptions of God’s actions. This instrument was validated among a sample of 804 respondents, of which 244 persons received psychotherapy. Results showed relationships
Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti
Czech Academy of Sciences Publication Activity Database
Ďurďovič, Martin
2014-01-01
Roč. 36, č. 3 (2014), s. 259-281 ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281
African Journals Online (AJOL)
USER
2016-12-13
Dec 13, 2016 ... processors produced 10kg shea butter each from 50kg shea nuts in a week. Hence, the technical ... a substitute for cocoa butter in the chocolate and ..... America. Journal of Humanities and Social. Science. 1(4);244-250. Doi:.
Czech Academy of Sciences Publication Activity Database
Tarkowská, Danuše; Strnad, Miroslav
2016-01-01
Roč. 244, č. 3 (2016), s. 545-555 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Phytoecdysteroids * Ecdysteroids * 20-Hydroxyecdysone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.361, year: 2016
Lifescience Database Archive (English)
Full Text Available H01327 Herpangina Herpangina is a vesicular exanthem of the fauces and soft palate...ot-mouth disease and herpangina caused by enterovirus 71 in Taiwan, 1998-2005. ... JOURNAL ... Pediatrics 120:e244-52 (2007) DOI:10.1542/peds.2006-3331
Update on alternative occupant volume testing
2010-04-27
This paper describes the conduct of the first of a series of quasi-static compression tests of rail passenger equipment being done to examine occupant volume strength. Budd Pioneer car 244 has been chosen as the test article for examination of altern...
Oil-Impregnated Oxide Nanostructures for Aluminum Corrosion Prevention
2017-12-18
Surfaces Based on Inverse Colloidal Monolayers. Nat. Commun. 2013, 4, 10. 25. Rykaczewski, K.; Anand, S.; Subramanyam, S. B.; Varanasi, K. K...conditions. Part II: Electrochemical responses. Surf. Coat. Technol. 2002,153 (2-3), 235-244. 44. Mansfeld, F., Simultaneous Determination of
Czech Academy of Sciences Publication Activity Database
Nestola, E.; Calfapietra, Carlo; Emmerton, C. A.; Wrong, Ch. Y. S.; Thayer, D. R.; Gamon, J. A.
2016-01-01
Roč. 8, č. 3 (2016), č. článku 260. ISSN 2072-4292 Institutional support: RVO:67179843 Keywords : grassland * NDVI * CO2 flux * optical remote sensing * LUE model * gap filling Subject RIV: EH - Ecology, Behaviour Impact factor: 3.244, year: 2016
Human brain evolution, theories of innovation, and lessons from the ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 29; Issue 3. Human brain evolution, theories of innovation, and lessons from the history of technology. Alfred Gierer. Perspectives Volume 29 Issue 3 September 2004 pp 235-244. Fulltext. Click here to view fulltext PDF. Permanent link:
Prevalence and antibiotic susceptibility patterns of nasal bacterial ...
African Journals Online (AJOL)
The Kirby-Bauer disk diffusion method was employed for antibiotic sensitivity testing of the confirmed isolates following Clinical and Laboratory Standards Institutes (CLSI) Guidelines. The following organisms were identified: Staphylococcus aureus, 43.6%; Klebsiella species, 24.4%; Citrobacter species, 12.8%; Proteus ...
Czech Academy of Sciences Publication Activity Database
Conrad, K.; Motyka, Václav; Bernhardt, R.; Stein, C.
2015-01-01
Roč. 99, JUL 2015 (2015), s. 54-61 ISSN 0254-6299 R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Chloride * Chlorophylls * Common reed Subject RIV: EF - Botanics Impact factor: 1.244, year: 2015
Czech Academy of Sciences Publication Activity Database
Svoboda, Martin; Lísal, Martin; Limpouchová, Z.; Procházka, Karel
2018-01-01
Roč. 23, č. 3 (2018), s. 244-251 ISSN 1023-666X R&D Projects: GA ČR GA15-19542S Institutional support: RVO:67985858 Keywords : vapor-pressure osmometry * simulation * solvatation Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry
Data of evolutionary structure change: 1BBDH-1RUPH [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1BBDH-1RUPH 1BBD 1RUP H H EVQLQQSGAELVRPGASVKLSCTTSGFNIKD-IYIHWVK... TYR CA 326 TRP CA 346 1RUP... H 1RUPH LLWYDGGAGSW...e>VAL CA 244 THR CA 303 LEU CA 370 1RUP... H 1RUPH LAPVCGDTTGSSVTL
International Nuclear Information System (INIS)
Nakai, K.; Yamamoto, T.; Aiyama, H.; Takada, T.; Yoshida, F.; Kageji, T.; Kumada, H.; Isobe, T.; Endo, K.; Matsuda, M.; Tsurubuchi, T.; Shibata, Y.; Takano, S.; Mizumoto, M.; Tsuboi, K.; Matsumura, A.
2011-01-01
Eight patients to received Boron Neutron Capture Therapy (BNCT) were selected from 33 newly diagnosed glioblastoma patients (NCT(+) group). Serial 42 glioblastoma patients (NCT(−) group) were treated without BNCT. The median OS of the NCT(+) group and NCT (−) group were 24.4 months and 14.9 months. In the high risk patients (RPA class V), the median OS of the NCT(+) group tended to be better than that of NCT(−) group. 50% of BNCT patients were RPA class V. - Highlights: ► We treated 8 patients with boron neutron capture therapy (NCT) for glioblastoma. ► We compare the overall survival between NCT including series and without NCT series. ► The median overall survival of the NCT including series was 24.4 months. ► In the high risk patients, the median OS of NCT including series tended to be better.
El-Magd, Mohammed Abu; Saleh, Ayman A; Abdel-Hamid, Tamer M; Saleh, Rasha M; Afifi, Mohammed A
2016-10-01
Chicken growth hormone secretagogue receptor (GHSR) is a receptor for ghrelin (GHRL), a peptide hormone produced by chicken proventriculus, which stimulates growth hormone (GH) release and food intake. The purpose of this study was to search for single nucleotide polymorphisms (SNPs) in exon 2 of GHSR gene and to analyze their effect on the appetite, growth traits and expression levels of GHSR, GHRL, and GH genes as well as serum levels of GH and GHRL in Mandara chicken. Two adjacent SNPs, A239G and G244A, were detected in exon 2 of GHSR gene. G244A SNP was non-synonymous mutation and led to replacement of lysine amino acid (aa) by arginine aa, while A239G SNP was synonymous mutation. The combined genotypes of A239G and G244A SNPs produced three haplotypes; GG/GG, GG/AG, AG/AG, which associated significantly (P4 to 16w. Chickens with the homozygous GG/GG haplotype showed higher growth performance than other chickens. The two SNPs were also correlated with mRNA levels of GHSR and GH (in pituitary gland), and GHRL (in proventriculus and hypothalamus) as well as with serum level of GH and GHRL. Also, chickens with GG/GG haplotype showed higher mRNA and serum levels. This is the first study to demonstrate that SNPs in GHSR can increase appetite, growth traits, expression and level of GHRL, suggesting a hunger signal role for endogenous GHRL. Copyright © 2016 Elsevier Inc. All rights reserved.
A biokinetic model of inhaled Cm compounds in dogs: Application to human exposure data
International Nuclear Information System (INIS)
Guilmette, R.A.; Mewhinney, J.A.
1989-01-01
Curium isotopes are major by-products in irradiated nuclear reactor fuel and comprise a significant fraction of the alpha-emitting radionuclide inventory. Although little use is currently being made of purified Cm sources, such usage is possible if reprocessing of spent fuel becomes feasible. Because little information is available on the biokinetics and dosimetry of inhaled Cm compounds, a study was conducted in which adult beagle dogs received a single inhalation exposure to either a monodisperse aerosol of 244Cm2O3 (1.4 micron activity median aerodynamic diameter [AMAD]; sigma g = 1.16) or a polydisperse aerosol of 244Cm (NO3)3 (1.1 micron AMAD; sigma g = 1.74). At times ranging from 4 h to 2 y after exposure, animals were sacrificed and their tissues analyzed for Cm content. The data describing the uptake and retention of 244Cm in the different organs and tissues and the measured rates of excretion of these dogs formed the basis on which a biokinetic model of Cm metabolism was constructed. This Cm model was based on a previously published model of the biokinetics of 241Am that was shown to be applicable to data from human cases of inhalation exposure to 241Am aerosols. This Cm model was found to be adequate to describe the biological distribution of Cm in dogs and was also applied to the sparse data from humans. Reasonable agreement was found between the model predictions for lung retention of Cm and for urinary excretion patterns in humans
SAH Gene Variants Revisited in the European Project on Genes in Hypertension
Czech Academy of Sciences Publication Activity Database
Tikhonoff, V.; Staessen, J.A.; Kuznetsova, T.; Thijs, L.; Hasenkamp, S.; Stolarz, K.; Seidlerová, J.; Filipovský, J.; Nikitin, Y.; Peleška, Jan; Kawecka-Jaszcz, K.; Casiglia, E.; Brand-Herrmann, S.M.; Brand, E.
2008-01-01
Roč. 26, č. 2 (2008), s. 244-250 ISSN 0263-6352 Institutional research plan: CEZ:AV0Z10300504 Keywords : body mass index * hypertension * population study * SAH gene * serum lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 5.132, year: 2008
Dairy Products, Dietary Calcium, and Risk of Inflammatory Bowel Disease
DEFF Research Database (Denmark)
Opstelten, Jorrit L; Leenders, Max; Dik, Vincent K
2016-01-01
, yogurt, and cheese) and dietary calcium was measured using validated food frequency questionnaires. Cases developing incident CD (n = 110) or UC (n = 244) during follow-up were matched with 4 controls. Conditional logistic regression analyses were used to calculate odds ratios (ORs) with 95% confidence...
Can voltammetry distinguish glycan isomers?
Czech Academy of Sciences Publication Activity Database
Trefulka, Mojmír; Paleček, Emil
2015-01-01
Roč. 69, č. 1 (2015), s. 241-244 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GAP301/11/2055 Institutional support: RVO:68081707 Keywords : oligosaccharide isomers * Os(VI) complexes * chemical modification Subject RIV: BO - Biophysics Impact factor: 1.326, year: 2015
an ecophysiological study of the meiofauna of the swartkops estuary ...
African Journals Online (AJOL)
75% and 24,4%. It is concluded that meiofauna in these exposed sand and mud flat areas is not quantitatively important, but the qualitative importance may be .... which occurred in very low numbers, the expression is: '02 = 2,9784 X 10-2 N' I ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Mamta. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 244-256 Classroom. Optimization of the Anderson Bridge Experiment · P Arun Kuldeep Kumar Mamta · More Details Fulltext PDF ...
Mizan Law Review - Vol 10, No 1 (2016)
African Journals Online (AJOL)
Notes: Public Consultation toward Ethiopia's Family Law Reform and the Revised Code's Response · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mandefrot Belay, 244-264. http://dx.doi.org/10.4314/mlr.v10i1.8 ...
Czech Academy of Sciences Publication Activity Database
Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.
2010-01-01
Roč. 122, č. 2 (2010), e244 ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardioloy * myocardial infarction * in-hospital mortality Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery
Delimitation of cryptic species inside Claviceps purpurea
Czech Academy of Sciences Publication Activity Database
Pažoutová, Sylvie; Pešicová, Kamila; Chudíčková, Milada; Šrůtka, P.; Kolařík, Miroslav
2015-01-01
Roč. 119, č. 1 (2015), s. 7-26 ISSN 1878-6146 R&D Projects: GA ČR(CZ) GA13-00788S Institutional support: RVO:61388971 Keywords : C. arundinis * C. humidiphila * C. microcephala Subject RIV: EE - Microbiology, Virology Impact factor: 2.244, year: 2015
Deprese z pohledu psychologie osobních konstruktů
Czech Academy of Sciences Publication Activity Database
Kovářová, Marie; Filip, Miroslav
2012-01-01
Roč. 56, č. 5 (2012), s. 435-447 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : depression * psychology of personal constructs * psychotherapy Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Powdery Mildew Resistance in 268 Entries of Hordeum vulgare
DEFF Research Database (Denmark)
Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J
1984-01-01
A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...
Lynn, Richard; Vanhanen, Tatu
2012-01-01
This paper summarizes the results of 244 correlates of national IQs that have been published from 2002 through 2012 and include educational attainment, cognitive output, educational input, per capita income, economic growth, other economic variables, crime, political institutions, health, fertility, sociological variables, and geographic and…
Czech Academy of Sciences Publication Activity Database
Mareš, Pavel
2010-01-01
Roč. 92, 2-3 (2010), s. 244-248 ISSN 0920-1211 R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : zonisamide * pentylenetetrazol * ontogeny Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.302, year: 2010
Czech Academy of Sciences Publication Activity Database
Komrsková, Daniela; Lojek, Antonín; Hrbáč, J.; Číž, Milan
2006-01-01
Roč. 21, č. 4 (2006), s. 239-244 ISSN 1522-7235 R&D Projects: GA ČR(CZ) GA524/01/1219 Institutional research plan: CEZ:AV0Z50040507 Keywords : antioxidant capacity * luminometry Subject RIV: BO - Biophysics Impact factor: 0.874, year: 2006
checkCIF/PLATON report Datablock: 1
Indian Academy of Sciences (India)
Moiety formula C33 H27 I ? .... 3.5 Ratio. PLAT244_ALERT_4_C Low 'Solvent' Ueq as Compared to ... PLAT043_ALERT_1_C Calculated and Reported Mol. ..... outliers and unusual parameters, but every test has its limitations and alerts that ...
78 FR 55641 - Polyurethane-Type Polymers; Tolerance Exemption
2013-09-11
...-Type Polymers; Tolerance Exemption AGENCY: Environmental Protection Agency (EPA). ACTION: Final rule... polymers produced by the reaction of either 1,6-hexanediisocyanate; 2,4,4-trimethyl-1,6-hexanediisocyanate... (also known as polyurethane-type polymers), when used as an inert ingredient in a pesticide chemical...
1999-01-01
Maine: Ecotoxicology and Environmental Safety, v. 25, no. 2, p. 244-252. 43 Gleich, J.G., 1972, Terrestrial gastropods from central Maine... macrophytes for our evaluation; because birds are not a focus of NAWQA activities, studies exclusively concerning waterfowl were not presented in this
On the Increasing Fragility of Human Teeth with Age: ADeep-Ultraviolet Resonance Raman Study
Energy Technology Data Exchange (ETDEWEB)
Ager III, J.W.; Nalla, R.K.; Balooch, G.; Kim, G.; Pugach, M.; Habelitz, S.; Marshall, G.W.; Kinney, J.H.; Ritchie, R.O.
2006-07-14
Ultraviolet resonance Raman spectroscopy (UVRRS) using 244nm excitation was used to investigate the impact of aging on humandentin. The intensity of a spectroscopic feature from the peptide bondsin the collagen increases with tissue age, similar to a finding reportedpreviously for human cortical bone.
DEFF Research Database (Denmark)
Illemann, Martin; Laerum, Ole Didrik; Hasselby, Jane Preuss
2014-01-01
Patients were identified from a population-based prospective study of 4990 individuals with symptoms associated with colorectal cancer (CRC). A total of 244 CRC tissue samples were available for immunohistochemical staining of uPAR, semiquantitatively scored at the invasive front, and in the tumo...
Improving index mutual fund risk perception : Increase financial literacy or communicate better?
de Goeij, Peter; Van Campenhout, Geert; Subotic, Marjana
2017-01-01
We investigate the effect of financial literacy and index mutual fund risk disclosure format on investors’ risk perception by examining the risk disclosure part in the Key Investor Information Document (KIID) for UCITS funds in Europe. Using an experimental survey administered to 244 university
STD care in the South African private health sector | Schneider ...
African Journals Online (AJOL)
Objectives. To establish the accessibility and quality of sexually transmitted disease (SID) care provided by private general practitioners (GPs) and workplace health services in South Africa. Design. Structured telephone interviews were conducted with a random national sample of 120 GPs and 244 occupational health ...
Czech Academy of Sciences Publication Activity Database
Binó, Lucia; Kučera, J.; Štefková, K.; Šindlerová, Lenka; Lanová, M.; Kudová, J.; Kubala, Lukáš; Pachernik, J.
2016-01-01
Roč. 244, JAN2016 (2016), s. 204-214 ISSN 0009-2797 R&D Projects: GA MŠk(CZ) EE2.3.30.0030 Institutional support: RVO:68081707 Keywords : Hypoxia * HIF-1 * Prolyl hydroxylase Subject RIV: BO - Biophysics Impact factor: 3.143, year: 2016
Labor supply consequences of family taxation: evidence from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Kalíšková, Klára
2014-01-01
Roč. 30, October (2014), s. 234-244 ISSN 0927-5371 R&D Projects: GA ČR GB14-36154G Institutional support: RVO:67985998 Keywords : joint tax ation * labor supply * diffrence-in-differences Subject RIV: AH - Economics Impact factor: 0.916, year: 2014
Data of evolutionary structure change: 1BY7A-9APIA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1BY7A-9APIA 1BY7 9API A A ----EDLCVANTLFALNLFKHLAKASPTQNLFLSPWSIS...> ASP CA 226 LYS CA 244 ILE CA 368 9API... A 9APIA FNLTEIPEAQI PRO CA 256 PHE CA 330 9API... A 9APIA RPFEVKDTEEED
Disentangling task and contextual performance : a multitrait-multimethod approach
Demerouti, E.; Xanthopoulou, D.; Tsaousis, I.; Bakker, A.B.
2014-01-01
This study among 244 employees and their colleagues working in various sectors investigated the dimensionality of self-ratings and peer-ratings of task and contextual performance, using the scales of Goodman and Svyantek (1999). By applying the multitrait-multimethod approach, we examined the degree
Capture and dissipation in the superheavy region
Energy Technology Data Exchange (ETDEWEB)
Materna, T. E-mail: tmaterna@ulb.ac.be; Aritomo, Y.; Amar, N.; Bogatchev, A.; Bouchat, V.; Dorvaux, O.; Giardina, G.; Grevy, S.; Hanappe, F.; Itkis, I.; Jandel, M.; Knyajeva, G.; Kliman, J.; Kozulin, E.; Kondratiev, N.; Krupa, L.; Peter, J.; Prokhorova, E.; Pokrovsky, I.; Schmitt, C.; Stuttge, L.; Voskresensky, V
2004-04-05
The competition between fusion-fission and quasi-fission in the reactions {sup 48}Ca+{sup 208}Pb and {sup 48}Ca+{sup 244}Pu(E* = 40MeV) is investigated using the pre-scission neutron multiciplicity distributions (PSNMD) obtained with a new analysis protocol.
2013-09-27
...: (970) 244-3049. Email: [email protected] . Persons who use a telecommunications device for the deaf (TDD... variety of planning and management issues associated with the RMP process for the Dominguez- Escalante NCA... topics: recreation, fire management, land-use planning process, invasive species management, travel...
SHORT COMMUNICATION PHYSICOCHEMICAL ATTRIBUTES OF ...
African Journals Online (AJOL)
Preferred Customer
161.29-244.97 mg KOH/g oil) suggest their usefulness in the industry ... peroxide value and iodine value (Wijs' method) were according to AOAC [15]. The ... petroleum, a natural gas, to be in shorter supply [24] and the much stable position of the ...
2015-03-01
officer to befriend the broke, depressed , unemployed, and mentally unbalanced Ferhani and “tricked and coaxed him into a scheme that was completely...Strategic Counterterrorism Communications’ latest YouTube satire of the “Welcome to the ‘Islamic State’ land (ISIS/ISIL).”244 The State Department
African Journals Online (AJOL)
USER
2016-04-08
Apr 8, 2016 ... Ethiopian Journal of Environmental Studies & Management 9 (2): 235 – 244, 2016. ISSN:1998-0507 ... impact of tourism and hospitality industry, taking responsibility towards the silent ... environment related with the concept of ... strategy and daily practice is imperative .... Nigeria case study achieved high.
Low, Sabina; Snyder, James; Shortt, Joann Wu
2012-01-01
Prospective associations of mothers' parenting processes, youth disclosure, and youth problem behavior were examined in a longitudinal design following 244 adolescent sibling dyads over a 3-year period. For both siblings, authoritative parenting was positively associated with youth disclosure and was negatively related to problem behavior, and…
It should not hurt to be a child : prevalence of child maltreatment across the globe
Stoltenborgh, Marije
2012-01-01
In this thesis we describe, combine and compare results of a series of meta-analyses on the prevalence of child sexual, physical, and emotional abuse and of physical and emotional neglect, including 244 publications and 577 prevalence rates for the various types of maltreatment. Child maltreatment
Czech Academy of Sciences Publication Activity Database
Hlaváčková, V.; Krchňák, P.; Nauš, J.; Novák, Ondřej; Špundová, M.; Strnad, Miroslav
2006-01-01
Roč. 225, č. 1 (2006), s. 235-244 ISSN 0032-0935 R&D Projects: GA ČR GA206/05/0894 Institutional research plan: CEZ:AV0Z50380511 Keywords : Abscisic acid * Electrical signals * Gas exchange Subject RIV: CE - Biochemistry Impact factor: 2.963, year: 2006
DEFF Research Database (Denmark)
Gårdsvoll, Henrik; Gilquin, Bernard; Le Du, Marie Hélène
2006-01-01
a comprehensive alanine scanning mutagenesis of uPAR combined with low resolution distance constraints defined within the complex using chemical cross-linkers as molecular rulers. The kinetic rate constants for the interaction between pro-uPA and 244 purified uPAR mutants with single-site replacements were...
The effect of pulmonary tuberculosis on neurocognitive function in ...
African Journals Online (AJOL)
To examine group differences in neurocognitive status, we used Wilcoxon ranked sum tests to compare the performance between groups on neuropsychological test battery. Results: Out of 324, only 244 were studied. Results indicated significant neurocognitive impairment in PTB+/HIV+ group than PTB-/HIV+ in the GDS, ...
Sequence-characterized markers from Begonia x tuberhybrida Voss..
Czech Academy of Sciences Publication Activity Database
Wiesner, Ivo; Wiesnerová, Dana
2008-01-01
Roč. 73, č. 6 (2008), s. 244-247 ISSN 1611-4426 R&D Projects: GA AV ČR 1QS500510566 Institutional research plan: CEZ:AV0Z50510513 Keywords : Begonia * genetic markers Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.300, year: 2008
Performance-vested stock options and interest alignment
Kuang, Y.; Qin, B.
2009-01-01
This paper investigates the effects of performance-vested stock options (PVSOs) in aligning management interests and shareholder wealth. Using 4238 executive-level observations for 1383 executive directors from the largest 244 UK non-financial firms over the 1999-2004 period, we find that the use of
Performance-vested stock options and interest alignment
Kuang, Y.; Qin, B.
2009-01-01
This paper investigates the effects of performance-vested stock options (PVSOs) in aligning management interests and shareholder wealth. Using 4238 executive-level observations for 1383 executive directors from the largest 244 UK non-financial firms over the 1999–2004 period, we find that the use of
Behaviour Profile of Hungarian Adolescent Outpatients with a Dual Diagnosis
Dinya, Elek; Csorba, Janos; Suli, Agota; Grosz, Zsofia
2012-01-01
The behaviour dimensions of 244 Hungarian adolescent psychiatric outpatients with a dual diagnosis (intellectual disability and psychiatric diagnosis) were examined by means of the adapted version of the Behaviour Problem Inventory (BPI, Rojahn, Matson, Lott, Esbensen, & Smalls, 2001). Four IQ subgroups were created: borderline, mild, moderate…
See No Evil: Sexual Abuse of Children by Teachers.
Shoop, Robert J.
1999-01-01
Sexual abuse of students by teachers is a serious problem. A 1998 "Education Week" nationwide study identified 244 cases of inappropriate sexual behavior during one six-month period. Overly affectionate behavior, inappropriate noneducation-related contact, and harassing behaviors are warning signs. Administrators should craft policies, pay…
Gclust Server: 68961 [Gclust Server
Lifescience Database Archive (English)
Full Text Available ace protein required for swimming motility 1 1.00e-06 0.0 0.0 4.0 0.0 0.0 0.0 Show 68961 Cluster ID 68961 Se...quences(244) Sequence length 835 Representative annotation SwmA-cell surface protein required for swimming
An FMRI Study of Olfactory Cues to Perception of Conspecific Stress
2010-04-01
Petrovic P, Ingvar M, Stone-Elander S, Petersson KM, Hansson P (1999) A PET activation study of dynamic mechanical allodynia in patients with...state on olfactory sensitivity suggest odor specificity. Biol Psychol 71: 244-247. 67. Mair RG, Bouffard JA, Engen T, Morton TH (1978) Olfactory
Concussion Education for High School Football Players: A Pilot Study
Manasse-Cohick, Nancy J.; Shapley, Kathy L.
2014-01-01
This survey study compared high school football players' knowledge and attitudes about concussion before and after receiving concussion education. There were no significant changes in the Concussion Attitude Index. Results revealed a statistically significant difference in the athletes' scores for the Concussion Knowledge Index, "t"(244)…
The effect of single and repeated UVB
Czech Academy of Sciences Publication Activity Database
Fris, M.; Tessem, M. B.; Čejková, Jitka; Midelfart, A.
2006-01-01
Roč. 244, - (2006), s. 1680-1687 ISSN 0721-832X R&D Projects: GA ČR GA304/03/0419 Institutional research plan: CEZ:AV0Z50390512 Keywords : Cataracts * Nuclear magnetic resonance * Lens opacity Subject RIV: FF - HEENT, Dentistry Impact factor: 1.609, year: 2006
2012-04-17
.... Chirikof (620) 0.0031 7,282 23 Kodiak (630) 0.0002 8,986 2 Annual WYK (640) 0.0000 3,244 0 SEO (650) 0.0000... 293 0 Demersal shelf rockfish Annual SEO 0.0000 293 0 Thornyhead rockfish Annual W 0.0047 150 1 C 0...
Strong overtones and combination bands in ultraviolet resonance Raman spectroscopy
Efremov, E.V.; Ariese, F.; Mank, A.J.G.; Gooijer, C.
2006-01-01
Ultraviolet resonance Raman spectroscopy is carried out using a continuous wave frequency-doubled argon ion laser operated at 229, 244, and 257 nm in order to characterize the overtones and combination bands for several classes of organic compounds in liquid solutions. Contrary to what is generally
Kombinace dvojlomných materiálů pro achromatické fázové destičky
Czech Academy of Sciences Publication Activity Database
Melich, Radek
2011-01-01
Roč. 56, č. 9 (2011), s. 242-244 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) ED2.1.00/03.0079 Institutional research plan: CEZ:AV0Z20430508 Keywords : Phasic wafers * achromatic wafers * birefringent materials Subject RIV: BH - Optics, Masers, Lasers
COMPOSITION AND DISTRIBUTION OF ECONOMIC TREE ...
African Journals Online (AJOL)
user
The inventory of economic trees in Nagi Natural Forest Reserve, Benue state was carried out to determine ..... state government decision to put them under .... 4.5. 2.44. 20.45. 11.89. Maranathes polyandra. 5. 5.95. 12.5. 2.5. 0.71. 5.95. 4.80.
The prevalence of child maltreatment across the globe: Review of a series of meta-analyses.
Stoltenborgh, M.; Bakermans-Kranenburg, M.J.; Alink, L.R.A.; van IJzendoorn, M.H.
2015-01-01
In this review, we combine and compare the results of a series of meta-analyses on the prevalence of child sexual, physical and emotional abuse and physical and emotional neglect, including 244 publications and 551 prevalence rates for the various types of maltreatment. Child maltreatment research
Incidence of bacteraemia following teeth extraction at the dental ...
African Journals Online (AJOL)
61 (78.2%) of the 78 isolates obtained in the survey were facultative anaerobes while 17 (21.8%) were obligate anaerobes. Amongst the facultative anaerobes, the most frequently isolated bacterial genus was Staphylococcus (19, 24.4%) followed by Streptococcus spp. (16, 20.5%) and - haemolytic Streptococcus spp.
DEFF Research Database (Denmark)
Kolte, Astrid Marie; Nielsen, H S; Moltke, Ida
2011-01-01
Previously, siblings of patients with idiopathic recurrent miscarriage (IRM) have been shown to have a higher risk of miscarriage. This study comprises two parts: (i) an epidemiological part, in which we introduce data on the frequency of miscarriage among 268 siblings of 244 patients with IRM...
2007-11-01
Papain binds DFP on tyrosine (Chaiken and Smith, 1969), while rabbit liver carboxylesterase binds DFP on histidine as well as on the active site...of a specific tyrosine residue of papain with diisopropylfluorophosphate. J. Biol. Chem. 244, 4247–4250. Chaudhury, C., Mehnaz, S., Robinson, J. M
DEFF Research Database (Denmark)
Qiu, Weimin; Andersen, Tom; Bollerslev, Jens
2007-01-01
in iliac crest bone biopsies from patients with the HBM phenotype and controls. We also used retrovirus-mediated gene transduction to establish three different human mesenchymal stem cell (hMSC) strains stably expressing wildtype LRP5 (hMSC-LRP5WT), LRP5T244 (hMSC-LRP5T244, inactivation mutation leading...... to osteoporosis), or LRP5T253 (hMSC-LRP5T253, activation mutation leading to high bone mass). We characterized Wnt signaling activation using a dual luciferase assay, cell proliferation, lineage biomarkers using real-time PCR, and in vivo bone formation. Results: In bone biopsies, we found increased trabecular...... mineralized bone when implanted subcutaneously with hydroxyapatite/tricalcium phosphate in SCID/NOD mice. Conclusions: LRP5 mutations and the level of Wnt signaling determine differentiation fate of hMSCs into osteoblasts or adipocytes. Activation of Wnt signaling can thus provide a novel approach to increase...
Investigation of neutron resonances of 247Cm in the 0.5-20 eV energy range
International Nuclear Information System (INIS)
Belanova, T.S.; Kolesov, A.G.; Klinov, A.V.; Nikol'skij, S.N.; Poruchikov, V.A.; Nefedov, V.N.; Artamonov, V.S.; Ivanov, R.N.; Kalebin, S.M.
1979-01-01
The neutron resonance parameters of 247 Cm were calculated from the transmission of a curium sample measured by the time-of-flight method. The neutron resonance parameters were calculated by the shape method using the single-level Breit-Wigner formula. Since the neutron resonance parameters of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu are well known, it was possible to identify the neutron resonances of 247 Cm from the measured transmission and calculate their parameters. We identified only five neutron resonances of 247 Cm with high values of 2gGAMMAsub(n). This is due to the fact that the 247 Cm content of the sample is low (1.7mg) and the resonances of this isotope are identified against the background of a large number of resonances of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu situated in the energy range in question
DEFF Research Database (Denmark)
Helby, J.; Nordestgaard, B. G.; Benfield, T.
2017-01-01
% confidence interval 1.40–1.94), pneumonia (2.44; 1.92–3.11) and any non-respiratory tract infection (1.36; 1.11–1.67); results were similar in ever smokers. Never smokers with any asthma had significantly increased risks of any infection (1.44; 1.24–1.66) and pneumonia (1.99; 1.62–2.44). Neither atopic...... asthma was associated with significantly increased risks of any infection, pneumonia and any non-respiratory tract infection in never and ever smokers. In never smokers, risk estimates as well as population attributable fractions for any infection were comparable between asthma and diabetes, suggesting...... of hospitalization for infections. Methods: We collected information on smoking history and self-reported atopic conditions from 105 519 individuals from the general population and followed them for up to 23 years for infectious disease hospitalizations and deaths. For asthma, we focused on never smokers with asthma...
DEFF Research Database (Denmark)
Krogh, T N; Bachmann, E; Teisner, B
1997-01-01
By means of sequence analysis, murine fetal antigen 1 (mFA1) isolated from Mus musculus amniotic fluid was shown to be the circulating protein of the delta-like protein, stromal-cell-derived protein 1 (SCP-1) and preadipocyte factor 1 (Pref-1) gene products. The protein contains 36 cysteine...... residues arranged in six epidermal-growth-factor-like domains. The purification of several C-terminal peptides of varying lengths showed mFA1 to be C-terminal heterogeneous. O-linked glycosylations of the NeuNAc alpha2-3Gal beta1-3(NeuNAc alpha2-6)GalNAc type were present on all C-terminal peptides...... at residues Thr235, Thr244 and Thr248, although glycosylation on Thr244 was only partial. Three N-linked glycosylations were localized in mFA1 (Asn77, Asn142 and Asn151), two of which (Asn142 and Asn151) were in the unusual Asn-Xaa-Cys motif. Fucosylated biantennary complex-type and small amounts (less than 5...
Directory of Open Access Journals (Sweden)
Svirikhin Alexandr
2013-12-01
Full Text Available For experiments aimed at the study of spontaneous fission of transfermium nuclei improvements in the focal plane detector system of recoil separator VASSILISSA have been made. A neutron detector consisting of 54 3He-filled counters has been mounted around the focal-plane detector chamber. The reaction 48Ca + 206Pb = 2n + 252No is used for tuning the separator settings and calibrating the detector system with the spontaneous fission of the 252No. The average neutron number per 252No spontaneous fission event is as large as ν̅ = 4.06 ± 0.12. The short-lived heavy isotopes 244,246Fm, produced in the complete fusion reactions 40Ar + 206,208Pb, are investigated. The average number of neutrons per spontaneous fission of 244,246Fm from the experimental data were (ν̅ = 3.3 ± 0.3 and (ν̅ = 3.55 ± 0.50, respectively. Both values are determined for the first time.
International Nuclear Information System (INIS)
Zhu Rongbao; Wang Shiju; Xu Yingpu; Zhang Zengrui
1986-04-01
A high-sensitive monitoring device and a quantitative analys technigue for transplutonium elements separation processes are described. X-ray and low energy γ-ray are measured by means of a scintillation monitor with two NaI(Tl) thin crystals. The α spectra of the fluents of ion-exchange column is measured by means of Si(Au) surface barrier in-line monitor. The construction of the monitors, auxiliary electronics, investigation result for the α spectra character of thick source and the calibration method were described. The determination results for extracting process of 243 Am and 244 Cm by ion-exchange chromatography were given. The sensitivity of total adding amount for 243 Am using the 4π scintillation monitor is better than 0.1 μCi. The precision of 243 Am and 244 Cm concentration determination using Si(Au) monitor is +- 5%. The precision of the two metals contents in containers is about +- 10%
International Nuclear Information System (INIS)
Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.
2000-01-01
This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate α-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained ∼ 1(wt)% of the alpha-emitting isotope 244 Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain 244 Cm, 241 Am, or 249 Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms
Directory of Open Access Journals (Sweden)
Siti Nurhadis Che Omar
2013-01-01
Full Text Available Melastoma malabathricum Linn. is a shrub that comes with beautiful pink or purple flowers and has berries-like fruits rich in anthocyanins. This study was carried out with the aim to evaluate the inhibitory activities of different concentrations of the M. malabathricum Linn. flower and fruit crude extracts against Listeria monocytogenes IMR L55, Staphylococcus aureus IMR S244, Escherichia coli IMR E30, and Salmonella typhimurium IMR S100 using the disc diffusion method. The lowest concentrations of the extracts producing inhibition zones against the test microorganisms were used to determine their minimum inhibitory concentrations (MICs and minimum bactericidal concentrations (MBCs. In addition, the growth of Listeria monocytogenes IMR L55 and Staphylococcus aureus IMR S244 grown in medium supplemented with the respective extracts at different temperatures (4°C, 25°C, and 37°C and pHs (4, 6, 7, and 8 was determined.
History of Tank 23, 1962 through 1974
International Nuclear Information System (INIS)
McNatt, F.G.
1979-04-01
Tank 23 was placed in service in April 1964 receiving contaminated water from Buildings 244-H, the Receiving Basin for Off-Site Fuel (RBOF), and 245-H, the Resin Regeneration Facility (RRF). Tank 23 also provided emergency storage space for 500,000 gallons in the event of a severe contamination incident in Building 244-H. The tank has remained in this service since that time. The Tank 23 waste was processed initially by the 242-H evaporator, but since mid-1966 the waste has been processed through a zeolite bed to remove 137 C and other radioisotopes by ion exchange, and discarded to seepage basins. Inspections of the tank interior were made by using a 40-ft optical periscope and the thickness of the steel bottom of the tank was measured ultrasonically. Samples of the waste in the tank and liquid collected in the side wall and bottom sumps were analyzed. Several equipment modifications and repairs were made
International Nuclear Information System (INIS)
Semkow, T.M.; Bari, A.; Parekh, P.P.; Haines, D.K.; Gao, H.; Bolden, A.N.; Dahms, K.S.; Scarpitta, S.C.; Thern, R.E.; Velazquez, S.
2004-01-01
Gross α counting of evaporated water residues offers a simple method for screening α radioactivity in water for both public health and emergency purposes. The evaporation process for water has been improved by using a combination of roughening of the surface of counting planchettes, two-stage evaporation, and temperature-controlled block heating. The efficiency of the gas-proportional detector for α-particle detection in water residues was studied as a function of sample mass-thickness in the range between 0.1 and 13 mg cm -2 . The effect of α energy on the efficiency, as well as moisture absorption on the samples, were studied using 230 Th, 238 U, 239 Pu, 241 Am, and 244 Cm radionuclides. Also, α-to-β crosstalk was investigated as a function of sample mass for 230 Th, 239 Pu, 210 Po, 241 Am, and 244 Cm. The improved method can also be applied for gross α detection in biological fluids
Isotopic Thermionic Generator; Generateur thermoionique isotopique
Energy Technology Data Exchange (ETDEWEB)
Clemot, M; Devin, B; Durand, J P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1967-07-01
This report describes the general design of a thermionic direct conversion space generator. The power source used is a radioisotope. Two radioisotopes are considered: Pu 238 and Cm 244. The system is made up of a heat pipe concentrating the thermal flux from the isotope to the emitter, and of a second heat pipe evacuating the waste heat from the collector to the outer wall used as radiating panel. Calculations are given in the particular case of a 100 electrical watts output power. (authors) [French] Ce rapport decrit la structure d'un generateur spatial d'electricite a conversion directe du type thermoionique. La source d'energie est un radioisotope. Deux isotopes sont envisages: le Pu 238 et le Cm 244. Le systeme comporte pour l'emetteur un caloduc concentreur de flux thermique et pour le collecteur, un caloduc evacuateur vers l'enveloppe du generateur utilise, en panneau rayonnant. Les calculs ont ete conduits dans le cas particulier d'une puissance convertie de 100 watts electriques. (auteurs)
Energy Technology Data Exchange (ETDEWEB)
Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.
2000-04-21
This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate {alpha}-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained {approximately} 1(wt)% of the alpha-emitting isotope {sup 244}Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain {sup 244}Cm, {sup 241}Am, or {sup 249}Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms.
Phase I study of Carzelesin (U-80,244) given (4-weekly) by intravenous bolus schedule
Awada, A; Punt, C J A; Piccart, M J; Tellingen, O Van; Manen, L Van; Kerger, J; Groot, Y; Wanders, J; Verweij, J; Wagener, D J Th
1999-01-01
Carzelesin is a cyclopropylpyrroloindole analogue which acts as a DNA-sequence-specific alkylating agent. In this phase I study, Carzelesin was given as a 4-weekly 10 min IV infusion to 51 patients with advanced solid tumours. Patients received a median of two courses (range 1–5) at one of nine dose levels: 24, 48, 96, 130, 150, 170, 210, 250 and 300 μg m−2. According to NCI-CTC criteria, non-haematological toxicities (grade 1/2) included fever, nausea and vomiting, mucositis and anorexia, none of which was clearly dose related. The dose-limiting toxicity was haematological and consisted mainly of neutropenia and to a lesser extent thrombocytopenia. From the dose level 150 μg m−2, the haematological toxicity (particularly thrombocytopenia) was delayed in onset, prolonged and cumulative in some patients. In several courses, double WBC nadirs occurred. The maximum tolerated dose for a single course was 300 μg m−2. From the dose level 170 μg m−2, the intended dose intensity could not be delivered to most patients receiving > 2 courses owing to cumulative haematological toxicity. The dose level with the best dose intensity for multiple courses was 150 μg m−2. The pharmacokinetics of Carzelesin and its metabolites (U-76,073; U-76,074) have been established in 31 patients during the first course of treatment using a HPLC method. Carzelesin exhibited linear pharmacokinetics. The concentration of U-76,074 (active metabolite) extended above the lower limit of quantitation (1 ng ml−1) for short periods of time and only at the higher dose levels. There was no relationship between neutropenia and the AUC of the prodrug Carzelesin, but the presence of detectable plasma levels of the active metabolite U-76,074 was usually associated with a substantial decrease in ANC values. © 1999 Cancer Research Campaign PMID:10188890
2010-07-21
... application and case record and to report findings and recommendations to the Board. Public comment is invited...--Riverside County, CA; Application for Reorganization Under Alternative Site Framework An application has been submitted to the Foreign-Trade Zones (FTZ) Board (the Board) by the March Joint Powers Authority...
Poly[[diaqua-μ2-4,4′-bipyridyl-μ2-o-phthalato-nickel(II] dihydrate
Directory of Open Access Journals (Sweden)
Bing Li
2008-02-01
Full Text Available In the title layer complex, {[Ni(C8H4O4(C10H8N2(H2O2]·2H2O}n, the Ni atom has a distorted octahedral environment, defined by the phthalate and 4,4′-bipyridyl ligands which link the Ni atoms, forming a square lattice in the bc plane. This extends into a three-dimensional supramolecular network through O—H...O hydrogen-bonding interactions. The Ni atom lies on, and both ligands are bisected by, a crystallographic twofold axis.
Variants of clinicoroentgenological manifestations of sarcoidosis of respiratory organs
International Nuclear Information System (INIS)
Borisova, N.K.; Daurov, B.I.
1988-01-01
The paper is concerned with clinicoroentgenological characterization of 275 patients with different stages of intrathoracic sarcoidosis. Different X-ray types of sarcoidosis of the respiratory organs were detected in 67 (24.4%) of them. The number of patients with different types of sarcoidosis increased with progression of disease
Czech Academy of Sciences Publication Activity Database
Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.
2015-01-01
Roč. 112, č. 2 (2015), s. 235-244 ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM
The Assessment of Bulimic Symptoms and Personality Correlates in Female College Students.
Nagelberg, Daniel B.; And Others
1984-01-01
Classified college women (N=244) into three groups according to bulimic symptoms: (1) binge eating; (2) purging; and (3) controls. Results indicated purging may represent the critical behavior in bulimia assessment. Purgers showed lower self-esteem, lowered will control, and less regard for social demands, suggesting significant differences…
Egyptian Journal of Biomedical Sciences - Vol 23 (2007)
African Journals Online (AJOL)
Effect Of Green Leaves And Germination And Boiling Treatments Of Fenugreek And Lupin Seeds On Chemical Composition, Serum Glucose, Lipid Profile And Hepatic Enzymes Of Rats · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT ... DOWNLOAD FULL TEXT. S A El-Adawy, A A Ramadan, 244-256.
Use and Perception of Electronic Cigarettes among College Students
Trumbo, Craig W.; Harper, Raquel
2013-01-01
Objective: This study provides insight into how electronic cigarettes (e-cigarettes) may affect the social normative environment for tobacco use among college students. Participants: Participants were 244 freshman and sophomore students. Methods: Students completed an online self-report survey in April 2011. Results: There is a higher acceptance…
Posttraumatický stres a posttraumatický rozvoj v dětské onkologii
Czech Academy of Sciences Publication Activity Database
Slezáčková, Alena; Loučka, M.; Bartošová, K.
2012-01-01
Roč. 56, č. 2 (2012), s. 132-147 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/11/2421 Institutional research plan: CEZ:AV0Z70250504 Keywords : postttraumatic stress * posttraumatic growth * childhood cancer Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
The Shared Traumatic and Professional Posttraumatic Growth Inventory
Tosone, Carol; Bauwens, Jennifer; Glassman, Marc
2016-01-01
Purpose: While there are established instruments offering psychometrically sound measurement of primary or secondary trauma, none capture the essence of dual exposure for mental health professionals living and working in traumatological environments. Methods: This study examined the experience of 244 mental health workers who lived and worked in…
Wright, Michelle F.; Li, Yan; Shi, Junqi
2014-01-01
This study examined two social status goals in relation to aggressive and prosocial behaviors as well as attributions for relational aggression among 477 (244 girls) Chinese early adolescents. Findings indicate that, after controlling for each other, the social preference goal was negatively related to self-reported overt aggression, and…
Influence of Day Length and Physical Activity on Sleep Patterns in Older Icelandic Men and Women
DEFF Research Database (Denmark)
Brychta, Robert J; Arnardóttir, Nanna Ýr; Jóhannsson, Erlingur
2016-01-01
Study Objectives: To identify cross-sectional and seasonal patterns of sleep and physical activity (PA) in community-dwelling, older Icelandic adults using accelerometers. Methods: A seven-day free-living protocol of 244 (110 female) adults aged 79.7 +/- 4.9 years was conducted as part of a larger...
Finance middle managers and financial statement fraud
Linke, Kristina Gisela Babette
2012-01-01
Verslaggevingsfraude is het manipuleren van de boekhouding om betere cijfers te laten zien. Kristina Linke onderzocht deze vorm van fraude, waarbij zij vooral keek naar de rol van de controller. Dat gebeurde aan de hand van 244 aanklachten in de periode 2000-2006 in de Verenigde Staten. Uit het
76 FR 44337 - Comments and Information Relevant to Mid Decade Review of NORA
2011-07-25
... NIOSH-244] Comments and Information Relevant to Mid Decade Review of NORA AGENCY: Department of Health...) is conducting a review of the processes of the National Occupational Research Agenda (NORA). In 2006, NORA entered its second decade with an industry sector-based structure. In 2011, as NORA reaches the...
Cano, Miguel Angel; Castillo, Linda G.; Davis, Matthew J.; Lopez-Arenas, Araceli; Vaquero, Juana; Thompson, Keisha V.; Saldivar, Isaac M.
2012-01-01
This study investigated the influence of psychocultural variables (e.g., acculturation, enculturation, ethnic identity) and personality characteristics in relation to educational expectations among 345 Latino middle school students in the U.S. Results from a path model indicate that 24.4% of the variance of educational expectations was accounted…
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. TRUPTI ASOLKAR. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 55-66 RESEARCH ARTICLE. Identification of virulence factors and type III effectors of phylotype I, Indian Ralstonia solanacearum strains Rs-09-161 and Rs-10-244 · TRUPTI ASOLKAR ...
2011-01-24
....'' FOR FURTHER INFORMATION CONTACT: Mr. Charles Pelizza; telephone: 772/ 562-3909, extension 244; e-mail... managed by the U.S. Avon Park Air Force Range, State of Florida, The Nature Conservancy, Archbold...; (2) lack of baseline information on resources; (3) lack of an effective approach to apply fire...
Neurovascular Compression in Essential Hypertension: Cause, Consequence or Unrelated Finding?
Czech Academy of Sciences Publication Activity Database
Ceral, J.; Žižka, J.; Eliáš, P.; Solař, M.; Klzo, L.; Reissigová, Jindra
2007-01-01
Roč. 21, č. 2 (2007), s. 179-181 ISSN 0950-9240 R&D Projects: GA MZd NA6169 Institutional research plan: CEZ:AV0Z10300504 Keywords : neurovascular compression * rostral ventrolateral medulla oblongata * hypertension Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.244, year: 2007
Short-term flow induced crystallization in isotactic polypropylene : how short is short?
Ma, Z.; Balzano, L.; Portale, G.; Peters, G.W.M.
2013-01-01
The so-called "short-term flow" protocol is widely applied in experimental flow-induced crystallization studies on polymers in order to separate the nucleation and subsequent growth processes [Liedauer et al. Int. Polym. Proc. 1993, 8, 236–244]. The basis of this protocol is the assumption that
Predictors and Outcomes of Parental Involvement with High School Students in Science
Shumow, Lee; Lyutykh, Elena; Schmidt, Jennifer A.
2011-01-01
Demographic and psychological predictors of parent involvement with their children's science education both at home and at school were examined during high school. Associations between both types of parent involvement and numerous academic outcomes were tested. Data were collected from 244 high school students in 12 different science classrooms…
Oral health knowledge, perceptions and behaviour among nursing ...
African Journals Online (AJOL)
Aim: The purpose of the study was to investigate oral health knowledge, perceptions and behaviour amongst nursing students in a Nigerian tertiary hospital. Materials and methods: The study was conducted at University of Nigeria Teaching Hospital on 244 respondents aged 17 to 40 years, using self administered ...
Orofacial cleft risk is increased with maternal smoking and specific detoxification-gene variants
DEFF Research Database (Denmark)
Shi, Min; Christensen, Kaare; Weinberg, Clarice R
2007-01-01
Maternal smoking is a recognized risk factor for orofacial clefts. Maternal or fetal pharmacogenetic variants are plausible modulators of this risk. In this work, we studied 5,427 DNA samples, including 1,244 from subjects in Denmark and Iowa with facial clefting and 4,183 from parents, siblings,...
Lipschitz images of Haar null sets
Czech Academy of Sciences Publication Activity Database
Matoušková, Eva
2000-01-01
Roč. 32, č. 2 (2000), s. 235-244 ISSN 0024-6093 R&D Projects: GA AV ČR IAA1019705 Institutional research plan: CEZ:AV0Z1019905; CEZ:A05/98:Z1-019-9ii Subject RIV: BA - General Mathematics Impact factor: 0.403, year: 2000
The South India Precambrian crust and shallow lithospheric mantle ...
Indian Academy of Sciences (India)
Regional geothermal-barometry in the granulite facies terrane of South India; Contrib. Mineral. Petrol. 73. 221–244. Raith M, Karmakar S and Brown M 1997 Ultra high temparature metamorphism and multi-stage decom- pressional of saphirrine granulite from the Palni-. Hill ranges, southern India; J. Metamorph. Geol. 15.
First ever production of a transactinide element in Switzerland
Energy Technology Data Exchange (ETDEWEB)
Jost, D.T.; Dressler, R.; Eichler, B.; Piguet, D.; Tuerler, A.; Gaeggeler, H.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Thoerle, P.; Trautmann, N.; Zauner, S. [Mainz Univ. (Germany)
1997-09-01
The transactinide element {sup 261}Rf was produced for the first time at the PSI Phillips cyclotron in the reaction {sup 244}Pu({sup 22}Ne,5n). At bombarding energy of 116 MeV the production cross section was 3 nb. (author) 2 figs., 1 tab., 1 ref.
DEFF Research Database (Denmark)
Jensen, Jesper K; Bak, Søren; Flemming Høilund-Carlsen, Poul
2008-01-01
We evaluated characteristics and prevalence of ST-segment depression and/or T-wave inversion in the resting electrocardiogram of 244 consecutive patients with acute ischemic stroke, but without ischemic heart disease. The prevalence of ST-T changes ranged from 13% to 16% and this is what to expect...
Psychologické důsledky jazykové abstraktnosti
Czech Academy of Sciences Publication Activity Database
Graf, Sylvie
2012-01-01
Roč. 56, č. 5 (2012), s. 420-434 ISSN 0009-062X R&D Projects: GA ČR GAP407/10/2394 Institutional support: RVO:68081740 Keywords : language abstractness * linguistic category model * linguistic intergroup bias * linguistic expectancy bias Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
E-Learning Adoption: The Role of Relative Advantages, Trialability and Academic Specialisation
Hsbollah, Hafizah Mohamad; Idris, Kamil Md.
2009-01-01
Purpose: The purpose of this paper is to investigate Universiti Utara Malaysia UUM lecturers' perception of the decision regarding adopting e-learning as a teaching tool. Design/methodology/approach: Data were collected from 244 lecturers in Universiti Utara Malaysia. Internal consistency using Cronbach alpha and exploratory factor analysis with…
Conducting swift heavy ion track networks
Czech Academy of Sciences Publication Activity Database
Fink, Dietmar; Kiv, A.; Fuks, D.; Vacík, Jiří; Hnatowicz, Vladimír; Chandra, A.; Saad, A.
2010-01-01
Roč. 165, č. 3 (2010), s. 227-244 ISSN 1042-0150 R&D Projects: GA AV ČR(CZ) KAN400480701 Institutional research plan: CEZ:AV0Z10480505 Keywords : ion tracks * negative differential resistance * neural networks Subject RIV: JJ - Other Materials Impact factor: 0.660, year: 2010
Air & Space Power Journal. Volume 27, Number 1, January-February 2013
2013-02-01
aspects of daily life.” This was to be achieved by utilizing contemporary media, including newspapers, journals, radio, television and films .25 Given...Washington, DC 20036-3011, 2009, 244 pages, $16.00 (softcover), ISBN 978-1-60127-033-7. A particular genre of military guides related to low intensity
Czech Academy of Sciences Publication Activity Database
Genre, A.; Ivanov, S.; Fendrych, Matyáš; Faccio, A.; Žárský, Viktor; Bisseling, T.; Bonfante, P.
2012-01-01
Roč. 53, č. 1 (2012), s. 244-255 ISSN 0032-0781 R&D Projects: GA ČR(CZ) GAP305/11/1629 Institutional research plan: CEZ:AV0Z50380511 Keywords : Daucus carota * Exocytosis * Medicago truncatula Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.134, year: 2012
DEFF Research Database (Denmark)
Lund, A.B. Kiholm; Hove, H.D.; Kirchhoff, M.
2008-01-01
A 15q24 microduplication, reciprocal to the minimal critical region for the recently described 15q24 microdeletion syndrome, was found in a 2-year-old boy by 244k Agilent oligoarray CGH analysis. The boy had global developmental delay and dysmorphic facial features, digital and genital abnormalit...
DEFF Research Database (Denmark)
Ostrowski, S R; Ullum, H; Pedersen, Bente Klarlund
2005-01-01
Human immunodeficiency virus (HIV)-1 infection influences natural killer (NK) cell expression of inhibitory NK receptors and activating natural cytotoxicity receptors. It is unknown whether expression of the co-stimulatory NK cell receptor 2B4 (CD244) on NK cells and CD3+ CD8+ cells are affected ...
Prevalence of obesity among diabetics seen in a tertiary health care ...
African Journals Online (AJOL)
Background: Obesity is a leading determinant for diabetes mellitus. The objective of this study was to assess the prevalence of overweight/obesity among diabetic patients seen at a tertiary hospital in South-South Nigeria. Methods: A retrospective study of 244 diabetic patients seen between January 2010 and June 2012.
African Journals Online (AJOL)
HP4510s
place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.
On the Conditioning of Factors in the SR Decomposition
Czech Academy of Sciences Publication Activity Database
Fassbender, H.; Rozložník, Miroslav
2016-01-01
Roč. 505, 15 September (2016), s. 224-244 ISSN 0024-3795 R&D Projects: GA ČR GA13-06684S Institutional support: RVO:67985807 Keywords : SR decomposition * symplectic matrices * skew-symmetric bilinear forms * orthogonalization * condition number Subject RIV: BA - General Mathematics Impact factor: 0.973, year: 2016
Czech Academy of Sciences Publication Activity Database
Hu, Q.; Rijcken, C. J. F.; van Gaal, E.; Brundel, P.; Kostková, Hana; Etrych, Tomáš; Weber, B.; Barz, M.; Kiessling, F.; Prakash, J.; Storm, G.; Hennink, W. E.; Lammers, T.
2016-01-01
Roč. 244, Part B (2016), s. 314-325 ISSN 0168-3659. [European Symposium on Controlled Drug Delivery /14./. Egmond aan Zee, 13.04.2016-15.04.2016] Institutional support: RVO:61389013 Keywords : nanomedicine * drug targeting * polymeric micelles Subject RIV: CD - Macromolecular Chemistry Impact factor: 7.786, year: 2016
Detection Performance of an Operator Using Lofar
1976-04-01
Blur on Perimetric Thresholds," Aroh. of Opthalmology , 68:2, pp. 240-51 (1962). 15. Ferree, C.E., Rand, G., Hardy, C, "Refraction for the...Static Perimetric Technique Believed to Test Receptive Field Properties III Clinical Trials," Am. Jour. Opthalmology , 70:2, pp. 244-272 (Aug. 1970
Project W-314 DST and DCRT instrument and control systems, initial assessment
International Nuclear Information System (INIS)
Acree, C.D.
1996-01-01
This report contains an assessment of the instrument and control systems in the Double Shell Tank Farms and the 244-A DCRT. The assessment report contains data from physical inspection activities and an overall engineering assessment of the instruments and control systems in use in the Double Shell Tanks
2010-04-01
... Section 244 of the National Housing Act. Independent Public Accountant. Certified Public Accountant or a licensed or registered public accountant, none of which has a business relationship with the owner or State Agency except for the performance of audit, systems work and tax preparation. If not certified, the...
Seccombe, Karen
1986-01-01
Tested Kohn's theory that people who work in highly supervised, routinized occupations are likely to value obedience and conformity in marital and parental relationships. Findings from 244 couples revealed that working conditions were not strong predictors of division of household labor. Concludes that nontraditional gender role values,…
77 FR 43599 - Ocean Transportation Intermediary License Applicants
2012-07-25
... OFF License. Logistics International Parcel Shipping Transport LLC (NVO), 182 West Melrose Avenue, 2... Schwartz, Director, Application Type: New OFF License. Brox Logistics USA, LLC (NVO,) 244 5th Avenue, V-280... Agency Corporation, dba C&F Worldwide Logistics. Cargois Inc. dba Star Vision Logis (NVO), 2700 Coyle...
Directory of Open Access Journals (Sweden)
Alfonzo Pérez-Gutiérrez
2017-04-01
Full Text Available The irrigation methods offer a good alternative for increasing water use efficiency. The main purpose of this study was to identify the best irrigation level for Habanero pepper (Capsicum chinense Jacq. plants based on available water capacity (AWC of substrate. An experiment carried out with three irrigation levels (20, 40 and 60% of AWC and five genotypes (H225, H241, H244, H226 and Jaguar. The irrigation level of 20% decreased the soil water potential to cause water stress in plants. At an irrigation level of 40%, average jaguar plant height (92 cm and H241 (79 cm, genotypes were greater than under the other treatments. Average leaf area of H225, H241 and H244 plants was at least 48% greater than Jaguar plants. Average total dry matter of H241 and Jaguar plants, were 30 and 28% greater than H226 plants; and values of maximum photochemical quantum yield (Fv/Fm, relative electron transport rate and effective photochemical quantum yield of photosystem II were higher in H241, H244 and H226 plants; i.e. they are less probably due to photo inhibition damage. However, flowering time was earlier in plants with an irrigation level (IL of 20% than plants with an IL of 40%, this was a consequence of stress due to water deficit. The 60% irrigation treatment caused flooding and all genotypes died before the inflorescence stage. These results suggest the enforcement of a suitable irrigation level based in available water capacity of substrate coupled with a vigorous genotype can encourage healthy plants and high water use efficiency.
Directory of Open Access Journals (Sweden)
Xiaolin Liao
2014-07-01
Full Text Available Half-smooth tongue sole (Cynoglossus semilaevis is one of the most important flatfish species for aquaculture in China. To produce a monosex population, we attempted to develop a marker-assisted sex control technique in this sexually size dimorphic fish. In this study, we identified a co-dominant sex-linked marker (i.e., CyseSLM by screening genomic microsatellites and further developed a novel molecular method for sex identification in the tongue sole. CyseSLM has a sequence similarity of 73%–75% with stickleback, medaka, Fugu and Tetraodon. At this locus, two alleles (i.e., A244 and A234 were amplified from 119 tongue sole individuals with primer pairs CyseSLM-F1 and CyseSLM-R. Allele A244 was present in all individuals, while allele A234 (female-associated allele, FAA was mostly present in females with exceptions in four male individuals. Compared with the sequence of A244, A234 has a 10-bp deletion and 28 SNPs. A specific primer (CyseSLM-F2 was then designed based on the A234 sequence, which amplified a 204 bp fragment in all females and four males with primer CyseSLM-R. A time-efficient multiplex PCR program was developed using primers CyseSLM-F2, CyseSLM-R and the newly designed primer CyseSLM-F3. The multiplex PCR products with co-dominant pattern could be detected by agarose gel electrophoresis, which accurately identified the genetic sex of the tongue sole. Therefore, we have developed a rapid and reliable method for sex identification in tongue sole with a newly identified sex-linked microsatellite marker.
Directory of Open Access Journals (Sweden)
Chibueze Chioma Ezinne
Full Text Available CD8+ T cell response is important in the response to viral infections; this response though is regulated by inhibitory receptors. Expression of inhibitory receptors has been positively correlated with CD8+ T cell exhaustion; the consequent effect of simultaneous blockade of these inhibitory receptors on CD8+ T cell response in viral infections have been studied, however, the role of individual blockade of receptor-ligand pair is unclear. 2B4/CD48 interaction is involved in CD8+T cell regulation, its signal transducer SAP (signaling lymphocyte activation molecule (SLAM-associated protein is required for stimulatory function of 2B4/CD244 on lymphocytes hence, we analyzed 2B4/CD244 (natural killer cell receptor and SAP (signaling lymphocyte activation molecule(SLAM-associated protein on total CD8+ and HTLV-1 specific CD8+T cells in HTLV-1 infection and the effect of blockade of interaction with ligand CD48 on HTLV-1 specific CD8+ T cell function. We observed a high expression of 2B4/CD244 on CD8+ T cells relative to uninfected and further upregulation on HTLV-1 specific CD8+ T cells. 2B4+ CD8+ T cells exhibited more of an effector and terminally differentiated memory phenotype. Blockade of 2B4/CD48 interaction resulted in improvement in function via perforin expression and degranulation as measured by CD107a surface mobilization on HTLV-1 specific CD8+ T cells. In the light of these findings, we thus propose an inhibitory role for 2B4/CD48 interaction on CD8+T cell function.
Directory of Open Access Journals (Sweden)
Siriwat Akapirat
Full Text Available Sexual transmission is the principal driver of the human immunodeficiency virus (HIV pandemic. Understanding HIV vaccine-induced immune responses at mucosal surfaces can generate hypotheses regarding mechanisms of protection, and may influence vaccine development. The RV144 (ClinicalTrials.gov NCT00223080 efficacy trial showed protection against HIV infections but mucosal samples were not collected, therefore, the contribution of mucosal antibodies to preventing HIV-1 acquisition is unknown. Here, we report the generation, magnitude and persistence of antibody responses to recombinant gp120 envelope and antigens including variable one and two loop scaffold antigens (gp70V1V2 previously shown to correlate with risk in RV144. We evaluated antibody responses to gp120 A244gD and gp70V1V2 92TH023 (both CRF01_AE and Case A2 (subtype B in cervico-vaginal mucus (CVM, seminal plasma (SP and rectal secretions (RS from HIV-uninfected RV144 vaccine recipients, who were randomized to receive two late boosts of ALVAC-HIV/AIDSVAX®B/E, AIDSVAX®B/E, or ALVAC-HIV alone at 0 and 6 months. Late vaccine boosting increased IgG geometric mean titers (GMT to gp120 A244gD in AIDSVAX®B/E and ALVAC-HIV/AIDSVAX®B/E CVM (28 and 17 fold, respectively, followed by SP and RS. IgG to gp70V1V2 92TH023 increased in AIDSVAX®B/E and ALVAC-HIV/AIDSVAX®B/E CVM (11-17 fold and SP (2 fold two weeks post first boost. IgG to Case A2 was only detected in AIDSVAX®B/E and ALVAC-HIV/AIDSVAX®B/E CVM. Mucosal IgG to gp120 A244gD (CVM, SP, RS, gp70V1V2 92TH023 (CVM, SP, and Case A2 (CVM correlated with plasma IgG levels (p<0.001. Although the magnitude of IgG responses declined after boosting, anti-gp120 A244gD IgG responses in CVM persisted for 12 months post final vaccination. Further studies in localization, persistence and magnitude of envelope specific antibodies (IgG and dimeric IgA in anogenital secretions will help determine their role in preventing mucosal HIV acquisition.
Do I Know Its Wrong: Children's and Adults' Use of Unconventional Grammar in Text Messaging
Kemp, Nenagh; Wood, Clare; Waldron, Sam
2014-01-01
There is concern that the violations of conventional grammar (both accidental and deliberate) often seen in text messages (e.g., "hi [smiley face emoticon] how is ya?!!") could lead to difficulty in learning or remembering formal grammatical conventions. We examined whether the grammatical violations made by 244 British children,…
Rate Control for Network-Coded Multipath Relaying with Time-Varying Connectivity
2010-12-10
Armen Babikyan, Nathaniel M. Jones, Thomas H. Shake, and Andrew P. Worthen MIT Lincoln Laboratory 244 Wood Street Lexington, MA 02420 DDRE, 1777...delay U U U U SAR 11 Zach Sweet 781-981-5997 1 Rate Control for Network-Coded Multipath Relaying with Time-Varying Connectivity Brooke Shrader, Armen
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Prajval Shastri. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 3 March 2017 pp 237-244 General Article. Black Holes in Our Universe: Do They Inch Up the Mass Ladder? Prajval Shastri · More Details Abstract Fulltext PDF.
Evolutionary relationships within a subgroup of HERV-K-related human endogenous retroviruses
Zsíros, J.; Jebbink, M. F.; Lukashov, V. V.; Voûte, P. A.; Berkhout, B.
1998-01-01
The prototype endogenous retrovirus HERV-K10 was identified in the human genome by its homology to the exogenous mouse mammary tumour virus. By analysis of a short 244 bp segment of the reverse transcriptase (RT) gene of other HERV-K10-like sequences, it has become clear that these elements
Nové termoresponsivní polymery pro kombinovanou lokální chemoradioterapii
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Kučka, Jan; Kozempel, Ján; Lebeda, Ondřej; Koňák, Čestmír; Ulbrich, Karel
2007-01-01
Roč. 61, č. 1 (2007), s. 243-244 ISSN 1336-7242. [Zjazd chemikov /59./. 02.09.2007-06.09.2007, Tatranské Matliare] R&D Projects: GA AV ČR IAA400480616 Institutional research plan: CEZ:AV0Z40500505 Keywords : thermoresponsive * local * radiotherapy Subject RIV: CD - Macromolecular Chemistry
African Journals Online (AJOL)
USER
One hundred poultry were collected using simple random sampling from 114 commercial, backyard and free range flocks affected by HPAI in different parts of. Nigeria. A total of 244,992 poultry were in. INTRODUCTION. Highly pathogenic avian influenza (HPAI) is a viral disease affecting almost all domestic and wild birds.
Does Sex Influence the Diagnostic Evaluation of Autism Spectrum Disorder in Adults?
Wilson, C. Ellie; Murphy, Clodagh M.; McAlonan, Grainne; Robertson, Dene M.; Spain, Debbie; Hayward, Hannah; Woodhouse, Emma; Deeley, P. Quinton; Gillan, Nicola; Ohlsen, J. Chris; Zinkstok, Janneke; Stoencheva, Vladimira; Faulkner, Jessica; Yildiran, Hatice; Bell, Vaughan; Hammond, Neil; Craig, Michael C.; Murphy, Declan G. M.
2016-01-01
It is unknown whether sex influences the diagnostic evaluation of autism spectrum disorder, or whether male and female adults within the spectrum have different symptom profiles. This study reports sex differences in clinical outcomes for 1,244 adults (935 males and 309 females) referred for autism spectrum disorder assessment. Significantly, more…
Pseekos, A. Chantelle; Bullock-Yowell, Emily; Dahlen, Eric R.
2011-01-01
The researchers examined the impact of person-environment (P-E) fit, as defined by Holland's (1997) theory, on interpersonal conflict at work (ICAW) and workplace aggression. In addition, previous relationships found in the job satisfaction literature were examined in the present sample of 244 United States employees. Internet-based surveys were…
Phytochemicals and in vitro antioxidant potentials of defatted ...
African Journals Online (AJOL)
ONOS
2010-01-18
Jan 18, 2010 ... 1Department of Biochemistry, Ladoke Akintola University of Technology, Ogbomoso, Nigeria. Accepted 21 September ... exhibited scavenging activity with IC50 of 12.63, 1,377.00 and 244.00 µg/ml for DPPH, hydroxyl radical and nitric oxide radical ..... maritimum essential oils. Planta. Med. 66: 687-693.
Fate map of the dental mesenchyme: Dynamic development of the dental papilla and follicle
Czech Academy of Sciences Publication Activity Database
Rothová, Michaela; Peterková, Renata; Tucker, A. S.
2012-01-01
Roč. 366, č. 2 (2012), s. 244-254 ISSN 0012-1606 R&D Projects: GA ČR GA304/07/0223 Institutional research plan: CEZ:AV0Z50390703; CEZ:AV0Z50390512 Keywords : tooth * mouse * mesenchyme Subject RIV: EA - Cell Biology Impact factor: 3.868, year: 2012
Children's Moral Self-Concept: The Role of Aggression and Parent-Child Relationships
Sengsavang, Sonia; Krettenauer, Tobias
2015-01-01
This study examined the role of aggressiveness and parenting in the development of children's moral self-concept. Participants were 198 elementary school children and their parents (M = 8.65 years, SD = 2.44). Participants completed a structured moral self puppet interview and a questionnaire about their relationship to parents. Parents completed…
DEFF Research Database (Denmark)
Kløverpris, Henrik N; McGregor, Reuben; McLaren, James E
2014-01-01
of differentiation on HIV-1-specific CD8+ T-cell populations(n = 128) spanning 11 different epitope targets. RESULTS: Expression levels of PD-1, but not CD244 or LAG-3, varied substantially across epitope specificities both within and between individuals. Differential expression of PD-1 on T-cell receptor (TCR...
Indian Academy of Sciences (India)
Hydantoins (2) 124 (GA). Hymenoptera (5) 459 (RN). Imhotep (6) 498 (SA). Immortalization (6) 539 (GA). Indo–Arabic numerals (12) 1062 (SA). Inductance measurement (3) 244 (CR). Inertial navigation system (INS) (4) 302 (SA). Information flow (7) 605 (GA). Instantons (2) 104 (GA). Instrument landing system (ILS) (4) 302 ...
A Cross-Cultural Exploration of Parental Involvement and Child-Rearing Beliefs in Asian Cultures
Frewen, A. R.; Chew, E.; Carter, M.; Chunn, J.; Jotanovic, D.
2015-01-01
Parental involvement (PI) and child-rearing beliefs were examined amongst parents whose children attended state-run kindergartens across Singapore. A total of 244 parents completed an online survey consisting of a Child-Rearing Beliefs Scale, a PI Scale, and demographic details. Results indicated respondents were generally low-income earners with…
75 FR 3871 - Promoting Diversification of Ownership in Broadcast Services; Suspension of Filing Date
2010-01-25
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [MB Docket Nos. 07-294, 06-121, 02-277, 04-228; MM Docket Nos. 01-235, 01-317, 00-244; DA 09-2618] Promoting Diversification of Ownership in...); Promoting Diversification in the Broadcasting Services, Order, DA 09-2165 (rel. Oct. 2, 2009). See also...
Impact of project funding on the implementation of LEEMP ...
African Journals Online (AJOL)
The implementation process could make a project succeed, fail or even abandoned midstream. Information gathered from LEEMP in Imo State indicates that out of the 258 development projects embarked upon by LEEMP, only 24.4% have been completed while 75.6% are at their various completion stages after committing ...
Link Maps and Map Meetings: Scaffolding Student Learning
Lindstrom, Christine; Sharma, Manjula D.
2009-01-01
With student numbers decreasing and traditional teaching methods having been found inefficient, it is widely accepted that alternative teaching methods need to be explored in tertiary physics education. In 2006 a different teaching environment was offered to 244 first year students with little or no prior formal instruction in physics. Students…
76 FR 58047 - Notice of Intent to Grant Exclusive License
2011-09-19
... Code AL; Phone (281) 244-7148; Fax (281) 483-6936. Information about other NASA inventions available... States to practice the inventions described and claimed in US Patent Application Serial Number 12/757,657... patent rights in this invention have been assigned to the United States of America as represented by the...
77 FR 43867 - Notice of Intent To Grant Partially Exclusive License
2012-07-26
...; Phone (281)244-7148; Fax (281) 483-6936. Information about other NASA inventions available for licensing... United States to practice the invention described and claimed in U.S. Patent Nos. 7,295,884 entitled... rights in these inventions have been assigned to the United States of America as represented by the...
Czech Academy of Sciences Publication Activity Database
Květon, Petr; Jelínek, Martin; Vobořil, Dalibor; Klimusová, H.
2012-01-01
Roč. 56, č. 1 (2012), s. 31-40 ISSN 0009-062X R&D Projects: GA ČR GP406/09/P284 Institutional research plan: CEZ:AV0Z70250504 Keywords : nominal categories model * item response theory * distractor * test Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
What Contributes to First-Year Student Teachers' Sense of Professional Agency in the Classroom?
Soini, Tiina; Pietarinen, Janne; Toom, Auli; Pyhältö, Kirsi
2015-01-01
This study explores Finnish first-year primary teacher students' (N = 244) sense of professional agency in the classroom. In addition, the interrelation between student teachers' sense of professional agency and the perceptions of teacher education as a learning environment is explored. The sense of professional agency in the classroom…
Life-history characteristics of an age-validated established invasive ...
African Journals Online (AJOL)
By counting post-fluorescent mark increments on otoliths from 21 chemically tagged wild fish recaptured 244–537 days later, the deposition of growth zones, comprising alternating opaque and translucent bands, was validated as annual. Examination of sectioned otoliths from 175 fish revealed that the oldest fish, two males ...
Examining Gender DIF on a Multiple-Choice Test of Mathematics: A Confirmatory Approach.
Ryan, Katherine E.; Fan, Meichu
1996-01-01
Results for 3,244 female and 3,033 male junior high school students from the Second International Mathematics Study show that applied items in algebra, geometry, and computation were easier for males but arithmetic items were differentially easier for females. Implications of these findings for assessment and instruction are discussed. (SLD)
2013-03-11
... for an MSP because OPM can treat a church plan as equivalent to an issuer under the Church Parity and Entanglement Protections Act, Public Law 106-244 (``Parity Act''). The commenter recommended that OPM could..., national origin, disability, age, sex, gender identity, or sexual orientation. We sought comment on any...
Chiral separations in capillary electrophoresis
Czech Academy of Sciences Publication Activity Database
Vespalec, Radim; Boček, Petr
2000-01-01
Roč. 100, č. 10 (2000), s. 3715-3753 ISSN 0009-2665 R&D Projects: GA AV ČR IAA4031703; GA ČR GA203/99/0044; GA MŠk VS96021; GA MŠk VS97014 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 21.244, year: 1999
Carter, Margaret Anne; Frewen, Amie; Chunn, Jennifer
2014-01-01
This study reports the importance 244 parents of six-year-old children living in Singapore placed on cognitive (problem-solving and creativity) and non-cognitive (practical school skills and conforming) behaviours. Our research team hypothesised that, as the age of the parent increased, the importance placed on each covariant skill (problem…
Evaluating U.S. and Chinese Cyber Security Strategies Within a Cultural Framework
2016-04-01
analysis of Chinese culture in warfare studies. They find that Chinese convention “respects inaction”28 and the teachings of Sun Tzu , thus favoring the...15 Bibliography ...AY16 16 Bibliography Ehsan Ahrari. “Transformation of America’s Military and Asymmetric War.” Comparative Strategy 29, no. 3 (2010): 223-244
Analýza motivace na základě použití TAT u dvou skupin adolescentů
Czech Academy of Sciences Publication Activity Database
Urbánek, Tomáš; Czekóová, Kristína; Čermák, Ivo; Fikarová, Táňa; Pokorná, Zuzana
2012-01-01
Roč. 56, č. 5 (2012), s. 393-408 ISSN 0009-062X R&D Projects: GA ČR GA406/09/2089 Institutional research plan: CEZ:AV0Z70250504 Keywords : thematic apperception test * thematic content analysis * motivation * adolescents Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
2147-IJBCS-Article-Abdoulaye Kone
African Journals Online (AJOL)
hp
2011. Age and growth of the smooth hammerhead shark, Sphyrna zygaena, in the Eastern Equatorial Atlantic. Ocean, using vertebral sections. Aqu. Liv. Res., 24(4): 351-357. Compagno LJV. 1984a. FAO species catalogue, Sharks of the world: an annotated and illustrated catalogue of shark species known to date. Part 1:.
Labor supply consequences of family taxation: evidence from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Kalíšková, Klára
2014-01-01
Roč. 30, October (2014), s. 234-244 ISSN 0927-5371 R&D Projects: GA MŠk(CZ) SVV260126 Grant - others:UK(CZ) GAUK 595812 Institutional support: PRVOUK-P23 Keywords : joint tax ation * labor supply * diffrence-in-differences Subject RIV: AH - Economics Impact factor: 0.916, year: 2014
Patterns of Parenting during Adolescence: Perceptions of Adolescents and Parents.
Paulson, Sharon E.; Sputa, Cheryl L.
1996-01-01
Explores differences in maternal and paternal parenting styles and involvement, the differences between parents' and adolescents' perceptions of parenting style and involvement, and changes in parenting style and involvement between the adolescents' 9th and 12th grade years. Subjects were 244 ninth graders from the Southeast and Midwest. Discusses…
Upright or dorsal? childbirth positions among antenatal clinic ...
African Journals Online (AJOL)
clinic attendees of two tertiary healthcare institutions located in the semi‑urban areas of .... Television. 33 (16.4). 4 (3.8). 37 (12.1) 0.002. Internet. 4 (2.0). 3 (2.9). 7 (2.3). 0.82. Mother. 49 (24.4) .... attitudes to things. Some earlier studies in ...