WorldWideScience

Sample records for berkelium 237

  1. Chemistry of berkelium: a review

    International Nuclear Information System (INIS)

    Hobart, D.E.; Peterson, J.R.

    1985-01-01

    Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity

  2. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  3. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  6. 49 CFR 237.131 - Design.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Design. 237.131 Section 237.131 Transportation... TRANSPORTATION BRIDGE SAFETY STANDARDS Repair and Modification of Bridges § 237.131 Design. Each repair or... component of a bridge shall be designed by a railroad bridge engineer. The design shall specify the manner...

  7. Analysis list: nhr-237 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available nhr-237 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target.../nhr-237.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/nhr-237.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/target/nhr-237.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.E...mbryo.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.Larvae.tsv http://dbarchive.bioscie...ncedbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  8. 49 CFR 238.237 - Automated monitoring.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Automated monitoring. 238.237 Section 238.237 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.237 Automated monitoring. (a) Except as further specified in this paragraph, on or after...

  9. 47 CFR 24.237 - Interference protection.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Interference protection. 24.237 Section 24.237... SERVICES Broadband PCS § 24.237 Interference protection. (a) All licensees are required to coordinate their... protection criterion shall be such that the interfering signal will not produce more than 1.0 dB degradation...

  10. Criticality of a 237Np sphere

    International Nuclear Information System (INIS)

    Sanchez, Rene G.; Loaiza, David J.; Kimpland, Robert H.; Hayes, David K.; Cappiello, Charlene C.; Myers, William L.; Jaegers, Peter J.; Clement, Steven D.; Butterfield, Kenneth B.

    2003-01-01

    A critical mass experiment using a 6-kg 237 Np sphere has been performed. The purpose of the experiment is to get a better estimate of the critical mass of 237 Np. To attain criticality, the 237 Np sphere was surrounded with 93 wt% 235 U shells. A 1/M as a function of uranium mass was performed. An MCNP neutron transport code was used to model the experiment. The MCNP code yielded a k eff of 0.99089 ± 0.0003 compared with a k eff 1.0026 for the experiment. Based on these results, it is estimated that the critical mass of 237 Np ranges from kilogram weights in the high fifties to low sixties. (author)

  11. 14 CFR 23.237 - Operation on water.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Operation on water. 23.237 Section 23.237... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Ground and Water Handling Characteristics § 23.237 Operation on water. A wave height, demonstrated to be safe for operation, and any...

  12. Np-237 in peat and lichen in Finland

    DEFF Research Database (Denmark)

    Salminen, S.; Paatero, J.; Roos, Per

    2009-01-01

    Activity concentrations of 237Np in peat and lichen samples in Finland were determined and contributions from nuclear weapons testing in 1950–1960s and the Chernobyl accident were estimated. 237Np was determined with ICP-MS using 235Np as a tracer. Activity concentrations of 237Np in peat samples...

  13. Criticality of a 237Np sphere

    International Nuclear Information System (INIS)

    Sanchez, Rene; Loaiza, David; Kimpland, Robert; Hayes, David; Cappiello, Charlene; Chadwick, Mark

    2006-01-01

    For the past five years, scientists at Los Alamos National Laboratory have mounted an unprecedented effort to get a better estimate of the critical mass of 237 Np. To accomplish this task, a 6-kg neptunium sphere was recently cast at the Chemical and Metallurgy Research (CMR) facility, which is part of the Los Alamos National Laboratory. The neptunium sphere was clad with tungsten and nickel to reduce the dose rates from the 310 keV gamma rays from the first daughter of neptunium, namely, 233 Pa. 237 Np is a byproduct of power production in nuclear reactors. It is primarily produced by successive neutron captures in 235 U or through the (n,2n) reaction in 238 U. These nuclear reactions lead to the production of 237 U, which decays by beta emission into 237 Np, namely, 235 U(n,γ) 236 U, 236 U(n,γ) 237 U→β→ 237 Np, 238 U (n,2n) 237 U→β→ 237 Np. It is estimated that a typical 1000 MW(e) produces on the order of 12 to 13 kg of neptunium in a year. Some of this neptunium in irradiated fuel elements has been separated and is presently stored in containers in a liquid form. This method of storage is quite adequate because the fission cross section for 237 Np at thermal energies is quite low and any moderation of the neutron population by diluting the configurations with water would increase the critical mass to infinity. However, for long term storage, the neptunium liquid solutions must be converted into oxides and metals because these form are less movable and less likely to leak out of containers. Metals and oxides made out of neptunium have finite critical masses but there is a great uncertainty about these values because of the lack of experimental criticality data. Knowing precisely the critical mass of neptunium not only will help to validate mass storage limits or optimize storage configurations for safe disposition of these materials, but will also save thousands of dollars in transportation and disposition costs. The experimental results presented in

  14. 48 CFR 1252.237-70 - Qualifications of contractor employees.

    Science.gov (United States)

    2010-10-01

    ... contractor employees. 1252.237-70 Section 1252.237-70 Federal Acquisition Regulations System DEPARTMENT OF....237-70 Qualifications of contractor employees. As prescribed in (TAR) 48 CFR 1237.110(a), insert the following clause: Qualifications of Contractor Employees (APR 2005) a. Definitions. As used in this clause...

  15. 48 CFR 252.237-7011 - Preparation history.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Preparation history. 252... Provisions And Clauses 252.237-7011 Preparation history. As prescribed in 237.7003(b), use the following clause: Preparation History (DEC 1991) For each body prepared, or for each casket handled in a group...

  16. Characterization of oxalate-based 237NpO2 powder

    International Nuclear Information System (INIS)

    Rankin, D.T.; Burney, G.A.; Smith, P.K.; Sisson, R.D.

    1976-01-01

    238 Pu, a radioisotope heat source, is produced by irradiating reactor targets containing 237 NpO 2 . The neptunium oxide is obtained by precipitating and calcining 237 Np(IV) oxalate. The effects of oxalate precipitation parameters on particle morphology and size distribution of 237 NpO 2 powder were established to provide process controls for fabricating reactor targets

  17. Biokinetics of 237Np in mussels and shrimp

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1977-01-01

    Neptunium-237 kinetics were studied in marine shrimp and mussels using a thick source alpha counting technique. Bioaccumulation of 237 Np from water was relatively slow in both species, reaching whole body concentration factors of only 15 to 20 after three months. Surface adsorption was implicated in the initial uptake. Both uptake and loss of the radioisotope were not significantly affected by temperature; this may be a reflection of the physical nature of the uptake. By virtue of the large amounts of accumulated 237 Np associated with the exoskeleton of shrimp, molting will play an important role in the biogeochemical cycling of this transuranic in the marine environment. Rapid growth of organisms like mussels acts to reduce the 237 Np concentration in tissues during a period of decontamination

  18. 48 CFR 252.237-7005 - Performance and delivery.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance and delivery... of Provisions And Clauses 252.237-7005 Performance and delivery. As prescribed in 237.7003(b), use the following clause: Performance and Delivery (DEC 1991) (a) The Contractor shall furnish the...

  19. 48 CFR 252.237-7007 - Termination for default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Termination for default... of Provisions And Clauses 252.237-7007 Termination for default. As prescribed in 237.7003(b), use the following clause: Termination for Default (DEC 1991) (a) This clause supplements and is in addition to the...

  20. 48 CFR 237.7502 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Acquisition and Management of Industrial Resources 237.7502 Policy. (a) Comply with DoD Directive 4275.5, Acquisition and Management of Industrial...

  1. 48 CFR 1352.237-72 - Security processing requirements-national security contracts.

    Science.gov (United States)

    2010-10-01

    ... requirements-national security contracts. 1352.237-72 Section 1352.237-72 Federal Acquisition Regulations... Provisions and Clauses 1352.237-72 Security processing requirements—national security contracts. As prescribed in 48 CFR 1337.110-70(d), use the following clause: Security Processing Requirements—National...

  2. 43 CFR 23.7 - Approval of exploration plan.

    Science.gov (United States)

    2010-10-01

    ... measures to be taken to prevent or control fire, soil erosion, pollution of surface and ground water... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Approval of exploration plan. 23.7 Section 23.7 Public Lands: Interior Office of the Secretary of the Interior SURFACE EXPLORATION, MINING AND...

  3. 48 CFR 237.7100 - Scope.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Laundry and Dry Cleaning Services 237.7100 Scope. This subpart— (a) Applies to contracts for laundry and dry cleaning services within the United...

  4. Sorption and Migration Mechanisms of 237 Np through Sandy Soil

    International Nuclear Information System (INIS)

    Chantaraprachoom, Nanthavan; Tanaka, Tadao

    2003-06-01

    In order to evaluate migration behavior of radioactive nuclides in the disposal of low-level radioactive waste into a shallow land burial, the sorption characteristic and migration behavior of 237 Np through sandy soil was studied. Two experimental methods were performed by using batch and column systems. The distribution coefficients (K d ) obtained from the adsorption and desorption process are rather small about 16 and 21 cm 3 /g respectively. Size distribution of 237 Np species in the influent solution was measured by ultra-filtration technique. Migration mechanism of 237 Np was studied by column experiments. The experimental condition was the influence of volume of eluting solution; 100, 300, 500, 1000 and 2000 ml respectively. The result from five column experiments confirm that the sorption characteristics of 237 Np are mainly controlled by a reversible ion-exchange reaction and the migration of 237 Np in the sandy soil can be estimated by using the K d concept

  5. 48 CFR 2452.237-73 - Conduct of Work and Technical Guidance.

    Science.gov (United States)

    2010-10-01

    ... conditions of the contract. (c) The GTR will issue technical guidance in writing or, if issued orally, he/she... Technical Guidance. 2452.237-73 Section 2452.237-73 Federal Acquisition Regulations System DEPARTMENT OF... Provisions and Clauses 2452.237-73 Conduct of Work and Technical Guidance. As prescribed in 2437.110(d...

  6. Neutron Data Evaluation of 237Np

    International Nuclear Information System (INIS)

    Maslov, V.M.; Tetereva, N.A.; Kolesov, A.M.; Pronyaev, V.G.; Zolotarev, K.I.; Granier, T.; Hambsch, F.-J.

    2010-11-01

    The diverse measured data base of n+ 237 Np was evaluated using a statistical theory and generalized least squares codes. Consistent description of the total, fission and partial inelastic scattering data in 1-3 MeV energy range provides an important constraint for the absorption cross section, which is quite important for the robust estimate of the capture cross section in the 0.5-500 keV energy range. Important constraints for the measured capture cross section come from the average radiative S0 and S1 strength functions. The evaluated inelastic cross sections of available evaluations are in severe disagreement with measured data on the inelastic scattering of neutrons with excitation of specific groups of levels. A change of the inelastic data shape at E n ∼1.5 MeV might be explained by the sharp increase of the level density of the residual odd-even nuclide 237 Np due to the onset of three-quasi-particle excitations. The influence of exclusive (n, xnf) pre-fission neutrons on prompt fission neutron spectra (PFNS) and (n, xn) spectra is modeled. Contributions of emissive/non-emissive fission and exclusive spectra of (n, xnf) reactions are defined by a consistent description of the 237 Np (n, F), 237 Np (n, 2n) 236s Np reactions and the ratio of the yields of short-lived (1 - ) and long-lived (6 - ) 236 Np states measured at 14 MeV. Excited levels of 236 Np are modeled using predicted Gallher-Moshkowski doublets. This work is performed under the project Agreement B-1604 with the International Science and Technology Center (Moscow). The financing party is EU. Partial support of International Atomic Energy Agency under Research Contract 14809 is acknowledged by JINER. (author)

  7. 48 CFR 1452.237-71 - Utilization of Woody Biomass.

    Science.gov (United States)

    2010-10-01

    ... Biomass. 1452.237-71 Section 1452.237-71 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR... Utilization of Woody Biomass. As prescribed in § 1437.7202, insert the following clause: Utilization of Woody Biomass (MAY 2005) (a) The contractor may remove and utilize woody biomass, if: (1) Project work is...

  8. Chemical aspects of 237 Np Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Karraker, D.G.

    1984-01-01

    The 237 Np Moessbauer effect has been especially useful in studies of neptunium chemistry, by virtue of its excellent resolution and straightforward experimental techniques. Neptunium can have valences from +3 to +7, and a broad range of compounds can be prepared that are analogous to those of other actinide elements. Studies on neptunium compounds, for example, have a ready application to the analogous compounds of uranium and plutonium. The emphasis in this paper will be on the application of the 237 Np Moessbauer effect to problems in neptunium chemistry

  9. 48 CFR 352.237-71 - Crime Control Act-reporting of child abuse.

    Science.gov (United States)

    2010-10-01

    ...-reporting of child abuse. 352.237-71 Section 352.237-71 Federal Acquisition Regulations System HEALTH AND... Clauses 352.237-71 Crime Control Act—reporting of child abuse. As prescribed in 337.103-70(b), the Contracting Officer shall insert the following clause: Crime Control Act of 1990—Reporting of Child Abuse...

  10. 49 CFR 237.9 - Waivers.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION BRIDGE SAFETY STANDARDS General § 237.9 Waivers. (a) Any person subject to a requirement of this... compliance is in the public interest and is consistent with railroad safety, the Administrator may grant the... Administrator publishes a notice in the Federal Register containing the reasons for granting the waiver. ...

  11. Neutron induced fission of 237Np – status, challenges and opportunities

    Directory of Open Access Journals (Sweden)

    Ruskov Ivan

    2018-01-01

    Full Text Available Nowadays, there is an increased interest in a complete study of the neutron-induced fission of 237Np. This is due to the need of accurate and reliable nuclear data for nuclear science and technology. 237Np is generated (and accumulated in the nuclear reactor core during reactor operation. As one of the most abundant long-lived isotopes in spent fuel (“waste”, the incineration of 237Np becomes an important issue. One scenario for burning of 237Np and other radio-toxic minor actinides suggests they are to be mixed into the fuel of future fast-neutron reactors, employing the so-called transmutation and partitioning technology. For testing present fission models, which are at the basis of new generation nuclear reactor developments, highly accurate and detailed neutron-induced nuclear reaction data is needed. However, the EXFOR nuclear database for 237Np on neutron-induced capture cross-section, σγ, and fission cross-section, σf, as well as on the characteristics of capture and fission resonance parameters (Γγ, Γf, σoΓf, fragments mass-energy yield distributions, multiplicities of neutrons vn and γ-rays vγ, has not been updated for decades.

  12. 7 CFR 205.237 - Livestock feed.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling Requirements § 205.237 Livestock feed. (a... specific stage of life; (3) Feed plastic pellets for roughage; (4) Feed formulas containing urea or manure...

  13. 32 CFR 237a.4 - Procedures.

    Science.gov (United States)

    2010-07-01

    ...); (c) Industrial programs which are in support of Government policy (example—international exhibits..., authorized by part 237 of this subchapter to apprise defense contractors, trade associations and other... governing research, development and production, and the procurement of goods and services, and serve as a...

  14. Conversion-electron experiment to characterize the decay of the 237Np shape isomer

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Bauer, R.W.; Gardner, D.G.; Decman, D.J.; Meyer, R.A.; Roy, N.; Sale, K.E.

    1987-01-01

    Conversion electrons from the decay of low-lying levels of 237 Np have been measured to detect the population of these levels by gamma-ray decay of the 237 Np shape isomer. Analysis of the 208-keV transition L conversion-electron peak gives an upper limit of about 17 μb for the population of the 3/2 - 267-keV level in 237 Np from the shape isomer decay. Model calculations are compared with the measured limit. Improvements are suggested for this experiment. 9 refs., 4 figs

  15. 48 CFR 852.237-70 - Contractor responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contractor....237-70 Contractor responsibilities. As prescribed in 837.110, insert the following clause: Contractor Responsibilities (APR 1984) The contractor shall obtain all necessary licenses and/or permits required to perform...

  16. 49 CFR 237.155 - Documents and records.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Documentation, Records, and Audits of Bridge Management Programs § 237.155 Documents and records. Each track owner required to implement a bridge management... protected by a security system that incorporates a user identity and password, or a comparable method, to...

  17. 48 CFR 1852.237-71 - Pension portability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Pension portability. 1852... 1852.237-71 Pension portability. As prescribed at 1837.110-70(b), insert the following clause: Pension Portability (JAN 1997) (a) In order for pension costs attributable to employees assigned to this contract to...

  18. 237 Np analytical method using 239 Np tracers and application to a contaminated nuclear disposal facility

    Energy Technology Data Exchange (ETDEWEB)

    Snow, Mathew S.; Morrison, Samuel S.; Clark, Sue B.; Olson, John E.; Watrous, Matthew G.

    2017-06-01

    Environmental 237Np analyses are challenged by low 237Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237Np analytical approach employing the short lived 239Np (t1/2 = 2.3 days) as a chemical yield tracer followed by 237Np quantification using inductively coupled plasma-mass spectrometry. 239Np tracer is obtained via separation from a 243Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 watt “Walmart” microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 106 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237Np contamination within 600 meters of this site, with maximum 237Np concentrations on the order of 103 times greater than nuclear weapons testing fallout levels.

  19. Role of ser-237 in the substrate specificity of the carbapenem-hydrolyzing class A beta-lactamase Sme-1.

    Science.gov (United States)

    Sougakoff, W; Naas, T; Nordmann, P; Collatz, E; Jarlier, V

    1999-08-17

    The role of the serine residue found at position 237 in the carbapenemase Sme-1 has been investigated by constructing a mutant in which Ser-237 was replaced by an alanine. The S237A mutant showed a catalytic behavior against penicillins and aztreonam very similar to that of Sme-1. By contrast, S237A was characterized by a reduced catalytic efficiency against cephems, such as cephalothin and cephaloridine. In addition, the weak activity of Sme-1 against the cephamycin cefoxitin was hardly detectable with the mutant enzyme. Finally, the Ser-237-->Ala mutation resulted in a marked decrease in catalytic activity against imipenem, showing that Ser-237 contributes to the carbapenemase activity of the class A beta-lactamase Sme-1.

  20. 237Np analytical method using 239Np tracers and application to a contaminated nuclear disposal facility.

    Science.gov (United States)

    Snow, Mathew S; Morrison, Samuel S; Clark, Sue B; Olson, John E; Watrous, Matthew G

    2017-06-01

    Environmental 237 Np analyses are challenged by low 237 Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237 Np analytical approach employing the short lived 239 Np (t 1/2  = 2.3 days) as a chemical yield tracer followed by 237 Np quantification using inductively coupled plasma-mass spectrometry. 239 Np tracer is obtained via separation from a 243 Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 W "Walmart" microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 10 6 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237 Np contamination within 600 m of this site, with maximum 237 Np concentrations on the order of 10 3 times greater than nuclear weapons testing fallout levels. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. 32 CFR 237a.3 - Objective and policy.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS PUBLIC AFFAIRS LIAISON WITH INDUSTRY § 237a.3 Objective and policy. (a) It is important that...D. Such understanding can be achieved by (1) wide dissemination of information to the business community, consistent with national security, and (2) cooperation with industry in public relations...

  2. 48 CFR 1552.237-76 - Government-Contractor Relations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government-Contractor... 1552.237-76 Government-Contractor Relations. As prescribed in 1537.110(g), insert the following clause: Government-Contractor Relations (JUN 1999) (a) The Government and the Contractor understand and agree that...

  3. Updated and revised neutron reaction data for 237Np

    Directory of Open Access Journals (Sweden)

    Chen Guochang

    2017-01-01

    Full Text Available Nuclear data with high accuracy for minor actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides in high burn-up reactors and the minor actinides transmutation. Based on the evaluated experimental data, the updated and revised evaluation of a full set of n+237Np nuclear data from 10−5 eV ∼ 20 MeV are carried out and recommended. Mainly revised quantities are neutron multiplicities from fission reaction, inelastic, fission, (n, 2n and (n, γ reaction cross sections as well as angular distribution and so on. The promising results are obtained when the renewal evaluated data of 237Np will be used to instead of the evaluated data in CENDL-3.1 database.

  4. Analysis of Np-237 ENDF for the theortical interpretation of critical assembly experiments.

    Energy Technology Data Exchange (ETDEWEB)

    Mihaila, B. (Bogdan); Chadwick, M. B. (Mark B.); MacFarlane, R. E. (Robert E.); Kawano, T. (Toshihiko)

    2004-01-01

    We report on the present status of our effort toward an improved Np-237 evaluated nuclear data file (ENDF). The aim here is to bridge the gap between calculated and observed k-eff values, as measured at the Np-U critical assembly at LANL, TA-18. As such, we perform a critical analysis of the existing body of experimental data and recommended evaluations. We are targeting in principal the fission nu-bar and cross section in Np-237, as well as the inelastic scattering which is particularly important since Np-237 is a threshold fissioner. This analysis will be employed in a future sensitivity study of the calculated k-eff with respect to variations of the afore mentioned nuclear data.

  5. 48 CFR 2152.237-70 - Continuity of services.

    Science.gov (United States)

    2010-10-01

    ...-out services for up to 10 months after this contract expires and (2) negotiate in good faith a plan... contract. The Contractor also must, except if prohibited by applicable law, disclose necessary personnel... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2152.237-70 Continuity of services. As...

  6. 238U and 237Np nuclear fission by 90-270 MeV electrons

    International Nuclear Information System (INIS)

    Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

    1981-01-01

    A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

  7. Integral test for Np237 and Am241 cross sections in JENDL, ENDF and JEF libraries

    International Nuclear Information System (INIS)

    Iwasaki, Tomohiko; Unesaki, Hironobu; Kitada, Takanori

    2002-01-01

    Experiments using Kyoto University critical assembly (KUCA) were performed for measuring the capture and fission reaction rates of 237 Np and 241 Am. A back-to-back fission chamber was employed for the measurement of the fission rate of 237 Np and 241 Am relative to 235 U. The capture rate of 237 Np relative to 197 Au was measured by using activation method. Eleven cores, of which the spectra were changed systematically, were mocked up for the present measurements. Five cores among the eleven were utilized for the fission reaction rate measurement. The experiment was analyzed using the Monte Carlo code MVP, the transport code TWOTRAN and the diffusion code CITATION using the libraries based on JENDL3.2, ENDF/B-VI and JEF2.2. As the results, for 237 Np, JENDL3.2 showed good agreement for both capture and fission. However, for the fission rate of 241 Am, JENDL3.2 underestimates 15-20%. On the other hand, ENDF/B-VI and JEF2.2 show different C/Es for 237 Np and 241 Am. (author)

  8. 15 CFR 23.7 - Notice to Department of Commerce organizational units of implementation and procedures.

    Science.gov (United States)

    2010-01-01

    ... organizational units of implementation and procedures. 23.7 Section 23.7 Commerce and Foreign Trade Office of the... Department of Commerce organizational units of implementation and procedures. Following are roles and...) Otherwise determine and control the use of missing children materials and information by the Operating Unit...

  9. 48 CFR 352.237-70 - Pro-Children Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Pro-Children Act. 352.237...-Children Act. As prescribed in 337.103-70(a), the Contracting Officer shall insert the following clause: Pro-Children Act (January 2006) (a) Public Law 103-227, Title X, Part C, also known as the Pro...

  10. Preparation of /sup 237/Np samples by electrodeposition and its determination by alpha spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Mertzig, W; Matsuda, H T; Araujo, B.F. de; Araujo, J.A. de [Instituto de Pesquisas Energeticas e Nucleares, Sao Paulo (Brazil). Centro de Engenharia Quimica

    1980-01-01

    An analytical method followed by alpha spectrometry was developed for the determination of trace amounts of actinides. A technique for quantitative electrodeposition of /sup 237/Np, under optimal conditions, using a carrier, is presented. This method will be applied for the control of trace amounts of /sup 237/Np in the solutions from the reprocessing (Purex process) of irradiated uranium.

  11. Distribution of global fallout 237Np, Pu isotopes, and 241Am in lake and sea sediments

    International Nuclear Information System (INIS)

    Yamamoto, Masayoshi; Yamauchi, Y.; Chatani, K.; Komura, K.; Ueno, Kaoru; Sakanoue, Masanobu

    1991-01-01

    In order to investigate the sedimentary behaviour of neptunium, 237 Np together with Pu isotopes and 241 Am were measured for the sediment cores collected from Lake Mikata (freshwater), from Lake Kugushi (brakish water) and from Nyu Bay (sea water). In all sediment core samples 237 Np was detected, and its concentrations were far below those of 239,240 Pu and 241 Am measured for the same samples. Inventories of 237 Np in the lakes were estimated to be 0.53, 0.29 and 0.34 MBq/km 2 , respectively. The activity ratios of 237 Np/ 239,240 Pu, except for Lake Mikata, are two or three times lower than the value of 0.3-0.4% observed for surface soils of 0-20 cm depth, suggesting that Np is more soluble compared with Pu. (author) 21 refs.; 6 figs.; 3 tabs

  12. Neptunium-237 in the marine environment determination in animal and plant species in the English Channel

    International Nuclear Information System (INIS)

    Germian, P.

    1990-01-01

    The uptake of 237 Np was studied in marine plants and animals belonging to several phyla. Samples were collected from the end of January 1986 to March 1986 in a sampling station near the fuel reprocessing plant at La Hague. 237 Np was determined by neutron activation analysis. The transfer modes of 237 Np to the various species as a function of their trophic levels are discussed as well as the distribution among the organs in the species consumed and the radiological impact of human consumption. (author) 27 refs.; 2 figs.; 1 tab

  13. Role of once-daily glycopyrronium bromide (NVA237 in the management of COPD

    Directory of Open Access Journals (Sweden)

    D’Urzo A

    2013-08-01

    Full Text Available Anthony D'UrzoDepartment of Family and Community Medicine, University of Toronto, Toronto, ON, CanadaAbstract: Progressive airflow limitation is a hallmark feature of chronic obstructive pulmonary disease (COPD that ultimately leads to breathlessness, impaired quality of life, and reduced exercise capacity. Pharmacotherapy is used in patients with COPD to prevent and control symptoms, reduce both the frequency and severity of exacerbations, improve health status, and increase exercise tolerance. These strategies are intended to address management issues which promote both current disease control and a reduction in the risk of disease deterioration in the future. At the present time, long-acting β2-agonists (LABAs and long-acting muscarinic antagonists (LAMAs are available for maintenance therapy in patients with persistent symptoms. Tiotropium was the first LAMA to be approved for management of COPD, and many studies have described its beneficial effects on multiple clinically relevant outcomes. Glycopyrronium bromide (NVA237, a new LAMA, has been developed and received regulatory approval for management of COPD in a number of countries around the world. Results from pivotal Phase III trials suggest that NVA237 is safe and well tolerated in patients with moderate to severe COPD, and provides rapid and sustained improvements in lung function. Further, these changes are associated with statistically and clinically meaningful improvements in dyspnea, health-related quality of life, and exercise tolerance. Treatment with NVA237 also results in a significant reduction in risk of exacerbations and the need for rescue medication, and has been comparable with tiotropium with respect to safety and efficacy outcomes. Finally, emerging data indicate that NVA237 is efficacious both as monotherapy and in combination with indacaterol.Keywords: glycopyrronium bromide, NVA237, chronic obstructive pulmonary disease, inhaled long-acting bronchodilators

  14. 48 CFR 2452.237-75 - Clearance of contractor personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Clearance of contractor... Clauses 2452.237-75 Clearance of contractor personnel. As prescribed in 2437.110(e), insert the following clause in solicitations and contracts. Clearance of Contractor Personnel (OCT 1999) (a) General. This...

  15. Sorption of 237Pu by the diatom Asterionella formosa

    International Nuclear Information System (INIS)

    Conway, H.L.; Wahlgren, M.A.; Peterson, N.; Nelson, D.M.

    1976-01-01

    Knowledge of the behavior of the man-made radionuclide plutonium within aquatic environments is of fundamental importance in assessing its potential hazards and ecological impact. The sorption of plutonium by phytoplankton and other algae is the dominant factor in the biological transport of plutonium in the aquatic environment, and it has been suggested that sorption by phytoplankton may be responsible for the seasonal loss of plutonium from the epilimnion of Lake Michigan. A unialgal diatom culture was spiked with 237 Pu tracer solution in an attempt to simulate the behavior of fallout plutonium observed in field studies. The results were encouraging in that the 237 Pu in the filtered lake water medium exhibited strongly anionic properties similar to fallout plutonium in Lake Michigan, with limited sorption on container walls. The purpose of the present study was to extend the investigations of the sorption of plutonium by phytoplankton in a controlled environment using continuous culture techniques

  16. A Single Recessive Mutated Gene (Sd237-1) Controlling Semi-Dwarf Plant Stature of Rice

    International Nuclear Information System (INIS)

    Sobrizal

    2009-01-01

    Dwarfism is a valuable trait in crop breeding, because it increases lodging resistance and decreases damages due to wind and rain. During the course of this study, a semi-dwarf mutant was successfully induced through 200 Gy gamma ray irradiated KI 237 seeds. KI 237 is a pure line with high yield potency, developed through an Indica-Japonica cross of IR36 / Koshihikari. The selected semi-dwarf plant reached 60 - 62 % of plant height of original plant KI 237 at the mature stage. The length of inter nodes, panicle, and seed were also compared between these two plants. The retardation of the 1 st (uppermost) inter nodes was 24 %, moreover, the retardation of panicle and seed length were only 10 % and 2 %, respectively. The elongation pattern of the inter nodes in this mutant was almost the same as sd1 (Dee-geo-woo-gen), the original parent of the first release modern rice variety, but their performances were different. Based on the segregation analysis in M 2 and M 3 generation it was concluded that this mutant was controlled by a single recessive mutated gene. This gene was designated as sd 237-1 . This mutant should be useful as a genetic resource for the improvement of KI 237 line through back-cross breeding as well as be developed further in breeding program directly to be a new high yielding mutant variety. (author)

  17. 48 CFR 237.7101 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... contracts for laundry and dry cleaning services to be provided on a count-of-articles basis. (d) Use the clause at 252.237-7015, Loss or Damage (Weight of Articles), in solicitations and contracts for laundry... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitation provisions...

  18. Role of transitional levels in 237Np (γ,f): Perspectives for studying highly deformed systems

    International Nuclear Information System (INIS)

    Arruda-Neto, J. D. T.; Mesa, J.; Garcia, F.; Rodriguez, O.; Geraldo, L. P.; Garcia, C.; Guzman, F.; Rodrigues, T. E.; Shtejer, K.; Semmler, R.

    2006-01-01

    The transition levels at the top of the two 237 Np fission barriers were obtained for the first time by means of the so-called semimicroscopic combined method, which we have developed and implemented. To overcome the difficulties in dealing with large nuclear deformations, we used our developed BARRIER code, which calculates single-particle spectra in a deformed Woods-Saxon potential using a coordinate system based on Cassini ovaloids as nuclear shape parametrization. The results enabled us to describe the experimentally observed near-barrier photofission cross-section structures for 237 Np, as well as a subbarrier shelf, the latter being consistently interpreted in terms of the accumulation of levels at the top of the inner and outer double fission barrier of 237 Np

  19. Field study of the migration of 237Np, 238Pu and 241Am in a weak loess aquifer

    International Nuclear Information System (INIS)

    Liu, C.L.; Wang, Z.M.; Li, S.S.; Yang, Y.E.; Li, B.; Jiang, H.; Jiang, L.; Wang, L.; Li, D.

    2004-01-01

    The migration of 237 Np, 238 Pu and 241 Am in a weak loess aquifer was investigated in-situ in an Underground Research Facility. Quartz containing 237 Np, 238 Pu, 241 Am and 3 H was introduced into the aquifer with a stainless steel tube. The local water flow in the aquifer was monitored using a 3-dimensional sampling system. The contaminated area of the aquifer was obtained wholly with the help of a pre-installed stainless steel frame and cut into small pieces (samples) 3-dimensionally and analyzed. 3 H in the water samples was determined with a liquid scintillation analyzer (Tri-Camb 2250). Radioactivity of 237 Np and 241 Am in the soil samples were determined with a low energy photon detector (HPGe), 238 Pu was analyzed with a low background αandβ detector after chemical separation. The result of the 3-year experiment indicated that 237 Np, 238 Pu and 241 Am were strongly absorbed by the loess aquifer. The retardation factor of 237 Np in the loess aquifer was 1.54 x 10 4 . (author)

  20. 29 CFR 779.237 - Enterprise engaged in commerce or in the production of goods for commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Enterprise engaged in commerce or in the production of goods for commerce. 779.237 Section 779.237 Labor Regulations Relating to Labor (Continued) WAGE AND... commerce or in the production of goods for commerce. Under section 3(s) the “enterprise” to be covered must...

  1. The 'overlooked trio' of hypothetical terrorist nuclear weapons - reactor grade plutonium, neptunium-237 and tritium

    International Nuclear Information System (INIS)

    Sholly, S.

    2002-01-01

    Full text: Considerations revolving around physical protection of nuclear material are quite commonly and naturally focused on protecting weapons-grade plutonium (WGPu) and highly enriched uranium (HEU) from theft and diversion. These two materials are the center of attention because of their well-known (and demonstrated) potential for use in first-generation nuclear explosive devices of which potential terrorists are widely thought to be capable. They are also the center of attention because of retirements of these materials from military use as the Russian Federation and the United States reduce the number of nuclear weapons in their arsenals. Three other materials - an 'overlooked trio' - must also be borne in mind within this context: (1) reactor-grade plutonium (RGPu); (2) neptunium-237 (Np-237); and (3) tritium (H-3). Although there are still some authorities who either contend that RGPu cannot be used in a nuclear explosive or that there are (for a terrorist) insurmountable difficulties in doing so, the knowledgeable scientific and technical community, recognizes the potential utility of RGPu for hypothetical terrorist nuclear devices. A much smaller community of experts recognizes the usefulness of Np-237 for nuclear devices, but Np-237 is as straight-forwardly and easily usable as HEU and similarly abundant (but not often in separated form). Tritium can be used (with a modest increase in design sophistication) in a conventional first-generation nuclear device with any of the weapons-usable materials (WGPu, HEU, RGPu or Np-237) to increase the yield and/or increase the reliability of a non-fizzle yield. Given the presence of RGPu and Np-237 in abundant quantities in spent commercial reactor fuel, widely available knowledge of how to separate these materials, and a world-wide total of more than 400 nuclear power plants, spent reactor fuel also requires stringent controls. This is especially true of old spent fuel which has far less radiation dose

  2. Distribution of global fallout sup 237 Np, Pu isotopes, and sup 241 Am in lake and sea sediments

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Masayoshi; Yamauchi, Y; Chatani, K; Komura, K; Ueno, Kaoru; Sakanoue, Masanobu [Kanazawa Univ., Ishikawa (Japan). Low Level Radioactivity Lab.; Igarashi, Syuiti [Fukui Prefectural Inst. of Public Health (Japan)

    1991-01-01

    In order to investigate the sedimentary behaviour of neptunium, {sup 237}Np together with Pu isotopes and {sup 241}Am were measured for the sediment cores collected from Lake Mikata (freshwater), from Lake Kugushi (brakish water) and from Nyu Bay (sea water). In all sediment core samples {sup 237}Np was detected, and its concentrations were far below those of {sup 239,240}Pu and {sup 241}Am measured for the same samples. Inventories of {sup 237}Np in the lakes were estimated to be 0.53, 0.29 and 0.34 MBq/km{sup 2}, respectively. The activity ratios of {sup 237}Np/{sup 239,240}Pu, except for Lake Mikata, are two or three times lower than the value of 0.3-0.4% observed for surface soils of 0-20 cm depth, suggesting that Np is more soluble compared with Pu. (author) 21 refs.; 6 figs.; 3 tabs.

  3. Peaceful berkelium

    Science.gov (United States)

    Trabesinger, Andreas

    2017-09-01

    The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

  4. Determination of traces of 237Np in environmental samples by ICP-MS after separation using TOA extraction chromatography

    International Nuclear Information System (INIS)

    Ji, Y.Q.; Li, J.Y.; Luo, S.G.; Wu, T.; Liu, J.L.

    2001-01-01

    A simple, rapid, cost-efficient, and robust method for separation of 237 Np with an extraction chromatographic column (TOA: tri-n-octylamine on Teflon powder) is outlined in detail and further improved for direct ICP-MS analysis. The column efficiently retained 237 Np in 2 mol L -1 HNO 3 medium and all of the 237 Np was easily eluted with 0.02 mol L -1 oxalic acid in 0.16 mol L -1 HNO 3 at 95 C. The separated solutions were free from most matrix elements and were aspirated into the ICP-MS directly. The decontamination factor for 238 U is more than 10 4 . The instrumental detection limit for 237 Np was 0.46 pg mL -1 , which corresponds to 1.2 x 10 -5 Bq mL -1 . The method is more rapid than traditional radiometric techniques. It is also considered to be more suitable for environmental monitoring than existing methods based on TOA. (orig.)

  5. Determination of traces of 237Np in environmental samples by ICP-MS after separation using TOA extraction chromatography.

    Science.gov (United States)

    Ji, Y Q; Li, J Y; Luo, S G; Wu, T; Liu, J L

    2001-09-01

    A simple, rapid, cost-efficient, and robust method for separation of 237Np with an extraction chromatographic column (TOA: tri-n-octylamine on Teflon powder) is outlined in detail and further improved for direct ICP-MS analysis. The column efficiently retained 237Np in 2 mol L(-1) HNO3 medium and all of the 237Np was easily eluted with 0.02 mol L(-1) oxalic acid in 0.16 mol L(-1) HNO3 at 95 degrees C. The separated solutions were free from most matrix elements and were aspirated into the ICP-MS directly. The decontamination factor for 238U is more than 10(4). The instrumental detection limit for 237Np was 0.46 pg mL(-1), which corresponds to 1.2 x 10(-5) Bq mL(-1). The method is more rapid than traditional radiometric techniques. It is also considered to be more suitable for environmental monitoring than existing methods based on TOA.

  6. Efficacy and safety of once-daily NVA237 in patients with moderate-to-severe COPD: the GLOW1 trial

    Directory of Open Access Journals (Sweden)

    D'Urzo Anthony

    2011-12-01

    Full Text Available Abstract Background NVA237 is a once-daily dry-powder formulation of the long-acting muscarinic antagonist glycopyrronium bromide in development for the treatment of chronic obstructive pulmonary disease (COPD. The glycopyrronium bromide in COPD airways clinical study 1 (GLOW1 evaluated the efficacy, safety and tolerability of NVA237 in patients with moderate-to-severe COPD. Methods Patients with COPD with a smoking history of ≥ 10 pack-years, post-bronchodilator forced expiratory volume in 1 second (FEV1 1/forced vital capacity 1 antagonists permitted in patients stabilized on them prior to study entry. The primary outcome measure was trough FEV1 at Week 12. Results A total of 822 patients were randomized to NVA237 (n = 552 or placebo (n = 270. Least squares mean (± standard error trough FEV1 at Week 12 was significantly higher in patients receiving NVA237 (1.408 ± 0.0105 L, versus placebo (1.301 ± 0.0137 L; treatment difference 108 ± 14.8 mL, p 1 were apparent at the end of Day 1 and sustained through Week 26. FEV1 was significantly improved in the NVA237 group versus placebo throughout the 24-hour periods on Day 1 and at Weeks 12 and 26, and at all other visits and timepoints. Transition dyspnoea index focal scores and St. George's Respiratory Questionnaire scores were significantly improved with NVA237 versus placebo at Week 26, with treatment differences of 1.04 (p Conclusions Once-daily NVA237 was safe and well tolerated and provided rapid, sustained improvements in lung function, improvements in dyspnoea, and health-related quality of life, and reduced the risk of exacerbations and the use of rescue medication. Trial registration ClinicalTrials.gov: NCT01005901

  7. Np-237 incineration study in various beams in ADS setup QUINTA

    Directory of Open Access Journals (Sweden)

    Kilim Stanisław

    2018-03-01

    Full Text Available Neptunium-237 samples were irradiated in a spallation neutron field produced in accelerator-driven system (ADS setup QUINTA. Five experiments were carried out on the accelerators at the JINR in Dubna - one in carbon (C6+, three in deuteron, and one in a proton beam. The energy in carbon was 24 GeV, in deuteron 2, 4 and 8 GeV, respectively, and 660 MeV in the proton beam. The incineration study method was based on gamma-ray spectrometry. During the analysis of the spectra several fission products and one actinide were identified. Fission product activities yielded the number of fissions. The actinide (Np-238, a result of neutron capture by Np-237, yielded the number of captures. The main goal of this work was to find out if and how the incineration rate depended on parameters of the accelerator beam.

  8. 'n Nota oor die vertaling van Jeremia 2:37 ("Met jou hande op jou hoof"

    Directory of Open Access Journals (Sweden)

    H.F. Stander

    1998-08-01

    Full Text Available A note on the translation of Jeremiah 2:37 ("With your hands on your head" In Jeremiah 2:37 God says to Israel: "You will leave that place (= Egypt with your hands upon your head". In this article various Bible translations and commentaries are scrutinized to determine how modem exegetes interpret this phrase. Thereafter the author discusses Egyptian depictions of mourners in funeral processions with their hands on their heads. He shows how an exploration of Egyptian Art can contribute to a better understanding of Jeremiah 2:37. This study also shows that the two dynamic Afrikaans translations of the Bible ("Die Lewende Bybel" and "Die Nuwe Afrikaanse Vertaling" are wide off the mark in their interpretation of the phrase "with your hands on your head". The author also argues that exegetes should not only rely on written texts when they study the ancient world in which the Scriptures originated, but that they should also explore works of art.

  9. 40 CFR 81.237 - Northeast Georgia Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Georgia Intrastate Air... Air Quality Control Regions § 81.237 Northeast Georgia Intrastate Air Quality Control Region. The Northeast Georgia Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

  10. A novel Meloidogyne graminicola effector, MgMO237, interacts with multiple host defence-related proteins to manipulate plant basal immunity and promote parasitism.

    Science.gov (United States)

    Chen, Jiansong; Hu, Lili; Sun, Longhua; Lin, Borong; Huang, Kun; Zhuo, Kan; Liao, Jinling

    2018-02-27

    Plant-parasitic nematodes can secrete effector proteins into the host tissue to facilitate their parasitism. In this study, we report a novel effector protein, MgMO237, from Meloidogyne graminicola, which is exclusively expressed within the dorsal oesophageal gland cell and markedly up-regulated in parasitic third-/fourth-stage juveniles of M. graminicola. Transient expression of MgMO237 in protoplasts from rice roots showed that MgMO237 was localized in the cytoplasm and nucleus of the host cells. Rice plants overexpressing MgMO237 showed an increased susceptibility to M. graminicola. In contrast, rice plants expressing RNA interference vectors targeting MgMO237 showed an increased resistance to M. graminicola. In addition, yeast two-hybrid and co-immunoprecipitation assays showed that MgMO237 interacted specifically with three rice endogenous proteins, i.e. 1,3-β-glucan synthase component (OsGSC), cysteine-rich repeat secretory protein 55 (OsCRRSP55) and pathogenesis-related BetvI family protein (OsBetvI), which are all related to host defences. Moreover, MgMO237 can suppress host defence responses, including the expression of host defence-related genes, cell wall callose deposition and the burst of reactive oxygen species. These results demonstrate that the effector MgMO237 probably promotes the parasitism of M. graminicola by interacting with multiple host defence-related proteins and suppressing plant basal immunity in the later parasitic stages of nematodes. © 2018 BSPP AND JOHN WILEY & SONS LTD.

  11. Photofission Cross Sections for 237Np in the Energy Interval from 5.27 to 10.83 MeV

    International Nuclear Information System (INIS)

    Geraldo, L.P.; Semmler, R.; Goncalez, O. L.; Mesa, J.; Arruda-Neto, J.D.T.; Garcia, F.; Rodriguez, O.

    2000-01-01

    Photofission cross sections for 237 Np have been measured as a function of energy, in the interval from 5.27 to 10.83 MeV. The gamma-ray spectra were those produced by thermal neutron capture, in 30 different target materials, at a tangential beam hole of the Instituto de Pesquisas Energeticas e Nucleares IEA-R1 2-MW research reactor. The set of experimental data has been unfolded employing least-squares methods and the covariance matrix methodology. The determined photofission cross sections for 237 Np, together with the complete correlation matrix for the involved errors, are presented and are compared with previous measurements reported in the literature. A statistical calculation for the 237 Np photofission cross sections was performed, and the results are compared with the experimental data

  12. Transmutation of actinide 237Np with a fusion reactor and a hybrid reactor

    International Nuclear Information System (INIS)

    Feng, K.M.; Huang, J.H.

    1994-01-01

    The use of fusion reactors to transmute fission reactor wastes to stable species is an attractive concept. In this paper, the feasibility of transmutation of the long-lived actinide radioactive waste Np-237 with a fusion reactor and a hybrid reactor has been investigated. A new waste management concept of burning HLW (High Level Waste), utilizing released energy and converting Np-237 into fissile fuel Pu-239 through transmutation has been adopted. The detailed neutronics and depletion calculation of waste inventories was carried out with a modified version of one-dimensional neutron transport and burnup calculation code system BISON1.5 in this study. The transmutation rate of Np with relationship to neutron wall loading, Pu and Np with relationship to neutron wall load, Pu and Np concentration in the transmutation zone have been explored as well as relevant results are also given

  13. Use of the electrodeposition technique in the preparation of samples of 237Np and its determination by alpha spectrometry

    International Nuclear Information System (INIS)

    Mertzig, W.; Matsuda, H.T.; Araujo, B.F. de; Araujo, J.A. de.

    1981-05-01

    The electroplating technique to prepare 237 Np source and its determination by alpha spectrometry is presented. The samples were prepared using a lucite-eletrolitic cell manufactured at IPEN, specially to trace amounts of actinides. A polished brass disk coated with Ni film has been used as cathodo and a fixed Pt wire as anode. The electroplated samples were alpha counted using a surface barrier detector. The optimum conditions to obtain the quantitative deposition of 237 Np have been achieved by studying the effects of some parameters as current density, pH and concentration of eletrolitic solution and time of eletrodeposition, using a carrier technique. After preliminary purification, the method is applied to control trace amounts of 237 Np in the Purex process solutions. (Author) [pt

  14. 242Pu as tracer for simultaneous determination of 237Np and 239,240Pu in environmental samples

    DEFF Research Database (Denmark)

    Chen, Q.J.; Dahlgaard, H.; Nielsen, S.P.

    2002-01-01

    A procedure has been developed using Pu-242 as tracer for simultaneous determination of Np-237 and Pu-239,Pu-240 in environmental samples. The validity of the method has been demonstrated by ICPMS and alpha-spectroscopy for up to 10 gram soil and sediment, seawater up to 200 litres. The paper...... from Np and Pu) R-before/R-after = 1.004 +/- 3.3% (S.D n = 20) and 1 litre seawater R-before/R-after = 1.019+/-1.9% (S.D., n = 12). Results from the intercomparison samples LAEA-135, LAEA-381 and from environmental samples are presented....... describes a suitable chemical procedure for Np and Pu including a quantitative pre-concentration of neptunium and plutonium, preparation of Np4+ and Pu4+, NP(NO3)(6)(2-) and Pu(NO3)(6)(2-), The ratio of Np-237/Pu-242 (or Np-237/Pu-239) before and after the procedure has been determined using 10 g soil (free...

  15. Transfer of 241Am and 237Pu from euphausiid moults to a carbonate-rich marine sediment

    International Nuclear Information System (INIS)

    Hargrave, B.T.

    1986-01-01

    Concentrations of 241 Am and 237 Pu adsorbed onto moulted exoskeletons from the euphausiid Meganyctiphanes norvegica decreased exponentially with 50% retention times of 3-7 d when moults were incubated in filtered seawater with small amounts of carbonate-rich sediment. Over 95% of sediment weight was present as -2 ) was greatest in the medium-fine sand fraction which had the highest carbonate content. These particles constituted -2 surface: atoms μm -3 in solution) was 10 3 -10 4 times higher than similar quotients for 241 Am and 237 Pu sorbed to surfaces of organic particles are transferred to sediments. (author)

  16. 50 CFR 23.7 - What office do I contact for CITES information?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What office do I contact for CITES... FAUNA AND FLORA (CITES) Introduction § 23.7 What office do I contact for CITES information? Contact the following offices to receive information about CITES: Type of information Office to contact (a) CITES...

  17. Savannah River Plant 200 Area technical manual. Part SP. Processing of Np/sup 237/ and Pu/sup 238/

    Energy Technology Data Exchange (ETDEWEB)

    Hill, A.J. (comp.)

    1963-01-03

    This manual covers the technology involved in the 200 Area process for the recovery of Np/sup 237/ from certain aqueous waste streams in the separations plants, for the recovery of NP/sup 237/ and Pu/sup 238/ from irradiated NpO/sub 2/-Al slugs and for the fabrication of NpO/sub 2/-Al slugs. The manual contains sections on the fundamental chemistry, the primary recovery of Np by ion exchange, the decontamination of Np by ion exchange, the processing of NpO/sub 2/-Al targets, the separation and purification of Np/sup 237/ and Pu/sup 238/, the finishing of Np, the preparation of NpO/sub 2/, the disposal of spent resin, and the safety aspects of the handling of hydrazine. The section on the fabrication of NpO/sub 2/-Al slugs will be added later. 76 refs., 22 figs.

  18. The Synergistic Effect of Valsartan and LAF237 [(S-1-[(3-Hydroxy-1-AdamantylAmmo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Min Shen

    2012-01-01

    Full Text Available Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker and LAF237 (DPP-IV inhibitor on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n=40 were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(PH oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P<0.05; LAF237: 10.2 ± 1.7, P<0.05, VCAM-1 (fold change: valsartan : 5.2 ± 1.2, P<0.05; LAF237: 4.8 ± 0.6, P<0.05, and MCP-1 (fold change: valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P<0.05 expression. Moreover, the combination treatment with valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice.

  19. 27 CFR 24.237 - Spirits added to juice or concentrated fruit juice.

    Science.gov (United States)

    2010-04-01

    ... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.237 Spirits added to juice or... fruit juice to which spirits have been added will be included in the appropriate tax class of any wine inventory and will be properly identified. Juice or concentrated juice to which wine spirits are added will...

  20. Identification of Nilsson orbitals in the superdeformed minimum of 237Pu

    International Nuclear Information System (INIS)

    Morgan, Thomas James

    2008-01-01

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of 237 Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ( 236f U and 240f Pu) and vibrational excitations ( 240f Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in 237 Pu (t 1/2 =115 ns/1.12 μs) were investigated in a γ-spectroscopy experiment at the Cologne Tandem accelerator. Using the 235 U(α,2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4π parallel plate detector. The extremely rare isomeric γ decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted γ-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified γ transitions, independent level schemes were constructed for the two fission isomers in 237 Pu. The consistency of these level schemes was supported by the connecting γ transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single-particle calculations, Nilsson model and Woods-Saxon potential calculations. This

  1. LOFT CIS analysis 4''-WH-237-E inside containment penetration S-17B

    International Nuclear Information System (INIS)

    Nitzel, M.E.

    1978-01-01

    The stress analysis performed on the 4''-WH-237-E piping system inside containment penetration S-17B is presented. Deadweight, thermal expansion, and seismic loads were considered. Results of this analysis show that the subject piping system will meet ASME Code, Section III, Class 2 requirements

  2. First experiments on transmutation studies of iodine-129 and neptunium-237 using relativistic protons of 3.7 GeV

    International Nuclear Information System (INIS)

    Krivopustov, M.I.; Adam, J.; Bradnova, V.

    1997-01-01

    First experiments on the transmutation of long-lived 129 I and 237 Np using relativistic protons of 3.7 GeV are described. Relativistic protons generate in extended Pb-targets substantial neutron fluences. These neutrons get moderated in paraffin and are used for transmutation as follows: 129 (n, γ) 130 I(β - ) → 130 Xe(stable) and 237 Np(n, γ) 238 Np(β - ) →. The isotopes 130 I (T 1/2 =12.36 h) and 238 Np (T 1/2 =2.117 days) were identified radiochemically. One can estimate the transmutation cross section (n, γ) in the given neutron field as σ( 129 I(n, γ))=(10±2)b and σ( 237 Np(n, γ))=(140±30)b. The experiments were carried out in November 1996 at the Synchrophasotron, Laboratory of High Energies (LHE), Dubna, Russia

  3. The Synergistic Effect of Valsartan and LAF237 [(S)-1-[(3-Hydroxy-1-Adamantyl)Ammo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Science.gov (United States)

    Shen, Min; Sun, Dongdong; Li, Weijie; Liu, Bing; Wang, Shenxu; Zhang, Zheng; Cao, Feng

    2012-01-01

    Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker) and LAF237 (DPP-IV inhibitor) on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n = 40) were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(P)H oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P valsartan : 5.2 ± 1.2, P valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice. PMID:22474415

  4. The inhalation of insoluble iron oxide particles in the sub-micron ranges. Part II - Plutonium-237 labelled aerosols

    International Nuclear Information System (INIS)

    Waite, D.A.; Ramsden, D.

    1971-10-01

    The results of a series of inhalation studies using iron oxide particles in the size range 0.1 to 0.3 um (count median diameter) are described. In this series the aerosols were labelled with plutonium 237. In vivo detection, excretion analysis and crude location studies were obtainable and the results compared to the earlier studies using chromium 51 labelled aerosols. Plutonium 237 can be considered as a simulator for plutonium 239 and attempts are made to extrapolate the results to the problem of the estimation of plutonium 239 in the human lung. (author)

  5. New experimental determination of the neutronic resonance parameters of {sup 237}Np below 500 eV; Nouvelle determination experimentale des parametres de resonances neutroniques de {sup 237}Np en dessous de 500 eV

    Energy Technology Data Exchange (ETDEWEB)

    Gressier, V

    1999-10-01

    For studies of future nuclear reactors dedicated to nuclear waste transmutation, an improvement of the accuracy of the neutron radiative capture cross section of {sup 237}Np appears necessary. In the framework of a collaboration between the Commissariat a l'Energie atomique (CEA) and Institute for Reference Materials and Measurement (IRMM, Geel, Bergium), a new determination of the resonance parameters of {sup 237}Np has been performed. Two types of experiments are carried out at GELINA, the IRMM pulsed neutron source, using the time of flight method: a transmission experiment which is related to the neutron total cross section and a capture experiment which gives the neutron radiative capture cross section. The resonance parameters presented in this work are extracted from the transmission data between 0 and 500 eV with the least square code REFIT, using the Reich-Moore formalism. In parallel, the Doppler effect is investigated. The commonly used free gas model appears inadequate below 20 eV for neptunium dioxide at room temperature. By the use of the program DOPUSH, which calculates the Doppler broadening with a harmonic crystal model according to Lamb's theory, we are able to produce abetter fit of the experimental data for the resonances of {sup 237}Np in NpO{sub 2} at low energy or temperatures. In addition to the resonance parameters, a study of their mean value and distribution is included in this work. (authors)

  6. Biokinetics of 237Np in two marine benthic invertebrates

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1976-01-01

    The long-lived alpha-emitting actinide 237 Np (T 1/2 = 2.2 x 10 6 y) enters the aquatic environment directly from nuclear testing and reprocessing plant wastes as well as indirectly by in situ generation from 241 Am. Earlier studies on 239 Np in the Columbia river ecosystem demonstrated that neptunium accumulated in aquatic species such as algae, sponges and insect larvae but was not detectable in higher trophic level organisms. Based on these findings and the fact that neptunium is chemically similar to the rare earth elements, it has been suggested that this actinide would not easily become incorporated into aquatic biota

  7. (237)Np(n,f) Cross Section: New Data and Present Status

    CERN Document Server

    Paradela, C; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Vannini, G; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Duran, I; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Kaeppeler, F; Cortes, G; Cox, J; Voss, F; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Gunsing, F; Reifarth, R; Perrot, L; Lindote, A; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Koehler, P; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Ferrant, L; Lozano, M; Patronis, N; Chiaveri, E; Guerrero, C; Kadi, Y; Vicente, M C; Praena, J; Baumann, P; Oshima, M; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Cano-Ott, D; Pavlix, A; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Tarrio, D; Alvarez, H

    2011-01-01

    In this document, we present the final result obtained at the n_TOF experiment; for the neutron-induced fission cross section of the (237)Np, from the fission threshold up to 1 GeV. The method applied to get tins result is briefly discussed. n_TOF data are compared to the last experimental measurements using other TOF facilities or the surrogate method, reported experiments performed with monoenergetic sources and the FISCAL systematic, including a discussion about the existing discrepancies.

  8. Transmutation of 129I, 237Np, 238Pu, 239Pu, and 241Am using ...

    Indian Academy of Sciences (India)

    Results of transmutation studies of 129I, 237Np, 238Pu, 239Pu and 241Am are presented. Keywords. ... J Adam et al. Table 1. Samples properties for 0.7 and 1 GeV experiments. ..... If we suppose that this conclusion is true also for ratios in ...

  9. 49 CFR 237.73 - Protection of bridges from over-weight and over-dimension loads.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Protection of bridges from over-weight and over... (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Capacity of Bridges § 237.73 Protection of bridges from over-weight and over-dimension loads. (a) Each track owner...

  10. Evaluation of nuclear data of 244Pu and 237Pu

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Konshin, V.A.

    1995-10-01

    The evaluation of nuclear data for 244 Pu and 237 Pu was made in the neutron energy region from 10 -5 eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for 244 Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author)

  11. Transuranium element chalcogenides. Crystallochemistry and Moessbauer spectrometry of neptunium 237 chalcogenides

    International Nuclear Information System (INIS)

    Thevenin, T.; Pages, M.; Damien, D.

    1981-09-01

    To study actinide compounds , neptunium 237 has been studied by Moessbauer resonance. The different oxidation degrees of neptunium (7, 6, 5, 4 and 3) have a very important effect on isomeric displacements. In the study of chalcogenides, the isomeric displacement value of NpS 3 confirms the valency 4+ of neptunium in this compound. Results obtained with Np 3 S 5 show two valency state +3 and +4 in this compound. There is a good agreement with the two crystalline sites determined by crystallography [fr

  12. Identification of Nilsson orbitals in the superdeformed minimum of {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Thomas James

    2008-03-31

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of {sup 237}Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ({sup 236f}U and {sup 240f}Pu) and vibrational excitations ({sup 240f}Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in {sup 237}Pu (t{sub 1/2}=115 ns/1.12 {mu}s) were investigated in a {gamma}-spectroscopy experiment at the Cologne Tandem accelerator. Using the {sup 235}U({alpha},2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4{pi} parallel plate detector. The extremely rare isomeric {gamma} decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted {gamma}-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified {gamma} transitions, independent level schemes were constructed for the two fission isomers in {sup 237}Pu. The consistency of these level schemes was supported by the connecting {gamma} transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single

  13. A study of the multipolar composition of the electrofission cross section of 237Np

    International Nuclear Information System (INIS)

    Paschoal, S.L.

    1987-01-01

    The electrofission cross section for 237 Np was measured over the energy range from 0,6 to 60,0 MeV. The multipolar composition of this cross section was investigated using the virtual photons formalism with three different techniques of analysis: unfolding and two versions of multiple parameter regression. (A.C.A.S.) [pt

  14. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Taylor, D.M.

    1988-01-01

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  15. Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am

    CERN Document Server

    Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E

    2004-01-01

    he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.

  16. Multimode approach to Am-241 and Np-237 fission induced by 660-MeV protons

    Czech Academy of Sciences Publication Activity Database

    Karapetyan, G. S.; Balabekyan, A. R.; Demekhina, N. A.; Adam, Jindřich

    2009-01-01

    Roč. 72, č. 6 (2009), s. 911-916 ISSN 1063-7788 R&D Projects: GA MŠk(CZ) LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : FISSION * Am-241 * Np-237 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.539, year: 2009

  17. Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.

    Science.gov (United States)

    Burgess, Selena G; Messiha, Hanan Latif; Katona, Gergely; Rigby, Stephen E J; Leys, David; Scrutton, Nigel S

    2008-05-06

    We have used multiple solution state techniques and crystallographic analysis to investigate the importance of a putative transient interaction formed between Arg-alpha237 in electron transferring flavoprotein (ETF) and Tyr-442 in trimethylamine dehydrogenase (TMADH) in complex assembly, electron transfer, and structural imprinting of ETF by TMADH. We have isolated four mutant forms of ETF altered in the identity of the residue at position 237 (alphaR237A, alphaR237K, alphaR237C, and alphaR237E) and with each form studied electron transfer from TMADH to ETF, investigated the reduction potentials of the bound ETF cofactor, and analyzed complex formation. We show that mutation of Arg-alpha237 substantially destabilizes the semiquinone couple of the bound FAD and impedes electron transfer from TMADH to ETF. Crystallographic structures of the mutant ETF proteins indicate that mutation does not perturb the overall structure of ETF, but leads to disruption of an electrostatic network at an ETF domain boundary that likely affects the dynamic properties of ETF in the crystal and in solution. We show that Arg-alpha237 is required for TMADH to structurally imprint the as-purified semiquinone form of wild-type ETF and that the ability of TMADH to facilitate this structural reorganization is lost following (i) redox cycling of ETF, or simple conversion to the oxidized form, and (ii) mutagenesis of Arg-alpha237. We discuss this result in light of recent apparent conflict in the literature relating to the structural imprinting of wild-type ETF. Our studies support a mechanism of electron transfer by conformational sampling as advanced from our previous analysis of the crystal structure of the TMADH-2ETF complex [Leys, D. , Basran, J. , Sutcliffe, M. J., and Scrutton, N. S. (2003) Nature Struct. Biol. 10, 219-225] and point to a key role for the Tyr-442 (TMADH) and Arg-alpha237 (ETF) residue pair in transiently stabilizing productive electron transfer configurations. Our work

  18. Numerical simulation of CALIBAN reactivity perturbation experiments using neptunium-237 samples

    International Nuclear Information System (INIS)

    Humbert, Philippe; Mechitoua, Boukhmes

    2003-01-01

    In order to contribute to the validation of nuclear data used in critical mass computation, reactivity perturbation experiments using 237 Np samples have been performed at CEA-Valduc using the fast pulsed reactor CALIBAN operated in continuous mode. In this paper we report these experiments together with the numerical calculations. The calculations were carried out using PANDA, a S N code developed at CEA-Bruyeres-le-Chatel for classic criticality and stochastic neutronics applications and with MCNP4C which is a commonly used Monte Carlo code. A good agreement was found between experimental and deterministic results. (author)

  19. Measurements of fast neutron-induced fission data of Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Win, Than; Saito, Keiichiro; Baba, Mamoru; Iwasaki, Tomohiko; Ibaraki, Masanobu; Miura, Takako; Sanami, Toshiya; Nauchi, Yasushi; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering

    1998-03-01

    We have performed the following measurements for {sup 237}Np using the 4.5 MV Dynamitron accelerator of Tohoku University as the pulsed neutron source: (1) Prompt fission neutron spectrum for 0.62 MeV incident neutrons, and (2) Neutron-Induced fission cross-section between 10 and 100 keV. The prompt fission neutron spectrum was measured using TOF method with a heavily shielded NE213 scintillation detector. The Maxwellian temperature T{sub m} derived is 1.28 MeV, which is lower than that of 1.38 MeV in JENDL-3.2. The fission cross sections were measured between 10 - 100 keV. The results are between JENDL-3.2 and ENDF/B-VI. (author)

  20. Measurements of {sup 237}Np secondary neutron spectra

    Energy Technology Data Exchange (ETDEWEB)

    Kornilov, N.V.

    1997-03-01

    The activities carried out during the first year of the project are summarized. The main problems for Np spectra measurements arise from high intrinsic gamma-ray activity of the sample and admixture of the oxygen and iron nuclei. The inelastically scattered neutrons and the fission neutrons spectra for {sup 237}Np were measured by time-of-flight spectrometer of the IPPE at incident neutron energies {approx_equal}1.5 MeV, and {approx_equal}0.5 MeV. A solid tritium target and a Li-metallic target were used as neutron sources. The neutron scattering on C sample (C(n,n) standard reaction) was measured to normalize the Np data. The experimental data should be simulated by Monte Carlo method to correct the experimental data for oxygen and iron admixture as well as for multiple scattering of the neutrons in the sample. Therefore the response function of the spectrometer, and the neutron energy distribution from the source were investigated in detail. (author)

  1. Helicobacter pylori and primary gastric lymphoma. A histopathologic and immunohistochemical analysis of 237 patients.

    Science.gov (United States)

    Nakamura, S; Yao, T; Aoyagi, K; Iida, M; Fujishima, M; Tsuneyoshi, M

    1997-01-01

    Few previous articles have analyzed the relation between infection with Helicobacter pylori (H. pylori) and primary gastric lymphoma in a large number of patients. Resected and biopsied specimens from 237 patients with primary gastric lymphoma were investigated for H. pylori using hematoxylin and eosin stain, modified Giemsa stain, and immunohistochemistry. These specimens were compared with specimens from 29 patients with chronic active gastritis, 33 with peptic ulcers, and 41 with gastric carcinoma. H. pylori was detected in 145 of 237 patients (61%) with gastric lymphoma. The frequency of H. pylori positivity was higher in patients with lymphoma restricted to the mucosa and submucosa (76%) than in those with lymphoma invading beyond the submucosa (48%) (P gastritis (100%) (P gastritis and peptic ulcer. The H. pylori grading score for patients with lymphoma (0.9 +/- 1.0) was lower than for those with chronic active gastritis (1.9 +/- 0.8) (P < 0.001), peptic ulcers (2.2 +/- 1.0) (P < 0.001), or gastric carcinoma (1.2 +/- 1.1) (P < 0.05). These results suggest that H. pylori is more likely to be associated with early states of primary gastric lymphoma than with advanced states. Thus, H. pylori may disappear during the progression of primary gastric lymphoma.

  2. Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1995-10-01

    The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).

  3. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography (Presentation)

    International Nuclear Information System (INIS)

    Strisovska, J.

    2013-01-01

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237 Np a 241 Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239 Np a 237 Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242 Pu and 239 Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239 Np was obtained by separation from the parent radionuclide 2 43 Am, which is in radioactive equilibrium to 239 Np. The average yield of chemical separation was 69,3% for 239 Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240 Pu (95,0 ± 3,5)% and 237 Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  4. Development of ionization technique for measurement of fast neutron induced fission products yields of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Goverdovski, A.A.; Khryachkov, V.A.; Ketlerov, V.V.; Mitrofanov, V.F.; Ostapenko, Yu.B.; Semenova, N.N.; Fomichev, A.N.; Rodina, L.F. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    Twin gridded ionization chamber and corresponding software was designed for measurements of masses, kinetic energies and nuclear charges of fission fragments from fast neutron induced fission of {sup 237}Np. The ionization detector design, electronics, data acquisition and processing system and the test results are presented in this paper. (J.P.N.)

  5. NKS-Norcmass reference material for analysis of Pu-isotopes and 237Np by mass spectrometry

    International Nuclear Information System (INIS)

    Ross, P.; Nygren, U.; Appelblad, P.; Skipperud, L.; Sjoegren, A.

    2006-04-01

    The aim of the reference material in the Norcmass-project was to produce a low-level ( 239 Pu) sample of sufficient amount to allow individual laboratories to perform several tests without risk of using up the material. Although there are several reference materials available (eg IAEA) few have 239 Pu/ 240 Pu data and almost none have 237 Np/ 239 Pu-data. Those who have (eg IAEA-384) have very high concentrations and are not useful for testing analytical methods designed for low-level measurements where a large sample mass may be required. The reference material consist of the top 10cm of 2mm sieved soil pooled together from 12 different Danish locations collected during 2003. The Soil was blended and sieved through 0.6 and finally through a 0.4 mm sieve. A total amount of 17 kg soil was produced. Several aliquots of the material was subject to analysis by alpha spectrometry and ICP-MS. The material contain 239 + 240 Pu at a concentration of 0.24 ± 0.01 mBq/g and a 240 Pu/ 239 Pu atom ratio of 0.19 ± 0.006. The ratio 237 Np/ 239 Pu was determined to 0.32 ± 0.01. (au)

  6. Neutron induced fission cross sections for 232Th, 235,238U, 237Np, and 239Pu

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Hill, N.W.; Carlson, A.D.; Wasson, O.A.

    1989-01-01

    Neutron-induced fission cross section ratios for samples of 232 Th, 235,238 U, 237 Np and 239 Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence from 3 to 30 MeV. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.178 MeV. From 30 to 400 MeV cross section values were determined using the neutron fluence measured with a plastic scintillator. Cross section values of 232 Th, 235,238 U, 237 Np and 239 Pu were computed from the ratio data using the authors' values for 235 U(n,f). In addition to providing new results at high neutron energies, these data highlight several areas of deficiency in the evaluated nuclear data files and provide new information for the 235 U(n,f) standard

  7. Quality control for measurement of soil samples containing 237Np and 241Am as radiotracer

    International Nuclear Information System (INIS)

    Sha Lianmao; Zhang Caihong; Song Hailong; Ren Xiaona; Han Yuhu; Zhang Aiming; Chu Taiwei

    2003-01-01

    This paper reports quality control (QC) for the measurement of soil samples containing 237 Np and 241 Am as radiotracers in migration test of transuranic nuclides. All of the QC were done independently by the QA members of analytical work. It mainly included checking 5%-10% of the total analyzed samples; preparing blank samples, blind replicate sample and spiked samples used as quality control samples to check the quality of analytical work

  8. α-decay chain and associated cluster emission from neutron deficient 237Cf nucleus

    International Nuclear Information System (INIS)

    Jain, Deepika; Sharma, Manoj K.

    2015-01-01

    We have studied the α-decay chain of 237 Cf nucleus, which has been observed in the 3n evaporation channel when the semi-magic projectile 36 S strikes on 204 Pbv nucleus. The calculations are carried out by using preformed cluster model (PCM), with choices of spherical and quadruple deformation with in cold optimum orientation approach. The calculated half-lives of α-decay chain find relatively in nice agreement with experimental data for the deformed fragmentation approach. Along with α emission, the possibility of heavier clusters is also worked out and corresponding half-lives are predicted. (author)

  9. The field migration tests of 237Np, 238Pu, 241Am and 90Sr in aerated loess, aquifer and engineering barrier materials

    International Nuclear Information System (INIS)

    Li Shushen; Wang Zhiming; Zhao Yingjie; Fan Zhiwen; Liu Chunli; An Yongfeng; Yang Yue'e; Wu Qinghua

    2003-01-01

    This paper introduces the field migration tests of 237 Np, 238 Pu, 241 Am and 90 Sr in aerated loess, aquifer and engineering barrier materials. The tests in the aerated loess and engineering barrier materials were carried out under both natural and artificial sprinkling (15 mm/d) conditions. The tests in aquifer were carried out in both assemblies packed with undisturbed aquifer media and a definite undisturbed area. The results indicate that after 3 years tests no significant migrations were seen for all nuclides in engineering barrier materials under two kinds of conditions and in aerated loess under natural conditions. For the aerated loess under artificial sprinkling conditions, 2.7 cm (center of mass) migration in the area directly below the sand tracer layer (named as area 1) and 13 cm (peak) migration in the area outside the area 1 for 90 Sr were observed; There was no migration for 237 Np, 238 Pu and 241 Am. It was discovered that the sand layer used as carrier of nuclide tracer has barrier effect on unsaturated water and an influence on nuclide migration. This has been demonstrated by the inter comparison experiment with both sand and loess as tracer carrier. In the tracer tests of undisturbed aquifer area there was no significant migration of 237 Np, 238 Pu, 241 Am and 90 Sr after 1023 days. In the assembly 8 there was no significant migration for 238 Pu and 241 Am and a small backward migration 0.95 cm for 237 Np and 4.7 cm migration (center of mass) for 90 Sr were observed. The tests also indicate that there is no significant difference of nuclide migration in ordinary and degraded cement

  10. Measurement of the fission cross-section ratio for 237Np/235U around 14 MeV neutron energies

    International Nuclear Information System (INIS)

    Desdin, L.; Szegedy, S.; Csikai, J.

    1989-01-01

    Fission cross-section ratio was determined for 237 Np/ 235 U around 14 MeV neutron energies with a back-to-back ionization chamber. Neutrons were produced by a 180 KV accelerator using T(d,n) 4 He reaction. No significant energy dependence was found in the cross section ratio

  11. Post-Irradiation Examination of 237Np Targets for 238Pu Production

    Energy Technology Data Exchange (ETDEWEB)

    Morris, Robert Noel [ORNL; Baldwin, Charles A [ORNL; Hobbs, Randy W [ORNL; Schmidlin, Joshua E [ORNL

    2015-01-01

    Oak Ridge National Laboratory is recovering the US 238Pu production capability and the first step in the process has been to evaluate the performance of a 237Np target cermet pellet encased in an aluminum clad. The process proceeded in 3 steps; the first step was to irradiate capsules of single pellets composed of NpO2 and aluminum power to examine their shrinkage and gas release. These pellets were formed by compressing sintered NpO2 and aluminum powder in a die at high pressure followed by sintering in a vacuum furnace. Three temperatures were chosen for sintering the solution precipitated NpO2 power used for pellet fabrication. The second step was to irradiate partial targets composed of 8 pellets in a semi-prototypical arrangement at the two best performing sintering temperatures to determine which temperature gave a pellet that performed the best under the actual planned irradiation conditions. The third step was to irradiate ~50 pellets in an actual target configuration at design irradiation conditions to assess pellet shrinkage and gas release, target heat transfer, and dimensional stability. The higher sintering temperature appeared to offer the best performance after one cycle of irradiation by having the least shrinkage, thus keeping the heat transfer gap between the pellets and clad small minimizing the pellet operating temperature. The final result of the testing was a target that can meet the initial production goals, satisfy the reactor safety requirements, and can be fabricated in production quantities. The current focus of the program is to verify that the target can be remotely dissembled, the pellets dissolved, and the 238Pu recovered. Tests are being conducted to examine these concerns and to compare results to code predictions. Once the performance of the full length targets has been quantified, the pellet 237Np loading will be revisited to determine if it can be

  12. Measurement of 237Np fission rate ratio relative to 235U fission rate in cores with various thermal neutron spectrum at the Kyoto University Critical Assembly

    International Nuclear Information System (INIS)

    Unesaki, Hironobu; Shiroya, Seiji; Iwasaki, Tomohiko; Fujiwara, Daisuke; Kitada, Takanori; Kuroda, Mitsuo; Kohashi, Akio; Kato, Takeshi; Ikeuchi, Yoshitaka

    2000-01-01

    Integral measurements of 237 Np fission rate ratio relative to 235 U fission rate have been performed at Kyoto University Citrical Assembly. The fission rates have been measured using the back-to back type double fission chamber at five thermal cores with different H/ 235 U ratio so that the neutron spectra of the cores were systematically varied. The measured fission rate ratio per atom was 0.00439 to 0.0298, with a typical uncertainty of 2 to 3%. The measured data were compared with the calculated results using SRAC/TWOTRAN and MVP based on JENDL-3.2, which gave the averaged C/E values of 0.93 and 0.95, respectively. Obtained results of C/E using 237 Np cross sections from JENDL-3/2, ENDF/B-VI.5 and JEF2.2 show that the latter two gave smaller results than JENDL-3.2 by about 4%, which clearly reflects the discrepancy in the evaluated cross section among the libraries. This difference arises from both fast fission and resonance region. Although further improvement is recommended, 237 Np fission cross section in JENDL-3.2 is considered to be superior to those in the other libraries and can be adopted for use in design calculations for minor actinide transmutation system using thermal reactors with prediction precision of 237 Np fission rate with in 10%. (author)

  13. Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am

    International Nuclear Information System (INIS)

    Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro

    1984-01-01

    Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)

  14. Evaluation of methods for retention of radioiodine during processing of irradiated 237Np

    International Nuclear Information System (INIS)

    Thompson, G.H.; Kelley, J.A.

    1975-06-01

    Methods of removing radioiodine from 237 Np-- 238 Pu dissolver solution and process off-gas were investigated. This program is part of a continuing effort to reduce releases of radionuclides from plant operations. Experimental data show: Greater than 99.9 percent of the radioiodine in dissolver solution can be removed by precipitation, in situ, of manganese dioxide. Silver zeolite will sorb greater than 99.9 percent of radioiodine in process off-gas. Other solid sorbents and nitric acid-mercuric nitrate scrubber solutions do not remove appreciable amounts of radioiodine from process off-gas, because radioiodine is present principally as relatively unreactive organic iodine compounds. (U.S.)

  15. Depth profiling of residual activity of ^{237}U fragments as a range verification technique for ^{238}U primary ion beam

    Directory of Open Access Journals (Sweden)

    I. Strašík

    2012-07-01

    Full Text Available Experimental and simulation data concerning fragmentation of ^{238}U ion beam in aluminum, copper, and stainless-steel targets with the initial energy 500 and 950  MeV/u are collected in the paper. A range-verification technique based on depth profiling of residual activity is presented. The irradiated targets were constructed in the stacked-foil geometry and analyzed using gamma-ray spectroscopy. One of the purposes of these experiments was depth profiling of residual activity of induced nuclides and projectile fragments. Among the projectile fragments, special attention is paid to the ^{237}U isotope that has a range very close to the range of the primary ^{238}U ions. Therefore, the depth profiling of the ^{237}U isotope can be utilized for experimental verification of the ^{238}U primary-beam range, which is demonstrated and discussed in the paper. The experimental data are compared with computer simulations by FLUKA, SRIM, and ATIMA, as well as with complementary experiments.

  16. Differences in the behavior of 233Pa, 237Np and 239 Pu in bentonite contaminated by sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Kudo, A.; Fujikawa, Y.; Takigami, H.; Zheng, J.; Asano, H.; Arai, K.; Yoshikawa, H.; Ito, M.

    1998-01-01

    The behaviors of 233 Pa, 237 Np and 239 Pu in high level radioactive wastes from nuclear fuel reprocessing were investigated by a laboratory experiment. Radioactive wastes are glassified and disposed of in geological repositories encased in bentonite as an additional artificial barrier to protect the environment. There is, however, the possibility that some anaerobic bacteria, especially sulfate-reducing bacteria, may flourish within the bentonite during the long disposal period (more than a century). The effects of sulfate-reducing bacteria on the behavior of the radionuclides within bentonite were investigated using the distribution coefficient (Kd) of 233 Pa, 237 Np and 239 Pu. The Kd was obtained with a 0.22 m membrane filter separating radionuclide contents in solid and liquid phases. The anaerobic bacteria, including sulfate-reducing bacteria, used for this investigation originated from the anaerobic treatment of pulp and paper waste and operated for more than one year at Eh around -85 mV. The bentonite used for this study was produced in Japan. The active anaerobic bacteria clearly accumulates considerable amounts of 233 Pa and 239 Pu by producing high Kd values of nearly 100,000, while Kds of 233 Pa and 239 Pu for the sterilized anaerobic bacteria were less than 10,000. In other words, live anaerobic bacteria can hold considerably higher amounts of the radionuclides compared to dead bacteria. Furthermore, high Kd values were obtained for anaerobic bacteria at pH 5-9. In contrast, Kd values for the radionuclide 237 Np were not influenced by the anaerobic bacteria but were controlled by chemical environmental conditions such as like pH. Another comparison was conducted for the radionuclides for mixtures of non-sterilized bacteria with bentonite. (author)

  17. Standard practice for the determination of 237Np, 232Th, 235U and 238U in urine by inductively coupled plasma-Mass spectrometry (ICP-MS) and gamma ray spectrometry.

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  18. 239Np application as tracer of 237Np in liquid effluents and nuclear wastes

    International Nuclear Information System (INIS)

    Diodati, Jorge M; Sartori, F.M.

    2003-01-01

    In this paper a technique to separate and measure 237 Np using 239 Np as a tracer, is presented. After the radiochemical separation, a liquid scintillation measurement with pulse decay discrimination and a γ measurement on the same vial is performed. The method also allows an electrodeposition for an α and γ measurement. The chemical recoveries obtained by LSC and γ spectrometry in vial are similar to those obtained by α and γ spectrometry on electroplated disc. The MDA is 0.08 Bq/l by α spectrometry and 0.22 Bq/l by LSC, with 2 σconfidence interval, and 93.7 % measurement efficiency and 98.0% chemical recovery. (author)

  19. Rapid separation method for {sup 237}Np and Pu isotopes in large soil samples

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, Sherrod L., E-mail: sherrod.maxwell@srs.go [Savannah River Nuclear Solutions, LLC, Building 735-B, Aiken, SC 29808 (United States); Culligan, Brian K.; Noyes, Gary W. [Savannah River Nuclear Solutions, LLC, Building 735-B, Aiken, SC 29808 (United States)

    2011-07-15

    A new rapid method for the determination of {sup 237}Np and Pu isotopes in soil and sediment samples has been developed at the Savannah River Site Environmental Lab (Aiken, SC, USA) that can be used for large soil samples. The new soil method utilizes an acid leaching method, iron/titanium hydroxide precipitation, a lanthanum fluoride soil matrix removal step, and a rapid column separation process with TEVA Resin. The large soil matrix is removed easily and rapidly using these two simple precipitations with high chemical recoveries and effective removal of interferences. Vacuum box technology and rapid flow rates are used to reduce analytical time.

  20. High resolution measurement of the 237Np(n,f) cross section from 100keV to 2MeV

    International Nuclear Information System (INIS)

    Plattard, S.; Pranal, Y.; Blons, J.

    1975-01-01

    237 Np fission is one of the reactions utilized in the threshold detector method of neutron spectrometry for the determination of fast neutron spectra in nuclear reactors. Therefore, an accurate knowledge of the energy-dependent fission cross section is essential for a precise generation of the spectral indices of this method. A high resolution measurement of the fission cross section is presented [fr

  1. Improvement of evaluated neutron nuclear data for {sup 237}Np and {sup 241}Am

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Iwamoto, Osamu; Hasegawa, Akira [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-01-01

    The nuclear data of {sup 237}Np and {sup 241}Am that are particularly important among the minor actinides were investigated by comparing JENDL-3.2 with the recent evaluated data and available experimental data. As a result of the study, several defects of JENDL-3.2 data were revealed. They were improved on the basis of experimental data or recent evaluated data. For the both nuclides, main quantities revised in the present work were the resonance parameters, cross sections, angular and energy distributions of secondary neutrons, number of neutrons per fission. The data were given in the neutron energy range from 10{sup -5} eV to 20 MeV, and compiled in the ENDF-6 format. (author)

  2. Measurement of the neutron-induced fission cross section of 237Np relative to 235U from 0.02 to 30 MeV

    International Nuclear Information System (INIS)

    Behrens, J.W.; Magana, J.W.; Browne, J.C.

    1977-01-01

    The 237 Np/ 235 U fission cross section ratio has been measured from 0.02 to 30 MeV. Using the threshold method, a value of 1.294 +- 0.019 is obtained for the average cross section ratio in the interval from 1.75 to 4.00 MeV

  3. Study of the excited levels of 233Pa by the 237Np alpha decay

    International Nuclear Information System (INIS)

    Gonzalez, J.; Gaeta, R.; Vano, E.; Los Arcos, J. M.

    1978-01-01

    The excited levels in 233 P a following the 237 N p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233 P a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs

  4. Standard Test Method for Measuring Reaction Rates by Radioactivation of Neptunium-237

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by assaying a fission product (F.P.) from the fission reaction 237Np(n,f)F.P. 1.2 The reaction is useful for measuring neutrons with energies from approximately 0.7 to 6 MeV and for irradiation times up to 30 to 40 years. 1.3 Equivalent fission neutron fluence rates as defined in Practice E 261 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  5. A comparative study of the carcinogenetic effects of 241Am, 239Pu and 237Np

    International Nuclear Information System (INIS)

    Wang Yumin; Wei Zhikang; Chen Xueyi; Yao Yongheng; Liu Peibin; Xu Lin; Lun Mingyao

    1984-01-01

    In this experiment, 420 wistar rats were used to study the comparative carcinogenetic effects of 241 Am, 239 Pu and 237 Np. These nuclides were injected to animals intravenously, subcutaneously or directly into the lung (Stansen's lung puncture method) in doses of 1.0, 5.0 and 8.5 μCi/kg, respectively. As soluble nitrate, the nuclides were rapidly transfered from the site of injection into the bone and the liver. Osteosarcomas were found in some animals 8 months to one year after intoxication. Diagnosis of osteosarcoma is based on the histopatological examination and X-ray photography. In the Am-poisoned rats the incidence of osteosarcoma is about 31-74%, varied with different doses and different routes of intoxication; in Pu-poisoned rats, the incidence of osteosarcoma is about 55-66%. while in Np-poisoned rats, it is about 36-53%. Primary lung cancers were also found in those animals poisoned by means of Stansen's lung puncture method with the above three nuclides. The incidence of primary lung cancers is about 6% in Am-and Pu-poisoned rats and 13% in Np-poisoned rats. The incidence of metastasis of osteosarcoma in lung is about 25-65% for Am-poisoned rats, 45-55% for Pu-poisoned rats and 41-80% for Np-poisoned rats. The life-span of above poisoned rats was significantly shorter than that of the normal control animals. The chemical weight for 241 Am, 239 Pu and 237 Np in same unit of radioactivity (1.0 μCi) equals to 0.308 μg, 15.9 μg and 1418.7 μg, respectively. For this reason, we have to pay more attention to the chemical mass effect in carcinogenesis of the above three nuclides

  6. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter

    2013-01-01

    An automated analytical method implemented in a novel dual-column tandem sequential injection (SI) system was developed for simultaneous determination of 236U, 237Np, 239Pu, and 240Pu in seawater samples. A combination of TEVA and UTEVA extraction chromatography was exploited to separate and purify...... target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...

  7. Localization of the X-linked ocular albinism gene (OA1) between DXS278/DXS237 and DXS143/DXS16 by linkage analysis

    NARCIS (Netherlands)

    Bergen, A. A.; Samanns, C.; van Dorp, D. B.; Ferguson-Smith, M. A.; Gal, A.; Bleeker-Wagemakers, E. M.

    1990-01-01

    Linkage analysis was performed in six families segregating for X-linked ocular albinism of the Nettleship-Falls type using four polymorphic DNA markers from the distal Xp. Linkage was found between the disease locus (OA1) and the loci DXS237 (theta max = 0.06, Zmax = 2.82), DXS278 (theta max = 0.03,

  8. Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu

    Energy Technology Data Exchange (ETDEWEB)

    Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-10-04

    This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.

  9. Fission mode analysis of the reaction 237Np(n,f) - possibilities and perspectives

    International Nuclear Information System (INIS)

    Siegler, P.

    1996-01-01

    Fission fragment properties for the reaction 237 Np(n,f) have been measured at the Van de Graaff Laboratory of the IRMM. Using a double gridded ionization chamber the mass, kinetic energy and the angular distribution for both fission fragments could be determined simultaneously for an incident neutron energy range from E n =0.3 MeV upto E n =5.5 MeV. Complete datasets have been acquired for 13 different neutron energies covering sub barrier fission as well as fission in the plateau region. A detailed analysis of the fragment distributions and the respective momenta has been carried out, checking the coherence against the excitation energy of the compound nucleus. The consideration of multi-modal fission offers an improved possibility for the description of the fragment distributions backed up by theoretical calculations on the basis of the multi-model random-neck rupture model of Brosa, Grossmann and Mueller. The changes of the fission fragment properties under investigation are completely described and an interpretation of the findings is presented. (author)

  10. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.

    1990-07-01

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  11. Study of the excited levels of 233{sup P}a by the 237{sup N}p alpha decay; Estudio de los niveles excitados en el 233{sup P}a por la desintegracion alfa del 237{sup N}p

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, J; Gaeta, R; Vano, E; Los Arcos, J M

    1978-07-01

    The excited levels in 233{sup P}a following the 237{sup N}p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233{sup P}a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs.

  12. The evaluation of the 237Np fission cross section in the 20 KeV - 20 MeV energy range

    International Nuclear Information System (INIS)

    Dushin, V.N.; Kalinin, V.A.; Shpakov, V.I.

    1997-01-01

    The results of the development of nuclear data evaluation based on the generalized least squares method is presented. The method to interpolate experimental data measured at arbitrary energy points, and their transfer to a fixed energy grid is described. The results of the 237 Np fission cross section measurements performed until 1988 were critically analyzed. A 781 x 781 covariant matrix was derived from the correlation analysis of the experimental results. The results of the evaluation, and the associated correlation matrix was obtained using the generalized least square method. (author). 34 refs, 4 figs, 2 tabs

  13. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  14. Neutron induced fission cross sections for /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu from 1 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Neutron-induced fission cross section ratios for samples of /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence up to 30 MeV. These data provided the shape of the /sup 235/U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known values were determined using the neutron fluence measured with a second proton recoil telescope. Cross section values for /sup 232/Th, /sup 238/U, /sup 237/Np, and /sup 239/Pu were computed from the ratio data using our values for /sup 235/U(n,f). In addition to providing new results at high neutron energies, these data resolve long standing discrepancies among different data sets. 1 ref., 1 fig.

  15. Measurement and analysis of reactivity worth of 237Np sample in cores of TCA and FCA

    International Nuclear Information System (INIS)

    Sakurai, Takeshi; Mori, Takamasa; Okajima, Shigeaki; Tani, Kazuhiro; Suzaki, Takenori; Saito, Masaki

    2009-01-01

    The reactivity worth of 22.87 grams of 237 Np oxide sample was measured and analyzed in seven uranium cores in the Tank-Type Critical Assembly (TCA) and two uranium cores in the Fast Critical Assembly (FCA) at the Japan Atomic Energy Agency. The TCA cores provided a systematic variation in the neutron spectrum between the thermal and resonance energy regions. The FCA cores, XXI and XXV, provided a hard neutron spectrum of the fast reactor and a soft one of the resonance energy region, respectively. Analyses were carried out using the JENDL-3.3 nuclear data library with a Monte Carlo method for the TCA cores and a deterministic method for the FCA cores. The ratios of calculated to experimental (C/E) reactivity worth were between 0.97 and 0.91, and showed no apparent dependence on the neutron spectrum. (author)

  16. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1975-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  17. The z = 1.6748 C I Absorber Toward the QSO PKS 1756+237

    Science.gov (United States)

    Roth, Katherine C.; Bauer, James M.; Jim, Kevin T. C.

    We have detected C I ground-state absorption at zabs = 1.6748 toward the QSO PKS 1756+237 (zem = 1.725), making this only the fourth known C I QSO absorber. The absence of excited-state fine-structure C I lines is compatible with the redshifted Cosmic Microwave Background Radiation at an expected temperature of TCMBR (1+z) = 7.291 K (Mather et al. 1994, ApJ, 354, L37). We find a 2 σ upper-limit on the C I excitation temperature of Tex <= 7.73(+0.53, -0.46) K (Roth & Bauer 1999, ApJ, submitted). Our Keck HIRES spectra (8.3 km s-1 FWHM) obtained in May 1997 also reveal the existence of Ni II and Fe II lines with a sub-solar Ni/Fe abundance ratio, presumably indicative of dust. We have obtained deep, high resolution (0.3'' FWHM) images in H+K' with the UH 2.2m Tip-Tilt system of the QSO field in order to identify the system responsible for the zabs = 1.6748 absorption. We detect two faint candidate systems within 1.5'' and 3'' (≅ 15 and 30 kpc, Hcirc = 65) of the QSO.

  18. Early retention of 237Pu + 239Pu in mature beagles

    International Nuclear Information System (INIS)

    Lloyd, R.D.; McFarland, S.S.; Atherton, D.R.; Bruenger, F.W.; Taylor, G.N.; Mays, C.W.

    1978-01-01

    Five mature beagles, ranging in age from 57 to 84 months, were injected intravenously with about 0.05-0.1 μCi/kg of 239 Pu(IV) citrate to which tracer amounts of the photon-emitter 237 Pu had been added. Plutonium retention in liver and in non-liver tissue (mainly skeleton) was measured periodically in the living dogs for nearly 4 months after injection by a combination of total-body and partial-body counting. All excreta were collected during the first 21 days and analysed for their Pu content. One dog was sacrificed at 14 days and another at 118 days for distribution studies. About 17% (14-20%) of the injected Pu was excreted in the urine and feces in the first 3 weeks, about the same as that excreted in a corresponding time by beagles injected as young adults (14%), but substantially more than beagles injected as juveniles (11%). In contrasts to juvenile beagles injected at 3 months of age, in which early retention was about 12% in liver and 68% in the skeleton, mature beagles retained about 30% in liver and 50% in the skeleton. Retention in young adult beagles injected at 17 months of age was similar to that of mature dogs. Relative distribution of skeletal plutonium among various bones was similar in the mature animals to that seen previously in young adults, but quite different from that of juveniles. A notable exception was the humerus for which there was no significant difference (P>0.2) in the % of retained skeletal Pu represented by the humerus among the juvenile, young adult and mature dogs. (author)

  19. Pigmented villonodular synovitis: a retrospective multicenter study of 237 cases.

    Directory of Open Access Journals (Sweden)

    Guo-ping Xie

    Full Text Available To review clinical characteristics of pigmented villonodular synovitis (PVNS in China.Electronic medical records (EMR of four Chinese institutes were queried for patients with histologically proven PVNS between January 2005 and February 2014. Their data were collected including gender, age at diagnosis, clinical presentation, affected site, symptom duration, comorbidities, treatment strategy, recurrence and routine laboratories.A total of 237 patients with biopsy-proven PVNS were investigated. The gender ratio was 1.35 for a female predominance (101 males and 136 females. The average age was 36 years (range, 2 to 83 years. The median delay from initial clinical symptom to diagnosis was 18 months. Main affected areas were the knee (73.84% and the hip (18.14%. Forty patients had a clear history of joint trauma. Six patients were concurrently diagnosed with PVNS and avascular necrosis (AVN. Five patients suffered from PVNS following implantation of orthopaedic devices including artificial prosthesis, plate and wire. One hundred and twenty-nine patients underwent arthroscopic synovectomy and 108 open synovectomy. Altogether 48 patients (26 males and 22 females had recurrence of disease. The relapse rate was 24% (knee and 6.98% (hip, 20.93% (open surgery and 19.44% (arthroscopy, respectively. Erythrocyte sedimentation rate (ESR and C-reactive protein (CRP rate were elevated in 45.83% and 38.41% of the patients respectively.To our knowledge, this study is the largest sample size of PVNS patients reported as well as the largest sample of PVNS with concurrent AVN reported to date. Our outcomes suggest that PVNS shows a female predominance, occurs mostly between 20-40 years and favors the knee and hip. Recurrence is frequent, particularly in the knee. Serum ESR and CRP may be elevated in some patients. Additionally, the present study supports the theory of an association between PVNS and orthopedic surgery, which is not limited to joint replacement.

  20. Poor adherence to medication as assessed by the Morisky Medication Adherence Scale-8 and low satisfaction with treatment in 237 psoriasis patients.

    Science.gov (United States)

    Saeki, Hidehisa; Imafuku, Shinichi; Abe, Masatoshi; Shintani, Yoichi; Onozuka, Daisuke; Hagihara, Akihito; Katoh, Norito; Murota, Hiroyuki; Takeuchi, Satoshi; Sugaya, Makoto; Tanioka, Miki; Kaneko, Sakae; Masuda, Koji; Hiragun, Takaaki; Inomata, Naoko; Kitami, Yuki; Tsunemi, Yuichiro; Abe, Shinya; Kobayashi, Miwa; Morisky, Donald E; Furue, Masutaka

    2015-04-01

    Previously we assessed the medication adherence for oral and topical remedies by a translated Japanese version of the Morisky Medication Adherence Scale-8 (MMAS-8) together with socioeconomic backgrounds in 3096 Japanese dermatological patients, and found the medication adherence, especially to topical drugs, was poor in these patients. In order to elucidate the disease-specific sociomedical factors, we further sub-analyzed the medication adherence in 237 psoriasis patients and compared it with that in other dermatological diseases such as atopic dermatitis, urticaria or tinea. This study was conducted among patients registered in monitoring system and 3096 eligible patients were enrolled. Our web-based questionnaire included the following items such as age, sex, annual income, main health-care institution, experience of effectiveness by oral or topical medication, overall satisfaction with treatment, and MMAS-8 for oral or topical medication. Mean adherence score by MMAS-8 was 5.2 for oral and 4.3 for topical medication. More patients with psoriasis used a university hospital and fewer used a private clinic compared with those with the other skin disease patients. Experience of drug effectiveness by oral medication and overall satisfaction with treatment was lower in psoriasis patients than in other patients. In oral medication, significantly better adherence was observed in those of higher age and with higher annual income. The adherence to medication, especially to topical drugs, was poor in 237 psoriasis patients. We speculated that some severe psoriasis patients were not sufficiently treated systemically and were resistant to topical therapy, leading to poor adherence. © 2015 Japanese Dermatological Association.

  1. A correlation between isomer shifts of 237Np Moessbauer spectra and coordination numbers of Np atoms in neptunyl(V) compounds

    International Nuclear Information System (INIS)

    Saeki, M.; Nakada, M.; Nakamoto, T.; Yamashita, T.; Masaki, N.M.; Krot, N.N.

    1999-01-01

    Five neptunyl(V) compounds were synthesized and studied by 237 Np Moessbauer spectroscopy. The isomer shifts (δ) of the Moessbauer spectra ranged from -18.6 to -19.1 mm/s for the compounds with Np atoms surrounded by 7 oxygen atoms (coordination number (CN) 7). On the other hand, the larger value of δ was obtained for the compound with CN 8. From the comparison of the present results with those reported on neptunyl(V) and (VI) compounds, it is concluded that there is a correlation between the δ and the CN for neptunyl(V) compounds, and the distribution of δ is narrower for neptunyl(V) compounds than that of neptunyl(VI) compounds. (author)

  2. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  3. Montecarlo calculation of the isomeric cross sections ratio for the reaction 237Np(n,2n)236Np

    International Nuclear Information System (INIS)

    Cleri, F.

    1988-01-01

    A Montecarlo calculation of the isomeric cross section ratio for the (n,2n) reaction on 237 Np has been carried out based on the Hauser-Feshbach formulation. A standard energy-dependent optical model potential was used, with zero deformation parameters and no spin-orbit coupling. Investigation was made about the role of the energy cut-off value, of the higher multipole (E2) transition, of the gamma-ray versus second neutron emission, of the value of the spin cutt-off parameter. The results give the correct qualitative energy dependence of the branching ratio, with the assumption that the 1 - level is the ground state. The spin cut-off value obtained indicates a less pronounced deviation of the nuclear moment of inertia from the rigid-body value, with respect to older evaluations for high-mass nuclei. (author)

  4. 16 CFR 23.7 - Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.”

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misuse of the words âplatinum,â âiridium,â... § 23.7 Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.” (a) It is unfair or deceptive to use the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium...

  5. Fragment properties in the fission of 237Np with fast neutrons - an experimental investigation of fission dynamics

    International Nuclear Information System (INIS)

    Naqvi, A.A.

    1980-03-01

    Fission fragment properties such as mass distribution, kinetic energy distribution or number of prompt emitted neutrons as a function of fragment mass can be used to characterize the scission point configuration. The present experiment allows for the first time to investigate these quantities for neutron induced fission in the MeV range. In this way the influence of excitation energy of the saddle point deformation of the fissioning system ( 237 Np + n) can be studied. Neutrons with energies of 0.8 and 5.5 MeV were produced by the Karlsruhe pulsed 3MV Van de Graaff accelerator. Kinetic energies and velocities of correlated fragments were determined by solid state detectors using the time-of-flight technique. The experimentally determined distributions of fragment properties were compared to a recent model suggested by Wilkins et al. which assumes only relatively weak coupling between internal and collective degrees of freedom. At least qualitative agreement is found for most of the results. (orig.) [de

  6. Ultra-trace determination of neptunium-237 and plutonium isotopes in urine samples by compact accelerator mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dai, X.; Christl, M.; Kramer-Tremblay, S., E-mail: sheila.kramer-tremblay@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Synal, H-A. [ETH Zurich, Lab. of Ion Beam Physics, Zurich (Switzerland)

    2015-12-15

    Ultra-trace analysis of actinides, such as Pu isotopes and {sup 237}Np, in bioassay samples is often needed for radiation protection programs at nuclear facilities. Accelerator mass spectrometry (AMS), particularly the compact ETH Zurich system “Tandy”, has evolved over the years as one of the most sensitive, selective, and robust techniques for actinide analysis. Employment of the AMS technique can reduce the demands on sample preparation chemistry and increase sample analysis throughput, due to very low instrumental detection limit, high rejection of interferences, and low susceptibility to adverse sample matrices. Initial research and development tests were performed to explore and demonstrate the analytical capability of AMS for Pu and Np urine bioassay. In this study, urine samples spiked with femtogram levels of Np and Pu isotopes were prepared and measured using compact ETH AMS system and the results showed excellent analytical capability for measuring Np and Pu isotopes at femtogram/litre levels in urine. (author)

  7. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  8. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2004-02-01

    New evaluations of cross sections and their uncertainties for dosimetry reactions 27 Al(n,p) , 56 Fe(n,p) and 237 Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  9. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Wan, J.-S.; Schmidt, T.Th.; Langrock, E.-J.; Vater, P.; Brandt, R.; Adam, J.; Bradnova, V.; Bamblevski, V.P.; Gelovani, L.; Gridnev, T.D.; Kalinnikov, V.G.; Krivopustov, M.I.; Kulakov, B.A.; Sosnin, A.N.; Perelygin, V.P.; Pronskikh, V.S.; Stegailov, V.I.; Tsoupko-Sitnikov, V.M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J.C.; Debeauvais, M.; Hashemi-Nezhad, S.R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K.K.; Zhuk, I.V.; Boulyga, S.F.; Lomonossova, E.M.; Kievitskaja, A.F.; Rakhno, I.L.; Chigrinov, S.E.; Wilson, W.B.

    2001-01-01

    Small samples of 129 I and 237 Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,γ) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger

  10. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    Science.gov (United States)

    Wan, J.-S.; Schmidt, Th.; Langrock, E.-J.; Vater, P.; Brandt, R.; Adam, J.; Bradnova, V.; Bamblevski, V. P.; Gelovani, L.; Gridnev, T. D.; Kalinnikov, V. G.; Krivopustov, M. I.; Kulakov, B. A.; Sosnin, A. N.; Perelygin, V. P.; Pronskikh, V. S.; Stegailov, V. I.; Tsoupko-Sitnikov, V. M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J. C.; Debeauvais, M.; Hashemi-Nezhad, S. R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K. K.; Zhuk, I. V.; Boulyga, S. F.; Lomonossova, E. M.; Kievitskaja, A. F.; Rakhno, I. L.; Chigrinov, S. E.; Wilson, W. B.

    2001-05-01

    Small samples of 129I and 237Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,γ) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger.

  11. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    Energy Technology Data Exchange (ETDEWEB)

    Zolotarev, K I [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    2004-02-01

    New evaluations of cross sections and their uncertainties for dosimetry reactions {sup 27}Al(n,p) , {sup 56}Fe(n,p) and {sup 237}Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  12. Precise 238U(n,2n)237U reaction cross-section measurements using the activation facility at TUNL

    Science.gov (United States)

    Krishichayan, Fnu; Bhike, M.; Tornow, W.

    2014-09-01

    Accurate neutron-induced 238U(n,2n)237U reaction data are required for many practical applications, especially in the field of nuclear energy, including advanced heavy water reactors, where 238U is used as the breeding material to regenerate the fissile material 239Pu. Precise (n,2n) cross-section measurements of 238U are underway at TUNL with mono-energetic neutrons in the 8.0 to 14.0 MeV energy range in steps of 0.25 MeV using the activation technique. After activation of the 0.5 inch diameter and 442 mg 238U foil, the activity of the 208 keV characteristic γ-line is tracked for 6 weeks with a high efficient HPGe clover detector to determine the initial activity needed for the cross-section determination. Results of the cross-section measurements, determined relative to 27Al and 197Au neutron activation monitor foils, and the comparison with theoretical models will be presented during the meeting.

  13. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Ochs, M.; Schmidt, Th.; Wan, J.-S.

    1999-01-01

    Small samples of approximately 1 g of 129 I and 237 Np, two long-lived radioactive waste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead or uranium, surrounded with a paraffin moderator 6 cm thick irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n, γ) transmutation rates have been determined for the two radioactive waste nuclides. Conventional radiochemical La and U sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. The observed secondary neutron fluences appear to be systematically larger, as compared to the calculations with the well-known cascade codes (LAHET from Los Alamos and DCM-CEM from Dubna)

  14. The bioavailability of the transuranic elements 237Pu and 241Am for the pond snail, Lymnaea stagnalis L., and their behaviour in selected natural surface waters

    International Nuclear Information System (INIS)

    Thiels, G.M.

    1983-01-01

    An attempt was made to characterise the bioavailability of 237 Pu and 241 Am for the pond snail Lymnaea stagnalis L. in selected surface waters. The uptake, distribution and retention patterns were studied through the contamination route water-snail. The effects of a number of parameters, such as seasonal variation, water type (pH, conductivity, ionic composition) and presence of food, on the bioavailability of the transuranics were evaluated. Finally, an assessment was made concerning the chemical speciation of plutonium and americium in the selected freshwaters

  15. Numerical methods to analyze alpha spectra and application to the study of neptunium 237 and neptunium 236

    International Nuclear Information System (INIS)

    Garcia-Torano, E.

    1990-01-01

    A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X 2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X 2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237 Np and 236 Np are studied by using some of the methods described in this work. (Author)

  16. The quadrupole moment and strong interaction parameters from muonic and pionic X-ray studies of 237Np

    International Nuclear Information System (INIS)

    Laat, C.T.A.M. de; Taal, A.; Duinker, W.; Konijn, J.; Petitjean, C.; Reist, H.W.; Mueller, W.; Commission of the European Communities, Geel

    1987-01-01

    The X-ray spectrum of muonic and pionic 237 Np has been investigated with muons and pions stopped in a NpO 2 target. The nuclear spectroscopic quadrupole moment was determined to be Q=3.886±0.006 b from the splittings of the muonic 5g→4f hyperfine complexes. The B(E2)↓-values for the first and second excited states were evaluated as 3.17±0.08 and 2.77±0.10 e 2 b 2 , respectively. A comparison between the muonic and pionic 5g→4f hyperfine complexes yields the strong interaction parameter for the pionic 4f state. For the first time a change of sign as function of Z for the strong interaction quadrupole shift ε 2 (4f) has been observed. The standard optical model predictions agree reasonably well with the measured strong interaction monopole shift, ε 0 (4f), and width, Γ 0 (4f), while they disagree with the experimental value for ε 2 . A stronger s-wave repulsion in the optical potential could explain this effect. (orig.)

  17. First simultaneous measurement of fission and gamma probabilities of 237U and 239Np via surrogate reactions

    Directory of Open Access Journals (Sweden)

    Marini P.

    2016-01-01

    Full Text Available Fission and gamma decay probabilities of 237U and 239Np have been measured, for the first time simultaneously in dedicated experiments, via the surrogate reactions 238U(3He, 4He and 238U(3He,d, respectively. While a good agreement between our data and neutron-induced data is found for fission probabilities, gamma decay probabilities are several times higher than the corresponding neutron-induced data for each studied nucleus. We study the role of the different spin distributions populated in the surrogate and neutron-induced reactions. The compound nucleus spin distribution populated in the surrogate reaction is extracted from the measured gamma-decay probabilities, and used as input parameter in the statistical model to predict fission probabilities to be compared to our data. A strong disagreement between our data and the prediction is obtained. Preliminary results from an additional dedicated experiment confirm the observed discrepancies, indicating the need of a better understanding of the formation and decay processes of the compound nucleus.

  18. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  19. Absolute and relative cross section measurements of 237Np(n,f and 238U(n,f at the National Physical Laboratory

    Directory of Open Access Journals (Sweden)

    Salvador-Castiñeira Paula

    2017-01-01

    Full Text Available Cross section measurements in the fast energy region are being demanded as one of the key ingredients for modelling Generation-IV nuclear power plants. However, in facilities where there are no time-of-flight possibilities or it is not convenient to use them, using the 235U(n,f cross section as a benchmark would require a careful knowledge of the room scatter in the experimental area. In this paper we present measurements of two threshold reactions, 238U(n,f and 237Np(n,f, that could become a standard between their fission threshold and 2.5 MeV, if the discrepancies shown in the evaluations and in some experimental data can be solved. The preliminary results are in agreement with the present ENDF/B-VII.1 evaluation.

  20. Transmutation of {sup 129}I and {sup 237}Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    Energy Technology Data Exchange (ETDEWEB)

    Wan, J.-S.; Schmidt, T.Th.; Langrock, E.-J.; Vater, P.; Brandt, R. E-mail: brandtr@mailer.uni-marburg.de; Adam, J.; Bradnova, V.; Bamblevski, V.P.; Gelovani, L.; Gridnev, T.D.; Kalinnikov, V.G.; Krivopustov, M.I.; Kulakov, B.A.; Sosnin, A.N.; Perelygin, V.P.; Pronskikh, V.S.; Stegailov, V.I.; Tsoupko-Sitnikov, V.M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J.C.; Debeauvais, M.; Hashemi-Nezhad, S.R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K.K.; Zhuk, I.V.; Boulyga, S.F.; Lomonossova, E.M.; Kievitskaja, A.F.; Rakhno, I.L.; Chigrinov, S.E.; Wilson, W.B

    2001-05-11

    Small samples of {sup 129}I and {sup 237}Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,{gamma}) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger.

  1. Chelation and stabilization of berkelium in oxidation state +IV

    Czech Academy of Sciences Publication Activity Database

    Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

    2017-01-01

    Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

  2. Criticality Data for Spherical 235U, 239Pu, and 237Np Systems Reflector-Moderated by Low Capturing-Moderator Materials

    International Nuclear Information System (INIS)

    Loaiza, David J.; Stratton, William

    2004-01-01

    The critical dimensions of spherical systems moderated and reflected by low-capturing materials such as D 2 O, BeO, Be, and C were investigated. A parametric study of the critical mass of enriched uranium, plutonium, and neptunium is examined and tabulated. The results obtained expand on the understanding of reflector-moderated critical systems, and they show regions of unstable criticality for 235 U and 239 Pu reflected cores at intermediate densities. This instability is illustrated by calculations of the positive reactivity coefficient of volume expansion. The coefficient is positive, not negative, in the intermediate density region for 235 U and 239 Pu systems. For 237 Np cores reflected by the same moderator, the effect is negligible. The critical dimensions were calculated with the DANTSYS codes using the Hansen-Roach cross-section libraries. This study is both a summary of mostly unpublished calculations and new calculations. Experimental data for these configurations are extremely limited. These are examined in the text when applicable

  3. Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

    1998-11-01

    The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

  4. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  5. Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

    Science.gov (United States)

    Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

    2017-10-01

    The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

  6. Neutron induced fission cross section ratios for 232Th, 235,238U, 237Np and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, 235,238 U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. (author)

  7. Evaluation of the 237Np neutron cross sections in the energy range from 10-5 eV to 5 MeV

    International Nuclear Information System (INIS)

    Derrien, H.; Fort, E.

    1979-01-01

    The 237 Np neutron cross-sections have been evaluated in the energy range from thermal to 5 MeV. A set of resonance parameters including a negative level, is recommanded after examination of the available experimental data. This set is used 1) to calculate the cross-sections from the thermal region to 150 ev, and 2) to provide the statistical parameters suitable to the calculations in the unresolved region. At higher energies, the transmission coefficients Te are calculated by the coupled channel optical model code ECIS. They are then used as input in the statistical model code FISINGA. The optical model parameters, including the deformation parameters, are those used by Lagrange for the Pu isotopes, slightly modified to reproduce at 40 KeV the total cross-sections obtained from the pure statistical parameters. The recommendations of Lynn concerning the level density parameters have been used. In this paper we describe the various steps of the evaluation

  8. Neutron induced fission cross section ratios for 232Th, /sup 235,238/U, 237Np, and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, /sup 235,238/U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs

  9. Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

    International Nuclear Information System (INIS)

    Henderson, R.A.

    2009-01-01

    This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

  10. Elastic and Raman scattering of 8.5-11.4 MeV photons from 159Tb, 165Ho, and 237Np

    International Nuclear Information System (INIS)

    Bar-Noy, T.; Moreh, R.

    1977-01-01

    Differential cross sections for elastic and inelastic Raman scattering from the deformed heavy nuclei 159 Tb, 165 Ho and 237 Np were measured at five energies between 8.5 and 11.4 MeV. Angular distributions at four angles between 90 0 and 140 0 for both elastic and inelastic scattering at 9.0 and 11.4 MeV were also measured. The monoenergetic photons were obtained from thermal neutron capture in Ni and Cr. All the angular distributions and the elastic and Raman scattering at the higher energies are in good overall agreement with theoretical predictions. The theory is based on a modified simple rotator model of the giant resonance in which the effect of Delbrueck scattering was included. A trend of both the elastic and Raman scattering at lower energies to be stronger than expected are suggested by the data. However, the ratio between the Raman and elastic scattering seem to be in good agreement with theory throughout the whole energy range. This shows that there is no need to introduce a direct nonresonant component to the imaginary part of the elastic scattering amplitude to explain the experimental data. (Auth.)

  11. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  12. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  13. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  14. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  15. Neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu from 1 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs.

  16. Capture and Fission rate of 232-Th, 238-U, 237-Np and 239-Pu from spallation neutrons in a huge block of lead.

    CERN Document Server

    Vlachoudis, Vasilis

    2000-01-01

    The study is centered on the research of the incineration possibility of nuclear waste, by the association of a particle accelerator with a multiplying medium of neutrons, in the project "Energy Amplifier" of C. Rubbia. It consists of the experimental determination of the rates of capture and fission of certain elements (232-Th, 238-U, 237-Np and 239-Pu) subjected to a fluence of fast spallation neutrons. These neutrons are produced by the interaction of high kinetic energy protons (several GeV) provided by the CERN-PS accelerator, on a large lead solid volume. The measurement techniques used in this work, are based on the activation of elements in the lead volume and the subsequent gamma spectroscopy of the activated elements, and also by the detection of fission fragment traces. The development, of a Monte Carlo code makes it possible, on one hand, to better understand the relevant processes, and on the other hand, to validate the code, by comparison with measurements, for the design and the construction of...

  17. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given; Determination des parametres des resonances neutroniques du neptunium 237, en dessous de 500eV, et obtention des matrices de covariances statistiques et systematiques entre les parametres de ces resonances

    Energy Technology Data Exchange (ETDEWEB)

    Lepretre, A.; Herault, N. [CEA Saclay, Dept. d' Astrophysique de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Brusegan, A.; Noguere, G.; Siegler, P. [Institut des Materiaux et des Metrologies - IRMM, Joint Research Centre, Gell (Belgium)

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  18. Wind-tunnel investigation of longitudinal and lateral-directional stability and control characteristics of a 0.237-scale model of a remotely piloted research vehicle with a thick, high-aspect-ratio supercritical wing

    Science.gov (United States)

    Byrdsong, T. A.; Brooks, C. W., Jr.

    1980-01-01

    A 0.237-scale model of a remotely piloted research vehicle equipped with a thick, high-aspect-ratio supercritical wing was tested in the Langley 8-foot transonic tunnel to provide experimental data for a prediction of the static stability and control characteristics of the research vehicle as well as to provide an estimate of vehicle flight characteristics for a computer simulation program used in the planning and execution of specific flight-research mission. Data were obtained at a Reynolds number of 16.5 x 10 to the 6th power per meter for Mach numbers up to 0.92. The results indicate regions of longitudinal instability; however, an adequate margin of longitudinal stability exists at a selected cruise condition. Satisfactory effectiveness of pitch, roll, and yaw control was also demonstrated.

  19. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  20. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  1. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  2. The Effect of Radiation Dose and Chemotherapy on Overall Survival in 237 Patients With Stage III Non-Small-Cell Lung Cancer

    International Nuclear Information System (INIS)

    Wang Li; Correa, Candace R.; Zhao Lujun; Hayman, James; Kalemkerian, Gregory P.; Lyons, Susan; Cease, Kemp; Brenner, Dean; Kong Fengming

    2009-01-01

    Purpose: To study the effects of radiation dose, chemotherapy, and their interaction in patients with unresectable or medically inoperable Stage III non-small-cell lung cancer (NSCLC). Methods and Materials: A total of 237 consecutive Stage III NSCLC patients were evaluated. Median follow-up was 69.0 months. Patients were treated with radiation therapy (RT) alone (n = 106), sequential chemoradiation (n = 69), or concurrent chemoradiation (n = 62). The primary endpoint was overall survival (OS). Radiation dose ranged from 30 to 102.9 Gy (median 60 Gy), corresponding to a bioequivalent dose (BED) of 39 to 124.5 Gy (median 72 Gy). Results: The median OS of the entire cohort was 12.6 months, and 2- and 5-year survival rates were 22.4% and 10.0%, respectively. Multivariable Cox regression model demonstrated that Karnofsky performance status (p = 0.020), weight loss < 5% (p = 0.017), chemotherapy (yes vs. no), sequence of chemoradiation (sequential vs. concurrent; p < 0.001), and BED (p < 0.001) were significant predictors of OS. For patients treated with RT alone, sequential chemoradiation, and concurrent chemoradiation, median survival was 7.4, 14.9, and 15.8 months, and 5-year OS was 3.3%, 7.5%, and 19.4%, respectively (p < 0.001). The effect of higher radiation doses on survival was independent of whether chemotherapy was given. Conclusion: Radiation dose and use of chemotherapy are independent predictors of OS in Stage III NSCLC, and concurrent chemoradiation is associated with the best survival. There is no interaction between RT dose and chemotherapy.

  3. Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program

    International Nuclear Information System (INIS)

    Martin, Julie-Fiona

    2014-01-01

    SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234 U, 235 U, 237 Np and 238 Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238 U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and

  4. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given

    International Nuclear Information System (INIS)

    Lepretre, A.; Herault, N.; Brusegan, A.; Noguere, G.; Siegler, P.

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  5. Investigation of Neutron Spectra and Transmutation of ^{129}I, ^{237}Np and Other Nuclides with 1.5 GeV Protons from the Dubna Nuclotron Using the Electronuclear Setup "Energy plus Transmutation"

    CERN Document Server

    Krivopustov, M I; Balabekyan, A R; Batusov, Yu A; Bielewicz, M; Brandt, R; Chaloun, P; Chultem, D; Dwivedi, K K; Elishev, A F; Fragopoulou, M; Henzl, V; Henzlová, D; Kalinnikov, V G; Kievets, M K; Krása, A; Krizek, F; Kugler, A; Manolopoulou, Metaxia; Mariin, I I; Nourreddine, A; Odoj, R; Pavliouk, A V; Pronskikh, V S; Robotham, H; Siemon, K; Szuta, M; Stegailov, V I; Solnyshkin, A A; Sosnin, A N; Stoulos, S; Tsoupko-Sitnikov, V M; Tumendelger, T; Wojecehowski, A; Wagner, V; Wan, J S; Westmeier, W; Zamani-Valasiadou, M; Kumawat, H; Kumar, V; Zaverioukha, O S; Zhuk, I V

    2004-01-01

    Experiments which are part of the scientific program "Investigations of physical aspects of electronuclear method of energy production and transmutation for radioactive waste of atomic energetics using relativistic beams from the JINR Synchrophasotron/Nuclotron" (project "Energy plus Transmutation") are described. A large lead target surrounded by a four-section uranium blanket with total weight of 206.4 kg natural uranium was irradiated with 1.5 GeV protons from the new cryogenic accelerator Nuclotron. Radiochemical sensors were exposed to the secondary particle fluences inside and on top of the target assembly. Two long-lived radioactive waste of atomic energetics sensors ^{129}I and ^{237}Np (approximately 1 g weight each) and stable nuclides ^{27}Al, ^{59}Co, ^{127}I, ^{139}La, ^{197}Au and ^{209}Bi as well as natural and enriched uranium were used. In addition, various solid state nuclear track detectors and nuclear emulsions were exposed simultaneously. The experimental results confirm the theoretical e...

  6. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  7. 234 - 237_Uduma_Elementall

    African Journals Online (AJOL)

    pc

    risks from exposure to geological materials associa with mining ... alue both to the mining industry and to the health of the commun cal exploitation ... ent production, ceramics petroleum .... controls can minimize exposures to workers and.

  8. Comment: 237 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available for Life Science licensed under CC Attribution2.1 Japan 絵や写真の投稿もできます。右は、没になったティラノザウルス(目がかわいい)です。 ttamura 2008/11/11 12:11:40 2011/09/14 21:10:36 ...

  9. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  10. Identification of the new isotope sup 2 sup 4 sup 1 Bk

    CERN Document Server

    Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

    2003-01-01

    A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

  11. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  12. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  13. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  14. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  15. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. TMFunction data: 237 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  17. 48 CFR 237.7301 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... means any public or private post-secondary school, junior college, college, university, or other degree... of study at any level beyond high school. (b) Nonprofit organization means any organization described... good standing in a curriculum designed to lead to the granting of a recognized degree, during the term...

  18. The accumulation of plutonium by the European lobster (Homarus gammarus L.)

    International Nuclear Information System (INIS)

    Swift, D.J.

    1992-01-01

    For 237 Pu accumulation from seawater, the whole body concentration factors (CFs) for juvenile lobsters at 18 o C did not exceed 250 over the 49 days of the study. Most 237 Pu was accumulated by the gills and exoskeleton. Since homarid lobsters eat their exuviae after ecdysis, the whole body 237 Pu content of recently moulted lobsters was also a function of the amount of 237 Pu ingested with the exuviae. Consequently, organ/tissue content and CF values for individual lobsters reflected both the time since their last moult and their exposure time to 237 Pu. These factors precluded the calculation of mean whole body CF values or the accurate estimate of a mean steady state (C ss ) CF value. Juvenile lobsters retained significantly more 237 Pu from labelled food at 7-10 o C than at 18 o C. At 7 o C, the biological half time for assimilated 237 Pu was about 28 days, at 10 o C about 15 days and at 18 o C about 8 days. Very little 237 Pu was transported from the gut to the internal tissues (about 1%); most was retained in the hepatopancreas. (author)

  19. Theoretical analyses of (n,xn) reactions on sup 235 U, sup 238 U, sup 237 Np, and sup 239 Pu for ENDF/B-VI

    Energy Technology Data Exchange (ETDEWEB)

    Young, P.G.; Arthur, E.D.

    1991-01-01

    Theoretical analyses were performed of neutron-induced reactions on {sup 235}U, {sup 238}U, {sup 237}Np, and {sup 239}Pu between 0.01 and 20 MeV in order to calculate neutron emission cross sections and spectra for ENDF/B-VI evaluations. Coupled-channel optical model potentials were obtained for each target nucleus by fitting total, elastic, and inelastic scattering cross section data, as well as low-energy average resonance data. The resulting deformed optical model potentials were used to calculate direct (n,n{prime}) cross sections and transmission coefficients for use in Hauser-Feshbach statistical theory analyses. A fission model with multiple barrier representation, width fluctuation corrections, and preequilibrium corrections were included in the analyses. Direct cross sections for higher-lying vibrational states were calculated using DWBA theory, normalized using B(E{ell}) values determined from (d,d{prime}) and Coulomb excitation data, where available, and from systematics otherwise. Initial fission barrier parameters and transition state density enhancements appropriate to the compound systems involved were obtained from previous analyses, especially fits to charged-particle fission probability data. The parameters for the fission model were adjusted for each target system to obtain optimum agreement with direct (n,f) cross section measurements, taking account of the various multichance fission channels, that is, the different compound systems involved. The results from these analyses were used to calculate most of the neutron (n,n), (n,n{prime}), and (n,xn) cross section data in the ENDF/B/VI evaluations for the above nuclei, and all of the energy-angle correlated spectra. The deformed optical model and fission model parameterizations are described. Comparisons are given between the results of these analyses and the previous ENDF/B-V evaluations as well as with the available experimental data. 14 refs., 3 figs., 1 tab.

  20. Human Leukocyte Antigen-A, B, C, DRB1, and DQB1 Allele and Haplotype Frequencies in a Subset of 237 Donors in the South African Bone Marrow Registry

    Directory of Open Access Journals (Sweden)

    Mqondisi Tshabalala

    2018-01-01

    Full Text Available Human leukocyte antigen- (HLA- A, HLA-B, HLA-C, HLA-DRB1, and HLA-DQB1 allele and haplotype frequencies were studied in a subset of 237 volunteer bone marrow donors registered at the South African Bone Marrow Registry (SABMR. Hapl-o-Mat software was used to compute allele and haplotype frequencies from individuals typed at various resolutions, with some alleles in multiple allele code (MAC format. Four hundred and thirty-eight HLA-A, 235 HLA-B, 234 HLA-DRB1, 41 HLA-DQB1, and 29 HLA-C alleles are reported. The most frequent alleles were A∗02:02g (0.096, B∗07:02g (0.082, C∗07:02g (0.180, DQB1∗06:02 (0.157, and DRB1∗15:01 (0.072. The most common haplotype was A∗03:01g~B∗07:02g~C∗07:02g~DQB1∗06:02~DRB1∗15:01 (0.067, which has also been reported in other populations. Deviations from Hardy-Weinberg equilibrium were observed in A, B, and DRB1 loci, with C~DQB1 being the only locus pair in linkage disequilibrium. This study describes allele and haplotype frequencies from a subset of donors registered at SABMR, the only active bone marrow donor registry in Africa. Although the sample size was small, our results form a key resource for future population studies, disease association studies, and donor recruitment strategies.

  1. The accumulation of plutonium by the European lobster (Homarus gammarus L. )

    Energy Technology Data Exchange (ETDEWEB)

    Swift, D J [Ministry of Agriculture, Fisheries and Food, Lowestoft (United Kingdom). Directorate of Fisheries Research

    1992-01-01

    For {sup 237}Pu accumulation from seawater, the whole body concentration factors (CFs) for juvenile lobsters at 18{sup o}C did not exceed 250 over the 49 days of the study. Most {sup 237}Pu was accumulated by the gills and exoskeleton. Since homarid lobsters eat their exuviae after ecdysis, the whole body {sup 237}Pu content of recently moulted lobsters was also a function of the amount of {sup 237}Pu ingested with the exuviae. Consequently, organ/tissue content and CF values for individual lobsters reflected both the time since their last moult and their exposure time to {sup 237}Pu. These factors precluded the calculation of mean whole body CF values or the accurate estimate of a mean steady state (C{sub ss}) CF value. Juvenile lobsters retained significantly more {sup 237}Pu from labelled food at 7-10{sup o}C than at 18{sup o}C. At 7{sup o}C, the biological half time for assimilated {sup 237}Pu was about 28 days, at 10{sup o}C about 15 days and at 18{sup o}C about 8 days. Very little {sup 237}Pu was transported from the gut to the internal tissues (about 1%); most was retained in the hepatopancreas. (author).

  2. Correction to: Kürti, László. “Review Article: Documenting Immigrants, Boarding Houses and Ethnographers. Burdosház Amerikából – Balogh Balázs néprajzkutató nyomában ('A Boarding House from America - in the Footsteps of Ethnographer Balázs Balogh'. Directed by Dezső Zsigmond, produced by Dunatáj Alapítvány, Camera: Arthur Bálint, 2015, 50:39 minutes.” Hungarian Cultural Studies. e-Journal of the American Hungarian Educators Association, Volume 9 (2016 DOI: 10.5195/ahea.2016.237

    Directory of Open Access Journals (Sweden)

    László Kürti

    2017-09-01

    Full Text Available Changing the incorrect word “script” to “scrip”. The word “scrip” refers to the method of payment used in companies instead of legal tender. The original article can be found via the DOI: http://doc.doi.org/10.5195/ahea.2016.237

  3. About the first experiment on investigation of 129I, 237Np, 238Pu and 239Pu transmutation at the nuclotron 2.52 GeV deuteron beam in neutron field generated in U/Pb-assembly 'Energy plus transmutation'

    International Nuclear Information System (INIS)

    Krivopustov, M.I.; Pavliouk, A.V.; Malakhov, A.I.

    2008-01-01

    Preliminary results of the first experiment with energy 2.52 GeV at the electronuclear setup which consists of Pb-target (diameter 8.4 cm, length 45.6 cm) and nat U-blanket (206.4 kg), transmutation samples of 129 I, 237 Np, 238 Pu and 239 Pu (radioecological aspect) are described. Hermetically sealed samples in notable amounts are gathered in atomic reactors and setups of industries which use nuclear materials and nuclear technologies were irradiated in the field of neutrons produced in the Pb-target and propagated in the nat U-blanket. Estimates of transmutations were obtained as a result of measurements of gamma activities of the samples. The information about the space and energy distribution of neutrons in the volume of the lead target and the uranium blanket was obtained with the help of sets of activation threshold detectors (Al, Co, Y, I, Au, Bi and others), solid-state nuclear track detectors, 3 He neutron detectors and nuclear emulsion. Comparison of the experimental data with the results of simulation with the MCNPX program was performed

  4. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  5. Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

    1983-01-01

    Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

  6. Prevalence, distribution and functional significance of the -237C to T polymorphism in the IL-12Rβ2 promoter in Indian tuberculosis patients.

    Directory of Open Access Journals (Sweden)

    Vikas Kumar Verma

    Full Text Available Cytokine/cytokine receptor gene polymorphisms related to structure/expression could impact immune response. Hence, the -237 polymorphic site in the 5' promoter region of the IL-12Rβ2 (SNP ID: rs11810249 gene associated with the AP-4 transcription motif GAGCTG, was examined. Amplicons encompassing the polymorphism were generated from 46 pulmonary tuberculosis patients, 35 family contacts and 28 miscellaneous volunteers and sequenced. The C allele predominated among patients, (93.4%, 43/46, and in all volunteers and contacts screened, but the T allele was exclusively limited to patients, (6.5%, 3/46. The functional impact of this polymorphism on transcriptional activity was assessed by Luciferase-reporter and electrophoretic mobility shift assays (EMSA. Luciferase-reporter assays showed a significant reduction in transcriptional efficiency with T compared to C allele. The reduction in transcriptional efficiency with the T allele construct (pGIL-12Rb2-T, in U-87MG, THP-1 and Jurkat cell lines, were 53, 37.6, and 49.8% respectively, compared to the C allele construct (pGIL-12Rb2-C. Similarly, densitometric analysis of the EMSA assay showed reduced binding of the AP-4 transcription factor, to T compared to the C nucleotide probe. Reduced mRNA expression in all patients (3/3 harboring the T allele was seen, whereas individuals with the C allele exhibited high mRNA expression (17/25; 68%, p = 0.05. These observations were in agreement with the in vitro assessment of the promoter activity by Luciferase-reporter and EMSA assays. The reduced expression of IL-12Rβ2 transcripts in 8 patients despite having the C allele was attributed to the predominant over expression of the suppressors (IL-4 and GATA-3 and reduced expression of enhancers (IFN-α of IL-12Rβ2 transcripts. The 17 high IL-12Rβ2 mRNA expressers had significantly elevated IFN-α mRNA levels compared to low expressers and volunteers. Notwithstanding the presence of high levels of IL-12R

  7. The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

    Energy Technology Data Exchange (ETDEWEB)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

  8. Capability to Recover Plutonium-238 in H-Canyon/HB-Line - 13248

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, Kenneth S. Jr.; Smith, Robert H. Jr.; Goergen, Charles R. [Savannah River Nuclear Solutions, LLC, Savannah River Site, Aiken, SC 29802 (United States)

    2013-07-01

    Plutonium-238 is used in Radioisotope Thermoelectric Generators (RTGs) to generate electrical power and in Radioisotope Heater Units (RHUs) to produce heat for electronics and environmental control for deep space missions. The domestic supply of Pu-238 consists of scrap material from previous mission production or material purchased from Russia. Currently, the United States has no significant production scale operational capability to produce and separate new Pu-238 from irradiated neptunium-237 targets. The Department of Energy - Nuclear Energy is currently evaluating and developing plans to reconstitute the United States capability to produce Pu-238 from irradiated Np-237 targets. The Savannah River Site had previously produced and/or processed all the Pu-238 utilized in Radioisotope Thermoelectric Generators (RTGs) for deep space missions up to and including the majority of the plutonium for the Cassini Mission. The previous full production cycle capabilities included: Np- 237 target fabrication, target irradiation, target dissolution and Np-237 and Pu-238 separation and purification, conversion of Np-237 and Pu-238 to oxide, scrap recovery, and Pu-238 encapsulation. The capability and equipment still exist and could be revitalized or put back into service to recover and purify Pu-238/Np-237 or broken General Purpose Heat Source (GPHS) pellets utilizing existing process equipment in HB-Line Scrap Recovery, and H-Canyon Frame Waste Recovery processes. The conversion of Np-237 and Pu-238 to oxide can be performed in the existing HB-Line Phase-2 and Phase- 3 Processes. Dissolution of irradiated Np-237 target material, and separation and purification of Np-237 and Pu-238 product streams would be possible at production rates of ∼2 kg/month of Pu-238 if the existing H-Canyon Frames Process spare equipment were re-installed. Previously, the primary H-Canyon Frames equipment was removed to be replaced: however, the replacement project was stopped. The spare equipment

  9. Attenuation of Foot-and-Mouth Disease Virus by Engineered Viral Polymerase Fidelity.

    Science.gov (United States)

    Rai, Devendra K; Diaz-San Segundo, Fayna; Campagnola, Grace; Keith, Anna; Schafer, Elizabeth A; Kloc, Anna; de Los Santos, Teresa; Peersen, Olve; Rieder, Elizabeth

    2017-08-01

    Foot-and-mouth disease virus (FMDV) RNA-dependent RNA polymerase (RdRp) (3D pol ) catalyzes viral RNA synthesis. Its characteristic low fidelity and absence of proofreading activity allow FMDV to rapidly mutate and adapt to dynamic environments. In this study, we used the structure of FMDV 3D pol in combination with previously reported results from similar picornaviral polymerases to design point mutations that would alter replication fidelity. In particular, we targeted Trp237 within conserved polymerase motif A because of the low reversion potential inherent in the single UGG codon. Using biochemical and genetic tools, we show that the replacement of tryptophan 237 with phenylalanine imparts higher fidelity, but replacements with isoleucine and leucine resulted in lower-fidelity phenotypes. Viruses containing these W237 substitutions show in vitro growth kinetics and plaque morphologies similar to those of the wild-type (WT) A 24 Cruzeiro strain in BHK cells, and both high- and low-fidelity variants retained fitness during coinfection with the wild-type virus. The higher-fidelity W237F (W237F HF ) mutant virus was more resistant to the mutagenic nucleoside analogs ribavirin and 5-fluorouracil than the WT virus, whereas the lower-fidelity W237I (W237I LF ) and W237L LF mutant viruses exhibited lower ribavirin resistance. Interestingly, the variant viruses showed heterogeneous and slightly delayed growth kinetics in primary porcine kidney cells, and they were significantly attenuated in mouse infection experiments. These data demonstrate, for a single virus, that either increased or decreased RdRp fidelity attenuates virus growth in animals, which is a desirable feature for the development of safer and genetically more stable vaccine candidates. IMPORTANCE Foot-and-mouth disease (FMD) is the most devastating disease affecting livestock worldwide. Here, using structural and biochemical analyses, we have identified FMDV 3D pol mutations that affect polymerase

  10. Dicty_cDB: Contig-U04716-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV429027 ) S237P6215FG6.T0 PortugueseWaterDog Canis familiar... 38 6e-04 2 ( CE020668 ) tigr-gss-dog-1700...AFT ... 48 0.034 2 ( CE733596 ) tigr-gss-dog-17000315432205 Dog Library Canis lup... 38 0.034 2 ( BV431612 ) S237P656RA1.T0 Portugues...library Mus ... 38 0.13 2 ( BV431707 ) S237P6458FA8.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( BV25... ( BV437326 ) S237P6229FG2.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( CE358139 ) tigr-gss-dog-17000... Canis lup... 38 0.14 2 ( BV432826 ) S237P6430RB9.T0 PortugueseWaterDog Canis familiar... 36 0.14 2 ( CE4742

  11. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... the agro-pastoral systems of Tanzania : a gendered analysis (open access) ... This paper deals with the ways in which gender and caste identities marginalise particular groups from access to water in a village in periurban Hyderabad, India.

  12. 33 CFR 117.237 - Christina River.

    Science.gov (United States)

    2010-07-01

    ... five short blasts, and an audio voice warning stating, “Attention, Attention. Norfolk Southern Railroad... infrared detectors, until green lights are displayed on the swing span. (c) The draw of the Third Street...

  13. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... we aim to widen the impact of our investment and advance development research. ... from place to place; this is mainly due to social and economic influences. ... with reference to specific technologies: the computer and the cell phone.

  14. 50 CFR 648.237 - Framework provisions.

    Science.gov (United States)

    2010-10-01

    ... Committee composition and process; description and identification of essential fish habitat; description and identification of habitat areas of particular concern; overfishing definition and related thresholds and targets... measures must come from one or more of the following categories: Minimum fish size; maximum fish size; gear...

  15. Modelling of the radioactive daughter elements in soil to assess radiation impact due to contaminated irrigation water by parents of 231Pa, 226Ra, 238U, 237Np and 239Pu

    International Nuclear Information System (INIS)

    Bela Kanyar; Katalin Eged; Tunde Katona; Gerhard Proehl; Ulla Bergstroem; Bengt Hallberg; Shelly Mobbs; Geert Olyslaegers; Theo Zeevaert; Palome Pinedo; Inmaculade Simon

    2004-01-01

    Radioactive wastes may contain both parent and daughter radionuclides. In some cases the transfer parameters of the daughter radio-elements differ significantly from that of the parent ones and therefore the dose contributions in the different pathways might be important to assess separately. The present work has compared 5 different site specific models by a scenario, using contaminated water for drinking and irrigation. Altogether 5 radionuclides from the investigated 10 ones contained radioactive daughter elements. In general, for long term studies in biosphere the steady-state formulations of processes are adequate to assess the contamination, except the infiltration into the deeper soil and sediment layers. According to the results of the modelling and computer simulations, the following daughters are to be assessed separately from their parents with respect to the radiation impact: for parent 231 Pa the daughter 227 Ac, for parent 226 Ra the daughters 222 Rn, 210 Pb and 210 Po and for parent 237 Np the daughter 233 Pa. The dose contributions of the daughters from parents 238 U and 239 Pu are less significant during the considered 100-10000 years. In case of contamination of irrigation water with 1 Bq x m -3 of the parent radionuclide 231 Pa, more than 90% of the external dose from soil exposure comes from the daughter 227 Ac (annually 15 nSv). By a similar contamination with 226 Ra as a parent radionuclide, 60% of the ingestion dose is due to food contamination with the daughters 210 Pb and 210 Po (approximately 150 nSv x a -1 ). (author)

  16. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides.

    Science.gov (United States)

    Garcia, Alexis; Adedoyin, Gloria; Heitman, Joseph; Lee, Soo Chan

    2017-07-05

    Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5'-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae ). A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG - mutant background. The resulting carRP :: pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP :: dpl237 strain, generating mutants with the alleles carRP :: dpl237 and cnbR :: pyrG These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides . Copyright © 2017 Garcia et al.

  17. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides

    Directory of Open Access Journals (Sweden)

    Alexis Garcia

    2017-07-01

    Full Text Available Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5′-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae. A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG− mutant background. The resulting carRP::pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP::dpl237 strain, generating mutants with the alleles carRP::dpl237 and cnbR::pyrG. These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides.

  18. Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Behrens, R.G.; Roth, S.B.; Jones, S.R.

    1991-01-01

    Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

  19. 48 CFR 252.237-7016 - Delivery tickets.

    Science.gov (United States)

    2010-10-01

    ...), and (e) to the basic clause: (c) Before the Contractor picks up articles for service under this... of serviced laundry on the delivery ticket. The Contracting Officer will ensure that this weight and... articles for service under this contract, the Contracting Officer will ensure that each bag is weighed and...

  20. 48 CFR 252.237-7017 - Individual laundry.

    Science.gov (United States)

    2010-10-01

    ... clause: Individual Laundry (DEC 1991) (a) The Contractor shall provide laundry service under this... services. (c) Charges for individual laundry will be on a per unit bundle or a piece-rate basis. The... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual laundry. 252...

  1. 237 MORAL AND PSYCHOLOGICAL FILICIDE: EXAMINING THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    no good hospital, employment opportunity or social infrastructure and where poverty level is over. 300%, how will you expect a family to reject the gains from anti-social ..... Likewise, every child has the right to maintenance by his parents or guardians in accordance with the extent of their means, and the child has the right, ...

  2. 237 MORAL AND PSYCHOLOGICAL FILICIDE: EXAMINING THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Nigerian campuses of higher learning or the like that engage in sex for .... children and causing various risks to the child safety… ... their babies with them for up to 18months gives room for bonding of mother and child, .... be likely to adversely affect his physical, mental, spiritual, moral or social development or employed as.

  3. 7 CFR 2.37 - Chief Information Officer.

    Science.gov (United States)

    2010-01-01

    ... acquisition; (iii) Approve the appointment of the program manager for each major information technology... recommendations to Agency Heads for the removal or replacement of information technology project managers, when... regarding information technology matters. (2) Overseeing all information technology and information resource...

  4. 48 CFR 1552.237-71 - Technical direction.

    Science.gov (United States)

    2010-10-01

    .... (d) Technical direction will be issued in writing or confirmed in writing within five (5) days after... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Technical direction. 1552... Technical direction. As prescribed in 1537.110, insert a clause substantially the same as the following...

  5. 48 CFR 237.104 - Personal services contracts.

    Science.gov (United States)

    2010-10-01

    ... intelligence component or counter-intelligence organization of DoD; or (iii) Directly support the mission of... travel between home or place of business and official duty station. (iii) Coordinate with the civilian... SYSTEM, DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Service Contracts...

  6. Neptunium Transport Behavior in the Vicinity of Underground Nuclear Tests at the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, P; Tinnacher, R M; Zavarin, M; Williams, R W; Kersting, A B

    2010-12-03

    We used short lived {sup 239}Np as a yield tracer and state of the art magnetic sector ICP-MS to measure ultra low levels of {sup 237}Np in a number of 'hot wells' at the Nevada National Security Site (NNSS), formerly known as the Nevada Test Site (NTS). The results indicate that {sup 237}Np concentrations at the Almendro, Cambric, Dalhart, Cheshire and Chancellor sites, are in the range of 3 x 10{sup -5} to 7 x 10{sup -2} pCi/L and well below the MCL for alpha emitting radionuclides (15 pCi/L) (EPA, 2009). Thus, while Np transport is believed to occur at the NNSS, activities are expected to be well below the regulatory limits for alpha-emitting radionuclides. We also compared {sup 237}Np concentration data to other radionuclides, including tritium, {sup 14}C, {sup 36}Cl, {sup 99}Tc, {sup 129}I, and plutonium, to evaluate the relative {sup 237}Np transport behavior. Based on isotope ratios relative to published unclassified Radiologic Source Terms (Bowen et al., 1999) and taking into consideration radionuclide distribution between melt glass, rubble and groundwater (IAEA, 1998), {sup 237}Np appears to be substantially less mobile than tritium and other non-sorbing radionuclides, as expected. However, this analysis also suggests that {sup 237}Np mobility is surprisingly similar to that of plutonium. The similar transport behavior of Np and Pu can be explained by one of two possibilities: (1) Np(IV) and Pu(IV) oxidation states dominate under mildly reducing NNSS groundwater conditions resulting in similar transport behavior or (2) apparent Np transport is the result of transport of its parent {sup 241}Pu and {sup 241}Am isotopes and subsequent decay to {sup 237}Np. Finally, measured {sup 237}Np concentrations were compared to recent Hydrologic Source Term (HST) models. The 237Np data collected from three wells in Frenchman Flat (RNM-1, RNM-2S, and UE-5n) are in good agreement with recent HST transport model predictions (Carle et al., 2005). The agreement

  7. New equations to calculate temperature correction factors for PO2 in human blood.

    Science.gov (United States)

    Inaba, H; Ohwada, T; Sato, J; Mizuguchi, T; Hirasawa, H

    1986-01-01

    Effects of hemoglobin concentration (Hb), pH, and body temperature (T) on the relationships between delta log PO2/delta T and PO2 were studied by means of a mathematical model using a Newton-Raphson iteration method. The functions between delta log PO2/delta T and PO2 were affected by the above three factors. New equations considering the effects of Hb, pH, and T were proposed by modifying the equation reported by Severinghaus: delta log PO2/delta T = (L +(U-L)/(A(vPO237)B + 1))(10(-2) where U = 3.15-0.45(7.4-pH37) L = 0.68-0.09(7.4-pH37) A = 5.86(exp10(0.074(T)-0.294(7.4-pH37)-11))((Hb)0.913) B = 6.33(exp10(-0.0051(T)))((Hb)-0.113) + 0.24(7.4-pH37) and vPO237 is virtual PO237 which may exist when PO237 is corrected to standard conditions (pH = 7.4, BE = 0) by the following equations: vPO237 = PO237(exp10(fB(7.4-pH37)-0.0013(BE))) fB = (PO237/26.6)0.08-1.52 where fB is the Bohr factor. The above equations provided values of delta log PO2/delta T which fit closely to those obtained by the complex iteration method with maximum differences of less than 1.3 X 10(-3) at T = 27, indicating that maximum % errors for PO2 at T (PO2T) are less than 3.0% at T = 27 and that our equations can be applied over a wide range of Hb, pH37 and T.

  8. Quantum helimagnetism of the frustrated spin-1/2 chain LiCuVO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Enderle, M.; Mukherjee, C.; Fak, B.; Kremer, R. K.; Broto, J.-M.; Rosner, H.; Drechsler, S.-L.; Richter, J.; Málek, Jiří; Prokofiev, A.; Assmus, W.; Pujol, S.; Raggazzoni, J.-L.; Rakato, H.; Rheinstädter, M.; Ronnow, H.M.

    2005-01-01

    Roč. 70, č. 2 (2005), s. 237-243 ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : inelastic neutron scattering * magnetic quantum helix Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.237, year: 2005

  9. Holdup Measures on an SRNL Mossbauer Spectroscopy Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dewberry, R.; Brown, T.; Salaymeh, S.

    2010-05-05

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 {+-} 150) {mu}Ci Am-241 and (110 {+-} 50) {mu}Ci of Np-237.

  10. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Iwamoto, Osamu

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  11. Update neutron nuclear data evaluation for 236,238Np

    International Nuclear Information System (INIS)

    Chen, Guochang; Wang, Jimin; Yu, Baosheng; Cao, Wentian; Tang, Guo-you

    2015-01-01

    The nuclear data with high accuracy for actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides (MAs) in high burnup reactors and to research to transmute the MAs to short half-lived nuclides or stable ones. The nuclides of 236 Np are generated via the α-decay of 240 Am or 237 Np(n, 2n) and 237 Np(d, t) reactions. And the nuclides of 238 Np are generated via the α-decay of 242 Am or 237 Np(n, γ) and 237 Np(d, p) reactions. In the present work, according to the systematic trend of the total cross section and elastic cross section etc. of different Np isotopes, and based on the neutron optical model parameters (OMP) of 237 Np, a new set of neutron optical model parameters were obtained for 236,238 Np. Based on the new set OMP and the systematic trend of the cross sections of different Np isotopes, a full set of 236,238 Np neutron nuclear data has been updated and improved by theoretical calculation. The present result has significant improvements over the data in CENDL-3.1

  12. Uptake of three isotopes of plutonium from soil by sweet corn grown in a growth chamber

    International Nuclear Information System (INIS)

    Hersloff, L.W.; Corey, J.C.

    1978-01-01

    The use of 237 Pu as a tracer for 238 Pu and 239 Pu was studied in a plant--soil system. Sandy clay--loam soil was spiked with approx. 240 pCi/g of 237 Pu, 14.3 pCi/g of 238 Pu, and 33 pCi/g of 239 Pu in the form of Pu(NO 3 ) 4 . The uptake of these three isotopes of plutonium was measured in the standing vegetation of sweet corn (Zea mays L. var. Silver Queen) after 30 and 50 days of growth. The mean concentrations in the standing crop and the concentration ratios of each isotope decreased from 30 to 50 days. There was an apparent differential availability of the three isotopes: 237 Pu was more available than 238 Pu, which was more available than 239 Pu. The quantity of 237 Pu in the standing crop, on a mass basis, closely approximated that of 238 Pu for both sampling times. Factors influencing these results are discussed

  13. EFFECT OF HYDROPHOBIC ORGANIC POLLUTANTS BIOAVAILABILITY ON ECOTOXICITY OF HISTORICALLY CONTAMINATED SOILS

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Innemanová, P.; Cajthaml, Tomáš

    2012-01-01

    Roč. 11, č. 3 (2012), s. 237-237 ISSN 1843-3707. [Environmental Microbiology and Biotechnology. 10.04.2012-12.04.2012, Bologna] R&D Projects: GA TA ČR TA01020804 Institutional research plan: CEZ:AV0Z50200510 Keywords : Supercritical fluid extraction Subject RIV: EE - Microbiology, Virology

  14. Mutual emergency assistance for radiation accidents

    International Nuclear Information System (INIS)

    1983-03-01

    A revised document on ''Mutual Emergency Assistance for Radiation Accidents'' jointly prepared by the Agency with the participation of the World Health Organization (WHO), the Food and Agricultural Organization of the United Nations (FAO), the International Labour Organisation (ILO) and the Office of the United Nations Disaster Relief Co-ordinator (UNDRO) was issued in 1980 as TECDOC-237. The present document lists the additional information received after publication of the 1980 edition and is issued as a Supplement to TECDOC-237 (1980 Edition). Some useful information contained in TECDOC-237 such as the IAEA arrangement and the WHO Collaborating Centres for Radiation Emergency Assistance are reprinted for ready reference

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 237 of 237 ... Vol 59 (2015), The IFAA Sunday Forum: Youth Dialogue on the TRC - Reflections and Possibilities, Abstract. CA Lester. Vol 58 (2015), The IMF's advice on fiscal policy, Abstract. A Schimmelpfennig. Vol 67, No 1 (2017), The national health insurance and traditional healing in South Africa, Abstract.

  16. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  17. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  18. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

    1978-01-01

    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  19. Dicty_cDB: Contig-U12507-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 129S1/SvImJ Mus musculus STS genomi... 58 0.001 1 ( BV434071 ) S237P6227RB12.T0 PortugueseWaterDog Canis fam...ilia... 58 0.001 1 ( BV424860 ) S237P6196FC6.T0 PortugueseWaterDog Canis familiar

  20. The study of prompt and delayed muon induced fission III. The ratios of prompt to delayed fission yields

    NARCIS (Netherlands)

    Rösel, Ch.; Hänscheid, H.; Hartfiel, J.; Mutius, von R.; Achard van Enschut, d' J.F.M.; David, P; Janszen, H.; Johansson, T.; Konijn, J.; Krogulski, T.; Laat, de C.T.A.M.; Paganetti, H.; Petitjean, C.; Polikanov, S.M.; Reist, H.W.; Risse, F.; Schaller, L.A.; Schrieder, W.; Sinha, A.K.; Taal, A.; Theobald, J.P.; Tibell, G.; Trautmann, N.

    1993-01-01

    The ratios of prompt to delayed fission yields for the isotopes U-233, U-234, U-235, U-236, U-238, Np-237, Pu-242, and Pu-244 and the fission probabilities relative to each other have been investigated experimentally. Using the value of the total fission probability for Np-237 the absolute

  1. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  2. Dicty_cDB: Contig-U03903-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence from clone DKEYP-86F8 in l... 52 0.023 1 ( BV433213 ) S237P6285FG10.T0 Portuguese...6 1 ( BV438906 ) S237P6374FA9.T0 PortugueseWaterDog Canis familiar... 44 5.6 1 ( AM456273 ) Vitis vinifera c

  3. New records of Ascaridia platyceri (Nematoda) in parrots (Psittaciformes)

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 7 (2004), s. 237-241 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * morphology * Nematoda Subject RIV: EG - Zoology Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-7-237.pdf

  4. Structural analysis within the Rožná and Olší uranium deposits (Strážek Moldanubicum) for the estimation of deformation and stress conditions of underground gas storage

    Czech Academy of Sciences Publication Activity Database

    Ptáček, Jiří; Melichar, R.; Hájek, Antonín; Koníček, Petr; Souček, Kamil; Staš, Lubomír; Kříž, P.; Lazárek, J.

    2013-01-01

    Roč. 10, č. 2 (2013), s. 237-246 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : structural analysis * deformation * stress * underground gas storage Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_13_Ptacek_237-246.pdf

  5. Actinide neutron induced cross-sections; analysis of the OSMOSE LWR-UO{sub 2} experiment in MINERVE

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, D.; Litaize, O.; Santamarina, A.; Antony, M.; Hudelot, J. P. [Commissariat a l' Energie Atomique, Cadarache, DEN/DER, 13108 Saint-Paul-Lez-Durance (France)

    2006-07-01

    This paper describes the interpretation of the first phase of the OSMOSE experimental program. The OSMOSE experiment began in 2005 in the MINERVE French facility and will continue until 2008. It consists in reactivity worth measurements of separated actinides by an oscillation technique. First results are obtained in a standard LWR neutron spectrum (UO{sub 2} lattice). The present study focuses on the following isotopes: {sup 234,236}U, {sup 237}Np, {sup 239,242}Pu. The comparison between APOLLO2 accurate deterministic calculations and experiments shows the reliability of the latest JEFF-3.1 European nuclear data library for all oscillated isotopes, except {sup 237}Np. The obtained (C/E-1){+-}({delta}E/E) values are the following: {sup 234}U: -5%{+-}2% {sup 237}Np: -11%{+-}2% {sup 239}Pu: +1%{+-}2% {sup 242}Pu: +2%{+-}2% An energetic decomposition of the reactivity worth is carried out using Standard Perturbation Theory that underlines the underestimation of the {sup 237}Np(n, {gamma}) thermal and resonant capture cross-section. (authors)

  6. 30 CFR 23.7 - Specific requirements for approval.

    Science.gov (United States)

    2010-07-01

    ... adequate instructions for the installation and connection of telephones and signal devices in order that the safety of these devices and other circuits shall not be diminished by improper installation. MSHA reserves the right to require the attachment of wiring diagrams to the cases of telephones and signal...

  7. Vocational Education in Corrections. Information Series No. 237.

    Science.gov (United States)

    Day, Sherman R.; McCane, Mel R.

    Vocational education programs in America's correctional institutions have been financially handicapped, since security demands the greatest portion of resource allocations. Four eras in the development of the correctional system are generally identified: era of punishment and retribution, era of restraint or reform, era of rehabilitation and…

  8. 29 CFR 1952.237 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 1910.142) in agriculture (except for agricultural temporary labor camps associated with egg, poultry or red meat production, or the post-harvest processing of agricultural or horticultural commodities.) The... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...

  9. 48 CFR 1252.237-72 - Prohibition on advertising.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Prohibition on advertising... Prohibition on advertising. As prescribed in (TAR) 48 CFR 1213.7101 and 1237.7003, insert the following clause: Prohibition on Advertising (JAN 1996) The contractor or its representatives (including training instructors...

  10. 48 CFR 652.237-71 - Identification/Building Pass.

    Science.gov (United States)

    2010-10-01

    ..., Information Security Programs Division, Industrial Security Branch (DS/ISP/INB) on its cleared employees..., Information Security Programs Division, Industrial Security Branch (DS/ISP/INB): (i) SF-85P, Questionnaire for... Pass (APR 2004) (a) Contractors working in domestic facilities who already possess a security clearance...

  11. 48 CFR 1252.237-71 - Certification of data.

    Science.gov (United States)

    2010-10-01

    ... (Public Law 104-106, 41 U.S.C. 425, note) and DOT Memorandum dated July 17, 1996. (a) The offeror...., company profile; qualifications; background statements; brochures) submitted with its offer is current, accurate, and complete as of the date of its offer. (b) The offeror understands that any inaccurate data...

  12. Determination of neptunium in soil by ICP-MS

    International Nuclear Information System (INIS)

    Ayranov, M.; Kraehenbuehl, U.

    2005-01-01

    A fast and simple method for the determination of 237 Np in soil is presented. The borate fusion decreases the sample pre-treatment time and a TEVA extraction chromatography separates neptunium from uranium and the interfering matrix components. A comparison of the sensitivities of alpha spectrometry and sector field ICP-MS for determination of 237 Np is presented. (orig.)

  13. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction chr...... and rapid analysis of neptunium contamination level for emergency preparedness....

  14. Gastrointestinal absorption and retention of plutonium-238 in neonatal rats and swine

    International Nuclear Information System (INIS)

    Sullivan, M.F.

    1978-01-01

    Neonatal rats gavaged with 237 Pu or 238 Pu retained a substantial quantity in gut mucosa for a week but absorbed only 2.9% of the 237 Pu. After 140 days the amount retained fell to half that initially deposited. Newborn swine also retained large amounts in the gut and absorbed about 40% of the dose

  15. Dicty_cDB: Contig-U01557-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22

  16. Excited levels of Pa-233

    International Nuclear Information System (INIS)

    Vara Cuadrado, J. M.

    1969-01-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T 1 ) detectors. (Author) 54 refs

  17. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J M

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  18. Modeling of lung cancer risk due to radon exhalation of granite stone in dwelling houses

    Directory of Open Access Journals (Sweden)

    Akbar Abbasi

    2017-01-01

    Conclusions: The estimated numbers of lung cancer deaths attributable to indoor radon due to granite stones in 2013 were 145 (3.33% and 103 (2.37% for poor and normal ventilation systems, respectively. According to our estimations, the values of 3.33% and 2.37% of lung cancer deaths in 2013 are attributed to radon exhalation of granite stones with poor and normal ventilation systems, respectively.

  19. 78 FR 73109 - Radio Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and...

    Science.gov (United States)

    2013-12-05

    ... Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and Shamrock, TX AGENCY... 237C3 at Benjamin, Texas; Channel 261C3 at Cisco, Texas; Channel 288C2 at Rule, Texas; and Channel 225C2..., Channel 237C3; by removing Cisco, Channel 261C3; by removing Channel 288C2 at Rule; and by removing...

  20. Profiling N-Type Dopants in Silicon

    Czech Academy of Sciences Publication Activity Database

    Hovorka, Miloš; Mika, Filip; Mikulík, P.; Frank, Luděk

    2010-01-01

    Roč. 51, č. 2 (2010), s. 237-242 ISSN 1345-9678 R&D Projects: GA ČR GP102/09/P543; GA AV ČR IAA100650803 Institutional research plan: CEZ:AV0Z20650511 Keywords : silicon * dopant contrast * photoemission electron microscopy * scanning electron microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.779, year: 2010 http://www.jim.or.jp/journal/e/51/02/237.html

  1. Value of MR-angiography in brain infarction

    International Nuclear Information System (INIS)

    Pirronello, Veronica; Capizzano, Aristides A.; Chouela, Carolina L.; Ternak, Alejandro; Ramirez, Susana; Mazzuco, Juan C.

    2004-01-01

    A retrospective study has been performed in a series of 237 patients, with brain and neck MR and MR angiography techniques. 108/237 (45.5%) patients presented either hemorrhage or lacunar and non lacunar ischemic stroke, 67 of which showed restricted diffusion. Diffusion and perfusion techniques can significantly contribute to study acute stroke. In our series MR angiography showed a 4% sensitivity to detect small arteries pathology. (author)

  2. Modeling of 830 nm FSO Link Attenuation in Fog or Wind Turbulence

    Czech Academy of Sciences Publication Activity Database

    Pešek, J.; Fišer, Ondřej; Svoboda, Jaroslav; Schejbal, V.

    2010-01-01

    Roč. 19, č. 2 (2010), s. 237-241 ISSN 1210-2512 R&D Projects: GA ČR GA102/08/0851; GA MŠk OC09027 Institutional research plan: CEZ:AV0Z30420517 Keywords : Free space optics propagation * fog attenuation, * wind turbulence attenuation * turbulent energy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.503, year: 2010 http://www.radioeng.cz/fulltexts/2010/10_02_237_241.pdf

  3. The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

    International Nuclear Information System (INIS)

    Raoelina Andriambololona

    1976-01-01

    Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

  4. Study on distribution and behavior of long-lived radionuclides in surface soil environment

    International Nuclear Information System (INIS)

    Morita, Shigemitsu; Watanabe, Hitoshi; Katagiri, Hiromi; Akatsu, Yasuo; Ishiguro, Hideharu

    1996-01-01

    Technetium-99 ( 99 Tc) and Neptunium-237 ( 237 Np) are important radionuclides for environmental assessment around nuclear fuel cycle facilities, because these have long-lives and relatively high mobility in the environment. Therefore, we have been studied the determination, distribution and behavior of such long-lived radionuclides in surface soil environment. A new analytical technique using Inductively Coupled Plasma Mass Spectrometry (ICP-MS) was applied to the determination of long-lived radionuclides in environmental samples. The determination method consists of dry ashing, anion exchange and solvent extraction to eliminate the interfering elements and ICP-MS measurement. The sensitivity of this method was 10 to 100,000 times higher, and the counting time was 300 to 100,000 times shorter than the conventional radioanalytical methods. The soil samples were collected at nine points and core soil sample was collected by an electric core sampler at one point. The core soil sample was divided into eight layers. The depth profiles showed that more than 90% of 99 Tc and 237 Np were retained in the surface layer up to 10cm in depth which contained much amount of organic materials. The results suggest that content of organic materials in soil is related to adsorption of 99 Tc and 237 Np onto soil. (author)

  5. Celecoxib-Induced Self-Assembly of Smart Albumin-Doxorubicin Conjugate for Enhanced Cancer Therapy.

    Science.gov (United States)

    Shi, Leilei; Xu, Li; Wu, Chenwei; Xue, Bai; Jin, Xin; Yang, Jiapei; Zhu, Xinyuan

    2018-03-14

    Recent years have witnessed the great contributions that drug combination therapy has made for enhanced cancer therapy. However, because of the complicated pharmacokinetics of combined drug formulations, the majority of combination strategies show severe adverse effects at high dosage and poor biodistribution in vivo. To overcome these deficiencies and achieve enhanced cancer therapy, we put forward a method to construct a smart albumin-based nanoplatform, denoted as K237-HSA-DC, for codelivery of cyclooxygenase-2 (COX-2) inhibitor (celecoxib) and chemotherapeutic agent (doxorubicin, DOX). Both in vitro and in vivo studies indicate that K237-HSA-DC exhibits the best therapeutic efficacy on tumor cells compared with all the other formulations. Moreover, K237-HSA-DC shows fewer side effects on normal organs in contrast to other formulations. To understand the reasons behind the improved drug efficacy in depth, we performed a cell metabonomics-based mechanism study and found that celecoxib could enhance the inhibitory effect of DOX on the transport of glucose into cells and then lead to subsequent significant energy metabolism inhibition. Considering the above-mentioned advantages of K237-HSA-DC, we believe the smart albumin-based nanoplatform can serve as a promising drug delivery system for enhanced cancer therapy.

  6. Aspects of 238Pu production in the experimental fast reactor JOYO

    International Nuclear Information System (INIS)

    Osaka, Masahiko; Koyama, Shin-ichi; Tanaka, Kenya; Itoh, Masahiko; Saito, Masaki

    2005-01-01

    Experimental determination of 238 Pu in 237 Np samples irradiated in the experimental fast reactor JOYO was done as part of the demonstration of 238 Pu production from 237 Np in fast reactors within the framework of the protected Pu production project, which aims at reinforcement of proliferation resistance of Pu by increasing the 238 Pu isotopic ratio. 238 Pu production amount in the irradiated 237 Np samples was determined by a radioanalytical technique. Aspects of 238 Pu production were examined on the basis of the present radioanalysis. The 238 Pu production amount depends on the neutron spectrum which can range from that of a typical fast reactor to a nearly epi-thermal spectrum. It is concluded that the fast reactor has not only high potential for use in protected Pu production, but also as an incinerator for excess Pu

  7. Serosurveillance of Scrub Typhus in Small Mammals Collected from Military Training Sites near the DMZ, Northern Gyeonggi-do, Korea, and Analysis of the Relative Abundance of Chiggers from Mammals Examined

    Science.gov (United States)

    2010-09-01

    Korean J Paras/to/. Vol. 48, No. 3: 237-243, September 2010 DOl: JO.J3471kjp.2010.48.J.237 Serosurveillance of Scrub Typhus in Small Mammals...65th Medical BrigadeAJSAMEDDAC-Korea, Unit# 15281, APO AP 96205-5281, USA Abstract: Comprehensive quarterly serosurveillance on scrub typhus in small...rarely observed (prevalence < 1 0%). In contrast to previous surveys, higher chigger indices of the primary scrub typhus vectors, L. pallidum (165.4

  8. 48 CFR 237.102-72 - Contracts for management services.

    Science.gov (United States)

    2010-10-01

    ... development or production of the major system ensures that Federal employees are responsible for determining— (1) Courses of action to be taken in the best interest of the Government; and (2) Best technical performance for the warfighter; and (c) The contract requires that the prime contractor for the contract may...

  9. 48 CFR 1852.237-73 - Release of sensitive information.

    Science.gov (United States)

    2010-10-01

    ... technology system for NASA that contains sensitive information, the service provider's contract shall include the clause at 1852.204-76, Security Requirements for Unclassified Information Technology Resources. The Security Requirements clause requires the service provider to implement an Information Technology...

  10. All projects related to | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of Tobacco Tax Increases in Latin America. Project. Raising taxes ... Region: North and Central America, South America, Argentina, Bolivia, Brazil, Chile, Colombia, Mexico, Peru. Program: Food, Environment, and Health. Total Funding: ...

  11. Neptunium 237 behaviour in subcellular fractions of rat kidneys

    International Nuclear Information System (INIS)

    Kreslov, V.V.; Maksutova, A.Ya.; Mushkacheva, G.S.

    1978-01-01

    Subcellular distribution of intravenously injected (1 and 0.5 μCi/rat) neptunium nitrate (5- and 6-valent) in kidneys of rat males and females has been investigated. It has been shown that the radionuclide was unevenly distributed within the cell. As early as 24 hours after administration, about 50 per cent of neptunium were concentrated in the mitochondrial fraction. The data are presented on variations in neptunium behaviour within subcellular fractions of rat kidneys depending on the sex of animals, valency and dose of the isotope

  12. 237 Missionary Historiography: A Factor for the Emergence of ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Nmah, P. E. - Department of Religion and Human Relations, Nnamdi ... It is also the identification of a people with the aspirations and interests of their .... edifices where they congregate for worship, and yet cannot say from their ... robot- like worshippers of the prophet Isaiah's description ( Isaiah 29: 13), or.

  13. 48 CFR 1852.237-72 - Access to Sensitive Information.

    Science.gov (United States)

    2010-10-01

    ... position in another procurement. (2) Safeguard sensitive information coming into its possession from... relating to ethics, conflicts of interest, corruption, and other criminal or civil matters relating to the...

  14. 49 CFR 237.71 - Determination of bridge load capacities.

    Science.gov (United States)

    2010-10-01

    ... capacity shall be determined. (g) Bridge load capacity may be expressed in terms of numerical values related to a standard system of bridge loads, but shall in any case be stated in terms of weight and...) Bridge load capacity may be expressed in terms of both normal and maximum load conditions. Operation of...

  15. 48 CFR 1552.237-70 - Contract publication review procedures.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract publication review... journal article to the Project Officer, and one copy to the Contracting Officer. (d) If the Government has... AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses...

  16. Situation Desperate: U.S. Army Engineer Disaster Relief Operations, Origins to 1950

    Science.gov (United States)

    2011-01-01

    the Sabine River sub- office, for example, relayed the following sad report to headquarters: “I regret to report the loss of all property in my...doctor with typhoid vaccine ; the cows and horses and dogs of every description wandering up and down the levees; the fur- niture, every kind of...215 Sabine River, 59 Sacramento Engineer District, 237, 238 Sacramento River, 186, 237 St. Francis River, 85, 87 St. Joe River, 217 St. Louis Engineer

  17. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 4, (Allenville, Missouri-Wyoming, Pennsylvania).

    Science.gov (United States)

    1984-01-01

    CLOSED CIRCUIT TV CORP 26 26INGERSOLL-RAND COMPANY INC 67 67INSTITUTE FOR ADVANCED STUDY 75 75 INTERNATIONAL BUSINESS MCHS 28 28M L ENERGIA INC 30...I 28 PRINCETON E 0 & 0 PARC 28 IBM CORP 25 25 M L ENERGIA INC 107 107 SAN LUIS CAMERA 41 41...SANDERS ASSOCIATES INC 848 848 SATELLITE SERVICES INC 237 237 SCHICKEL H GEN CONTR INC 132 132 SHERLOT HOME RENOVATION CORP 317 317 TRACY TROMBLEY CONT

  18. Analysis of trace neptunium in the vicinity of underground nuclear tests at the Nevada National Security Site.

    Science.gov (United States)

    Zhao, P; Tinnacher, R M; Zavarin, M; Kersting, A B

    2014-11-01

    A high sensitivity analytical method for (237)Np analysis was developed and applied to groundwater samples from the Nevada National Security Site (NNSS) using short-lived (239)Np as a yield tracer and HR magnetic sector ICP-MS. The (237)Np concentrations in the vicinity of the Almendro, Cambric, Dalhart, Cheshire, and Chancellor underground nuclear test locations range from nuclear tests at very low but measureable concentrations. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  19. Solvent extraction of irradiated neptunium targets. I. Valence stabilization

    International Nuclear Information System (INIS)

    Thompson, G.H.; Thompson, M.C.

    1977-01-01

    Solvent extraction of 237 Np and 238 Pu from irradiated neptunium is being investigated as a possible replacement for the currently used anion exchange process at the Savannah River Plant. Solvent extraction would reduce separations costs and waste volume and increase the production rate. The major difficulty in solvent extraction processing is maintaining neptunium and plutonium in the extractable IV or VI valence states during initial extraction. This study investigated the stability of these states. Results show that: The extractable M(IV) valence states of neptunium and plutonium are mutually unstable in plant dissolver solution (2 g/l 237 Np, 0.4 g/l 238 Pu, 1.2M Al 3+ , 4.6M NO 3 - , and 1M H + ). The reaction rates producing inextractable species from extractable M(IV) or M(VI) are fast enough that greater than or equal to 99.9 percent extractable species in 237 Np-- 238 Pu mixtures cannot be maintained for a practicable processing period

  20. Selective localization of neptunium-237 in the nuclei of mammalian cells. Localisation selective du neptunium-237 au sein des noyaux des cellules de mammiferes

    Energy Technology Data Exchange (ETDEWEB)

    Galle, P.; Boulahdour, H. (Faculte de Medecine, 94 - Creteil (FR)); Metivier, H. (CEA Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (FR). Inst. de Protection et de Surete Nucleaire)

    1992-01-01

    After injection in the rat of soluble neptunium salt, the distribution of this element was studied at the subcellular level by electron microscopy and electron probe microanalysis. Abnormal structures have been observed by electron microscopy in the nuclei of hepatocytes, and the same structures have also been observed in the nuclei of the proximal tubules cells of the kidney. These structures are formed of clusters of very small and dense particles, several nanometers in diameter. The clusters are localized in the central part of the nuclei and they are separate from nucleoli and heterochromatin. Electron probe X-ray analysis of this cluster have shown that they contain neptunium associated with phosphorus. In the cell containing neptunium inclusions, other non specific lesions are also observed (nuclear pycnosis, mitochondrial depletion).

  1. Child Pornography. An Exploratory Study

    Science.gov (United States)

    1990-01-01

    The Sexual Exploitation of Children. New York: St Martins Press, 1986. Fields, Howa’-4 "Supreme Court, 6-3, Sans Possossiron of Child Porn ...Court, 6-3, Bans Possession of Child Porn ," Publishers Weekly 237, no.18 (May 4, 1990) 10. 27 See: O’Brien, 65-78; Seth L. Goldstein, "Investigating...15, (1973). 3 New York v. Ferber, 458 U.S. 757, (1982). 4 Howard Fields, "Supreme Court, 6-3, Bans Possession of Child Porn ,’" Publishers Weekly 237

  2. Biology of neptunium

    International Nuclear Information System (INIS)

    Wirth, R.E.

    1985-11-01

    This work contains detailed information about fractional absorption of neptunium through gastrointestinal tract in vivo as well as about organ and subcellular distribution in rats. Biochemical investigations have shown, that neptunium is bound to the iron transport protein transferrin in the blood serum. A long-term experiment resulted in osteosarkomincidences of 11% (0.2 mp Np-237/kg) and 36% (1 mg Np-237/kg); simultaneous the whole-body retention was measured during the natural lifespan of the animals of 2.5 years. (orig.) [de

  3. Transport of neptunium through Yucca Mountain tuffs

    International Nuclear Information System (INIS)

    Triay, I.R.; Robinson, B.A.; Mitchell, A.J.; Overly, C.M.; Lopez, R.M.

    1993-01-01

    Neptunium has a high solubility in groundwaters from Yucca Mountain [1]. Uranium in nuclear reactors produces 237 Np which has a half-life of 2.1 4 x 10 6 years. Consequently, the transport of 237 Np through tuffs is of major importance in assessing the performance of a high-level nuclear waste repository at Yucca Mountain. The objective of this work is to determine the amount of Np retardation that is provided by the minerals in Yucca Mountain tuffs as a function of groundwater chemistry

  4. Experimental Studies on Plutonium Kinetics in Marine Biota

    International Nuclear Information System (INIS)

    Fowler, S.; Heyraud, M.; Beasley, T.M.

    1976-01-01

    Laboratory experiments were undertaken to measure plutonium flux through marine organisms and to clarify the pathways by which this important element is cycled in the marine environment. The use of a specially prepared isotope, plutonium-237, allowed measurements to be made with standard Nal(Tl) scintillation techniques. Mussels, shrimp and worms were allowed to accumulate plutonium-237 from sea water for up to 25 days. Accumulation by shrimp was relatively slow and the degree of uptake was strongly influenced by moulting. Cast moults contained large fractions of the shrimps ' plutonium content, indicating the high affinity of plutonium for surface areas. Only small amounts of the isotope in the moult are lost to water; hence, moulting is considered to be an important biological parameter in the biogeochemical cycling of plutonium. Mussels attained higher concentration factors than shrimp with most of the accumulated isotope (> 80%) located in the shell. Byssus threads often contained large fractions of the mussels' plutonium-237 content and reached concentration factors as high as 4100. Worms readily accumulated plutonium-237 in either the +4 or +6 state, reaching concentration factors of approximately 200, Retention studies indicated a relatively slow loss of plutonium-237 from all animals studied. In the case of mussels, a computed half-time for a large fraction of the animals plutonium content was of the order of 2 years. The more rapid loss from shrimp (Tb 1/2 = 1.5 months) was due principally to the large fraction of plutonium lost at moult. Food chain studies with shrimp indicated that tissue build-up via plutonium ingestion would be a slow process. Total excretion was not entirely a result of passing contaminated food through the gut; approximately 15% of the ingested plutonium was removed from the contaminated food and subsequently excreted by processes other than defaecation of labelled food. Ratios of four different plutonium isotopes used in

  5. Experimental studies on plutonium kinetics in marine biota

    International Nuclear Information System (INIS)

    Fowler, S.; Heyraud, M.; Beasley, T.M.

    1975-01-01

    Laboratory experiments were undertaken to measure plutonium flux through marine organisms and to clarify the pathways by which this important element is cycled in the marine environment. The use of a specially prepared isotope, plutonium-237, allowed measurements to be made with standard NaI(Tl) scintillation techniques. Mussels, shrimp and worms were allowed to accumulate plutonium-237 from seawater for up to 25 days. Accumulation by shrimp was relatively slow and the degree of uptake was strongly influenced by moulting. Cast moults contained large fractions of the shrimps' plutonium content, indicating the high affinity of plutonium for surface areas. Only small amounts of the isotope in the moult are lost to water; hence, moulting is considered to be an important biological parameter in the biogeochemical cycling of plutonium. Mussels attained higher concentration factors than shrimp with most of the accumulated isotope (>80%) located in the shell. Byssus threads often contained large fractions of the mussels' plutonium-237 content and reached concentration factors as high as 4100. Worms readily accumulated plutonium-237 in either the +4 or +6 state, reaching concentration factors of approximately 200. Retention studies indicated a relatively slow loss of plutonium-237 from all animals studied. In the case of mussels, a computed half-time for a large fraction of the animals' plutonium content was of the order of 2 years. The more rapid loss from shrimp (Tbsub(1/2)=1.5 months) was due principally to the large fraction of plutonium lost at moult. Food chain studies with shrimp indicated that tissue build-up via plutonium ingestion would be a slow process. Total excretion was not entirely a result of passing contaminated food through the gut; approximately 15% of the ingested plutonium was removed from the contaminated food and subsequently excreted by processes other than defaecation of labelled food. Ratios of four different plutonium isotopes used in the

  6. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  7. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    Moeser, Christina

    2010-01-01

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  8. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 237 ... Query: 64 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEAD...IVVTGGHTP 123 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEADIVVTGGHTP Sbjct: 1 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHE

  9. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 98 ... Query: 237 IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 296 ... IVAAARDYVLAHRSRP...VGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD Sbjct: 1 ... IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 60 ...

  10. Exploring the Presence of microDNAs in Prostate Cancer Cell Lines, Tissue, and Sera of Prostate Cancer Patients and its Possible Application as Biomarker

    Science.gov (United States)

    2016-04-01

    ES2 OVCAR8 LnCap PC-3 C4-2 Cell Count 1.8X108 1x108 1.1X108 1.24X108 1.1X108 Episomal DNA (ug) 21.3 23.7 26 15.6 20.4 Starting DNA (ug) 21.3 23.7...kidney, liver, lung, skeletal muscle, spleen, sperm , testis and thymus) (5). EccDNA sequences were then enriched by multiple displacement amplification...including sperm . MicroDNAs arise preferentially from areas with high gene density, GC content, and exon density from promoters with activating chro

  11. Source-driven noise analysis measurements with neptunium metal reflected by high enriched uranium

    International Nuclear Information System (INIS)

    Valentine, Timothy E.; Mattingly, John K.

    2003-01-01

    Subcritical noise analysis measurements have been performed with neptunium ( 237 Np) sphere reflected by highly enriched uranium. These measurements were performed at the Los Alamos Critical Experiment Facility in December 2002 to provide an estimate of the subcriticality of 237 Np reflected by various amounts of high-enriched uranium. This paper provides a description of the measurements and presents some preliminary results of the analysis of the measurements. The measured and calculated spectral ratios differ by 15% whereas the 'interpreted' and calculated k eff values differ by approximately 1%. (author)

  12. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 112 ... Query: 237 RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGT...NEYNMRLSI 296 ... RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGTNEYNMRLSI Sbjct: 1 ... RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGTNEYNMRLSI 60 ...

  13. A feasibility study on long-life reduced-moderation water reactor with highly protected Pu breeding by doping with minor actinides

    International Nuclear Information System (INIS)

    Hamase, Erina; Damian, Frederic; Poinot-salanon, Christine; Saito, Masaki; Sagara, Hiroshi; Han, Chi Young

    2013-01-01

    Highlights: ► The present paper is focused on a reduced-moderation water reactor. ►237 Np or 241 Am was doped into the inner blanket. ►238 Pu transmuted from MA works as a fissionable nuclide. ► It also contributes to increasing the proliferation resistance of Pu. ► Long-life core and highly protected Pu breeding were simultaneously achieved. - Abstract: The present paper is focused on the feasibility of reduced-moderation water reactor (RMWR) which could simultaneously achieve the extension of core life-time, and highly protected plutonium (Pu) breeding performance with short compound system doubling time (CSDT) by neptunium-237 ( 237 Np) or americium-241 ( 241 Am) doping of the inner blanket of the RMWR. As a preliminary analysis of the RMWR, a simplified fuel pin configuration was analyzed. In case of 60% doping of 237 Np and 241 Am in the inner blanket, the maximum available effective full power days (EFPDs) were much longer and were about 15,100 and 14,200 EFPDs, respectively. For the proliferation resistance of Pu produced in the blanket, the total Pu in the inner and lower/upper blanket was below the practically unusable criterion for an explosive device proposed by Pellaud, and was technically unfeasible for high-technology hypothetical nuclear explosive devices (HNEDs) proposed by Kessler and Kimura. The protected Pu breeding performance was analyzed and in case of 60% doping of 237 Np and 241 Am, CSDT was short by approximately 40 and 50 years. Therefore, the feasibility of RMWR was shown which could simultaneously achieve the extension of core life-time and have highly protected Pu breeding performance with short CSDT by doping the inner blanket with minor actinides (MAs). The objective of this study was thus to evaluate the performance of the concept with respect to the core life-time, proliferation resistance of Pu and CSDT. The technological feasibility of such core concept will have to be evaluated by further dedicated analyses

  14. 48 CFR 252.237-7013 - Instruction to offerors (bulk weight).

    Science.gov (United States)

    2010-10-01

    ...) Offers shall be submitted on a unit price per pound of serviced laundry. Unit prices shall include all costs to the Government of providing the service, including pickup and delivery charges. (b) The Contracting Officer will evaluate bids based on the estimated pounds of serviced laundry stated in the...

  15. 48 CFR 252.237-7023 - Continuation of Essential Contractor Services.

    Science.gov (United States)

    2010-10-01

    ... provide a written plan for continuing the performance of essential contractor services identified in...; and (v) The approach for communicating expectations to contractor employees regarding their roles and... or other designated representative as expeditiously as possible and use its best efforts to cooperate...

  16. 48 CFR 52.237-4 - Payment by Government to Contractor.

    Science.gov (United States)

    2010-10-01

    ... Officer shall retain 10 percent of the estimated payment until final completion and acceptance of the... full, without retaining a percentage. Also, on completion and acceptance of each unit or division for which the price is stated separately, the Contracting Officer may authorize full payment for that unit...

  17. 237 Impacts socio-sanitaires et environnementaux de la gestion des ...

    African Journals Online (AJOL)

    SWEET

    pollution des eaux, érosion des berges des mayo et alluvionnement des drains, amènent à suggérer des ... D'après TUCCI [1], les principaux défis de la gestion des inondations sont liés à l'occupation des ... populations aux impacts des inondations de plaine est due, d'après TUCCI [1], au manque de connaissance.

  18. 237 Interrogating Nollywood and its Sources of Funding: The Case ...

    African Journals Online (AJOL)

    The problem of funding continues to haunt start-ups in Africa and there seems to be ... hospitality business where funding, which catalyses the efforts of independent ..... find her testimony too easy, but Emem Isong made the above statement in ...

  19. P2-37: Processing Affordance Information from Invisible Tool Images

    Directory of Open Access Journals (Sweden)

    Shinho Cho

    2012-10-01

    Full Text Available A recent study showed that viewing manipulable objects such as images of tools induces the neural activation of posterior parietal areas. This neural activation is observed even when visual awareness of the image is visually suppressed. (Fang and He, 2005 Nature Neuroscience 10 1380–1385; Almeida et al, 2010 Psychological Science 21 772–778. However, the specific visuomotor information in tool images that drives the activation of dorsal areas is still unclear. We measured priming effect of invisible tool prime (left or right handed orientation. Observers distinguished the orientation of target tools (appropriate for left vs right handed grip briefly presented following visually suppressed primes (Experiment1. Also we measured the suppression time of tool images whose handle direction was presented in a left- or right-handed orientation. A dynamic noise pattern was presented to one of the observer's eyes at full contrast, while images of tools (left or right handed were simultaneously presented to the left or right visual field of the other eye. The subjects were asked to respond to the appearance of any partial or full part of the test image (Experiment 2. Results showed that (1 observers responded faster in the congruent condition (the same orientation between prime and target and (2 tool images shown in the right visual field took less time to gain dominance against the dynamic noise. These results suggest that even without overt recognition of presented tools, an object's affordance can be registered and processed in the brain. A recent study showed that viewing manipulable objects such as images of tools induces the neural activation of posterior parietal areas. This neural activation is observed even when visual awareness of the image is visually suppressed (Almeida et al., 2010 Psychological Science 21 772–778; Fang and He, 2005 Nature Neuroscience 10 1380–1385. However, the specific visuomotor information in tool images that drives the activation of dorsal areas is still unclear. We measured the priming effect of invisible tool prime (left or right handed orientation. Observers distinguished the orientation of target tools (appropriate for left vs. right handed grip briefly presented following visually suppressed primes (Experiment 1. Also we measured the suppression time of tool images whose handle direction was presented in a left- or right-handed orientation. A dynamic noise pattern was presented to one of the observer's eyes at full contrast, while images of tools (left or right handed were simultaneously presented to the left or right visual field of the other eye. The subjects were asked to respond to the appearance of any partial or full part of the test image (Experiment 2. Results showed that (1 observers responded faster in the congruent condition (the same orientation between prime and target and (2 tool images shown in the right visual field took less time to gain dominance against the dynamic noise. These results suggest that even without overt recognition of presented tools, an object's affordance can be registered and processed in the brain.

  20. 48 CFR 252.237-7018 - Special definitions of Government property.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Special definitions of... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT...) Articles delivered to the Contractor to be laundered or dry-cleaned, including any articles which are...

  1. Validation of Cross Sections with Criticality Experiment and Reaction Rates: the Neptunium Case

    CERN Document Server

    Leong, L S; Audouin, L; Berthier, B; Le Naour, C; Stéphan, C; Paradela, C; Tarrío, D; Duran, I

    2014-01-01

    The Np-237 neutron-induced fission cross section has been recently measured in a large energy range (from eV to GeV) at the n\\_TOF facility at CERN. When compared to previous measurements the n\\_TOF fission cross section appears to be higher by 5-7\\% beyond the fission threshold. To check the relevance of the n\\_TOF data, we considered a criticality experiment performed at Los Alamos with a 6 kg sphere of Np-237, surrounded by uranium highly enriched in U-235 so as to approach criticality with fast neutrons. The multiplication factor k(eff) of the calculation is in better agreement with the experiment when we replace the ENDF/B-VII. 0 evaluation of the Np-237 fission cross section by the n\\_TOF data. We also explored the hypothesis of deficiencies of the inelastic cross section in U-235 which has been invoked by some authors to explain the deviation of 750 pcm. The large modification needed to reduce the deviation seems to be incompatible with existing inelastic cross section measurements. Also we show that t...

  2. Laser ablation of silicate glasses doped with transuranic actinides

    International Nuclear Information System (INIS)

    Gibson, J.K.; Haire, R.G.

    1998-01-01

    Direct sampling laser ablation plasma mass spectrometry (DS-LAMS) was applied to silica glasses doped with 237 Np, 242 Pu or 241 Am using a unique instrument recently installed into a transuranic glovebox. The primary goal was to assess the utility of mass spectrometry of directly ablated ions for facile evaluation of actinide (An) constituents of silicate glass immobilization matrices used for encapsulation of radionuclides. The instrument and general procedures have been described elsewhere. Three high-purity silicate glasses prepared by a sol-gel process (SG) and one conventional high-temperature (HT; melting point ∼ 1,450 C) borosilicate glass were studied. These glasses comprised the following constituents, with compositions expressed in mass percentages: Np-HT ∼ 30% SiO 2 + 6% B 2 O 3 + 3% BaO + 13% Al 2 O 3 + 10% PbO + 30% La 2 O 3 + 8% 237 NpO 2 ; Np-SG ∼ 70% SiO 2 + 30% 237 NpO 2 ; Pu-SG ∼ 70% SiO 2 + 30% 242 PuO 2 ; Am-SG ∼ 85% SiO 2 + 15% 241 AmO 2

  3. Perceptions of preclinical medical students towards extracurricular activities.

    Science.gov (United States)

    Almasry, Mazen; Kayali, Zeina; Alsaad, Rakan; Alhayaza, Ghada; Ahmad, Mohammad Sharique; Obeidat, Akef; Abu-Zaid, Ahmed

    2017-08-16

    To determine the percentage of students involved in extracurricular activities (EAs), explore relationships between participation in EAs and students' characteristics, and investigate students' perceptions (i.e., motives and barriers) towards participation in EAs. An online, anonymous, random, cross-sectional, self-rating survey was administered during spring 2015-2016 to second-year and third-year students (n=340). Chi-square test was used to explore relationships between participation in EAs and students' characteristics. Mann-Whitney U-test was used to compare the mean 5-point Likert scale responses according to students' characteristics. Statistical significance was determined as pstudents participated in the survey (n=237/340, response rate: 69.7%). Only 143 students (60.3%, n=140/237) participated in EAs, and this percentage significantly differed by gender (χ 2 (1, N=237)=4.3205, pstudents regarding the following barrier: "affect academic performance negatively" (U=5389.5, psatisfactory, and positively related to students' characteristics of male gender, non-Saudi nationality and high cGPA. Medical schools should facilitate all potential motives and resolve all associated barriers towards participation in EAs.

  4. High-sensitivity fast neutron detector KNK-2-7M

    Energy Technology Data Exchange (ETDEWEB)

    Koshelev, A. S., E-mail: alexsander.coshelev@yandex.ru; Dovbysh, L. Ye.; Ovchinnikov, M. A.; Pikulina, G. N.; Drozdov, Yu. M. [Russian Federal Nuclear Center All-Russian Research Institute of Experimental Physics (Russian Federation); Chuklyaev, S. V. [Research Institute of Materials Technology (Russian Federation)

    2015-12-15

    The construction of the fast neutron detector KNK-2-7M is briefly described. The results of the study of the detector in the pulse-counting mode are given for the fissions of {sup 237}Np nuclei in the radiator of the neutron-sensitive section and in the current mode with the separation of sectional currents of functional sections. The possibilities of determining the effective number of {sup 237}Np nuclei in the radiator of the neutronsensitive section are considered. The diagnostic possibilities of the detector in the counting mode are shown by example of the analysis of the reference data from the neutron-field characteristics in the working hall of the BR-K1 reactor. The diagnostic possibilities of the detector in the current operating mode are shown by example of the results of measuring the {sup 237}Np-fission intensity in the BR-K1 reactor power start-ups implemented in the mode of fission-pulse generation on delayed neutrons at the detector arrangement inside the reactor core cavity under conditions of a wide variation of the reactor radiation field.

  5. Development and validation of RP-HPLC and UV-spectrophotometric methods for rapid simultaneous estimation of amlodipine and benazepril in pure and fixed dose combination

    Directory of Open Access Journals (Sweden)

    Abhi Kavathia

    2017-05-01

    Full Text Available High-performance liquid chromatographic (HPLC and UV spectrophotometric methods were developed and validated for the quantitative determination of amlodipine besylate (AM and benazepril hydrochloride (BZ. Different analytical performance parameters such as linearity, precision, accuracy, specificity, limit of detection (LOD and limit of quantification (LOQ were determined according to International Conference on Harmonization ICH Q2B guidelines. The RP-HPLC method was developed by the isocratic technique on a reversed-phase Shodex C-18 5e column. The retention time for AM and BZ was 4.43 min and 5.70 min respectively. The UV spectrophotometric determinations were performed at 237 nm and 366 nm for AM and at 237 nm for BZ. Correlation between absorbance of AM at 237 nm and 366 nm was established and based on developed correlation equation estimation of BZ at 237 nm was carried out. The linearity of the calibration curves for each analyte in the desired concentration range was good (r2 > 0.999 by both the HPLC and UV methods. The method showed good reproducibility and recovery with percent relative standard deviation less than 5%. Moreover, the accuracy and precision obtained with HPLC co-related well with the UV method which implied that UV spectroscopy can be a cheap, reliable and less time consuming alternative for chromatographic analysis. The proposed methods are highly sensitive, precise and accurate and hence successfully applied for determining the assay and in vitro dissolution of a marketed formulation.

  6. Non-conventional measurement techniques for the determination of some long-lived radionuclides produced in nuclear fuel

    International Nuclear Information System (INIS)

    Rosenberg, R.J.

    1992-04-01

    The results of a literature survey on non-radiometric analytical techniques for the determination of long-lived radionuclides are described. The methods which have been considered are accelerator mass spectrometry, inductively coupled plasma mass spectrometry, thermal ionization mass spectrometry, resonance ionization spectrometry, resonance ionization mass spectrometry and neutron activation analysis. Neutron activation analysis has been commonly used for the determination of 129 I and 237 Np in environmental samples. Inductively coupled mass spectrometry seems likely to become the method of choice for the determination of 99 Tc, 237 Np and Pu-isotopes. The methods are discussed and the chemical separation methods described. (orig.)

  7. Contribution to the experimental study of transuranian element (Pu, Am, Cm) transfers between the various phases (particles, water, organisms) of the sedimentary system

    International Nuclear Information System (INIS)

    Grillo, M.C.

    1982-06-01

    The methodology of this work is first given. Transfer kinetics of 237 Pu, 241 Am and 242 Cm between seawater and macrofauna of loose substrates are studied. The effect of temperature and salinity over the transfers of 237 Pu, 241 Am and 242 Cm between water and bivalve mollusk Tapes decussatus is then studied. This work deals also with transfer kinetics of these elements between carnivorous organisms of the loose substrates and their preys. A preliminary study of 241 Am transfers between two phases, particles and interstitial water is finally presented: role of benthic burrowing organisms [fr

  8. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available kinase ... [Bacillus cereus ATCC 14579] ... Length = 81 ... Query: 237 MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT 296 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT Sbjct: 1 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLT 60 ...

  9. Radioactivity studies. Progress report, January 1-December 31, 1982

    International Nuclear Information System (INIS)

    Cohen, N.

    1983-06-01

    During the last year, the research program in actinide biokinetics in nonhuman primates has been expanded to include preliminary studies of the element neptunium. Recently, Np-237, which is known to be present in high-level nuclear reactor waste, has received increased attention as a potential long-range hazard to man. In addition to the neptunium studies, the metabolism of protactinium-233, the daughter of Np-237, has been investigated. Although characterization of Pa-233 metabolism was originally conducted in order to correct for Pa-233 interference during in vivo and in vitro gamma spectrometry of Np-237, several other considerations indicated that Pa might be of radiological concern itself and should thereby warrant further investigation. Due to the limited amount of data in the literature defining the biokinetics of both neptunium and protactinium, metabolis studies of these nuclides are now being conducted in adult female baboons in a manner similar to that which has been successfully performed at this laboratory for Am-241 and Cm-243,244. Procedures routinely performed include external whole-body counting, excreta collection (separation and measurement), blood sampling, biopsies of liver and bone, and complete tissue and organ analysis after sacrifice

  10. Over-expression of p53 mutants in LNCaP cells alters tumor growth and angiogenesis in vivo

    International Nuclear Information System (INIS)

    Perryman, L.A.; Blair, J.M.; Kingsley, E.A.; Szymanska, B.; Ow, K.T.; Wen, V.W.; MacKenzie, K.L.; Vermeulen, P.B.; Jackson, P.; Russell, P.J.

    2006-01-01

    This study has investigated the impact of three specific dominant-negative p53 mutants (F134L, M237L, and R273H) on tumorigenesis by LNCaP prostate cancer cells. Mutant p53 proteins were associated with an increased subcutaneous 'take rate' in NOD-SCID mice, and increased production of PSA. Tumors expressing F134L and R273H grew slower than controls, and were associated with decreased necrosis and apoptosis, but not hypoxia. Interestingly, hypoxia levels were increased in tumors expressing M237L. There was less proliferation in F134L-bearing tumors compared to control, but this was not statistically significant. Angiogenesis was decreased in tumors expressing F134L and R273H compared with M237L, or controls. Conditioned medium from F134L tumors inhibited growth of normal human umbilical-vein endothelial cells but not telomerase-immortalized bone marrow endothelial cells. F134L tumor supernatants showed lower levels of VEGF and endostatin compared with supernatants from tumors expressing other mutants. Our results support the possibility that decreased angiogenesis might account for reduced growth rate of tumor cells expressing the F134L p53 mutation

  11. Hemoglobinopathies in newborns from Salvador, Bahia, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    Adorno Elisângela Vitória

    2005-01-01

    Full Text Available Hemoglobinopathies are hereditary disorders of the hemoglobin molecule with a high prevalence worldwide. Brazil has a prevalence of 0.1 to 0.3% of newborns with sickle cell anemia and 20.0 to 25.0% of heterozygous alpha2 thalassemia among African Brazilians. In the present study, we investigated the presence of variant hemoglobins and alpha2(3.7 Kb and alpha2(4.2 Kb thalassemia in newborns from Salvador, Bahia, Brazil. Samples of umbilical cord blood from a total of 590 newborns were analyzed, of which 57 (9.8% were FAS; 36 (6.5% FAC; one (0.2% SF; and five (0.9% FSC. One hundred fourteen (22.2% newborns had alpha2(3.7 Kb thalassemia, of whom 101 (19.7% were heterozygous and 13 (2.5% homozygous, showing statistical significance for hematological data between newborns with normal alpha genes and alpha2(3.7 Kb thalassemia carriers. The alpha2(4.2 Kb thalassemia was not found. Frequencies found in the present study confirm that hemoglobinopathies are a public health problem in Brazil, emphasizing the need for neonatal screening and genetic counseling programs.

  12. A single nucleotide in stem loop II of 5'-untranslated region contributes to virulence of enterovirus 71 in mice.

    Directory of Open Access Journals (Sweden)

    Ming-Te Yeh

    Full Text Available BACKGROUND: Enterovirus 71 (EV71 has emerged as a neuroinvasive virus responsible for several large outbreaks in the Asia-Pacific region while virulence determinant remains unexplored. PRINCIPAL FINDINGS: In this report, we investigated increased virulence of unadapted EV71 clinical isolate 237 as compared with isolate 4643 in mice. A fragment 12 nucleotides in length in stem loop (SL II of 237 5'-untranslated region (UTR visibly reduced survival time and rate in mice was identified by constructing a series of infectious clones harboring chimeric 5'-UTR. In cells transfected with bicistronic plasmids, and replicon RNAs, the 12-nt fragment of isolate 237 enhanced translational activities and accelerated replication of subgenomic EV71. Finally, single nucleotide change from cytosine to uridine at base 158 in this short fragment of 5'-UTR was proven to reduce viral translation and EV71 virulence in mice. Results collectively indicated a pivotal role of novel virulence determinant C158 on virus translation in vitro and EV71 virulence in vivo. CONCLUSIONS: These results presented the first reported virulence determinant in EV71 5'-UTR and first position discovered from unadapted isolates.

  13. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available kinase ... [Bacillus cereus ATCC 14579] ... Length = 81 ... Query: 237 MRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT 296 ... MRK+LKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT Sbjct: 1 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLT 60 ...

  14. {open_quotes}Transmutation efficiency calculation in the blanket on melted salts with central neptunium target{close_quotes}

    Energy Technology Data Exchange (ETDEWEB)

    Kolesov, V.F.; Shtarev, S.K.; Khoruzhiy, V.K. [Russia Federal Nuclear Center, Arzamas (Russian Federation)] [and others

    1995-10-01

    In the limits of ABC project version of two-sectional reactor system in the form of combination of subcritical blanket on melted salts and multiplying target from threshold fissile material {sup 237}Np is considered. This research is the development of the VNIIEF`s earlier work`s (Russia) investigating of usage possibilities in ABC project the conception of multisectional blankets with single-sided neutron coupling between sections. With the help of Monte-Carlo program the calculations results of system mentioned are given. The possibility of accelerator`s considerable power reduction at the account of thorium target substitution with neptunium-237 multiplying target is shown.

  15. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  18. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  19. 48 CFR 252.237-7015 - Loss or damage (weight of articles).

    Science.gov (United States)

    2010-10-01

    ... shall— (1) Be liable for return of the articles furnished for service under this contract; and (2... in servicing the laundry is ____ percent of the weight recorded on delivery tickets when the laundry...

  20. 48 CFR 237.7204 - Format and clauses for educational service agreements.

    Science.gov (United States)

    2010-10-01

    ... order, official Government order, or other written communication). The (insert type of request, such as, delivery order, official Government order, or other written communication) will contain the number of this... completion. (j) “Curriculum” means a series of courses having a unified purpose and belonging primarily to...

  1. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 237

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...

  2. 27 CFR 19.237 - Disapproval of bonds or consents of surety.

    Science.gov (United States)

    2010-04-01

    ..., prohibiting the manufacture, sale, importation, or transportation of spirits, wine, beer, or other... States, if such provision related to internal revenue or customs taxation of spirits, wines, or beer, or...

  3. 48 CFR 252.237-7000 - Notice of special standards of responsibility.

    Science.gov (United States)

    2010-10-01

    ..., of “Government Auditing Standards.” (1) Qualifications; (2) Independence; and (3) Quality Control. (b) “Government Auditing Standards” is issued by the Comptroller General of the United States and is available for... Contracting Officer evidence that it is licensed by the cognizant licensing authority in the state or other...

  4. 48 CFR 52.237-11 - Accepting and Dispensing of $1 Coin.

    Science.gov (United States)

    2010-10-01

    ... REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and... premises owned by the United States or under the control of any agency or instrumentality of the United...

  5. Coffee consumption and risk of incident gout in women: the Nurses' Health Study.

    Science.gov (United States)

    Choi, Hyon K; Curhan, Gary

    2010-10-01

    Coffee is one of the most widely consumed beverages in the world and may affect the risk of gout via various mechanisms, but prospective data on the relation between coffee intake and the risk of incident gout are limited. Over a 26-y period, we prospectively examined the relation between coffee intake and risk of incident gout in 89,433 female participants in the Nurses' Health Study. We assessed the consumption of coffee, decaffeinated coffee, tea, and total caffeine in participants every 2-4 y through validated questionnaires. We used a supplementary questionnaire to ascertain whether participants met the survey criteria of the American College of Rheumatology for gout. During the 26 y of follow-up, we documented 896 confirmed incident cases of gout. There was an inverse association between higher coffee intake and the risk of gout. The multivariate relative risks (RRs) for incident gout according to coffee-consumption categories [ie, 0, 1-237, 238-947, and ≥948 mL coffee/d (237 mL = one 8-ounce cup)] were 1.00, 0.97, 0.78 (95% CI: 0.64, 0.95), and 0.43 (95% CI: 0.30, 0.61; P for trend coffee, the multivariate RRs according to consumption categories (0, 1-237, and ≥237 mL decaffeinated coffee/d) were 1.00, 1.02, and 0.77 (95% CI: 0.63, 0.95; P for trend = 0.02), respectively. There was an inverse association between total caffeine from all sources and the risk of gout; the multivariate RR of the highest quintile compared with the lowest quintile was 0.52 (95% CI: 0.41, 0.68; P for trend coffee consumption is associated with a lower risk of incident gout in women.

  6. Experimental study on neptunium migration under in situ geochemical conditions

    Science.gov (United States)

    Kumata, M.; Vandergraaf, T. T.

    1998-12-01

    Results are reported for migration experiments performed with Np under in situ geochemical conditions over a range of groundwater flow rates in columns of crushed rock in a specially designed facility at the 240-level of the Underground Research Laboratory (URL) near Pinawa, Manitoba, Canada. This laboratory is situated in an intrusive granitic rock formation, the Lac du Bonnet batholith. Highly altered granitic rock and groundwater were obtained from a major subhorizontal fracture zone at a depth of 250 m in the URL. The granite was wet-crushed and wet-sieved with groundwater from this fracture zone. The 180-850-μm size fraction was selected and packed in 20-cm long, 2.54-cm in diameter Teflon™-lined stainless steel columns. Approximately 30-ml vols of groundwater containing 3HHO and 237Np were injected into the columns at flow rates of 0.3, 1, and 3 ml/h, followed by elution with groundwater, obtained from the subhorizontal fracture, at the same flow rates, for a period of 95 days. Elution profiles for 3HHO were obtained, but no 237Np was detected in the eluted groundwater. After terminating the migration experiments, the columns were frozen, the column material was removed and cut into twenty 1-cm thick sections and each section was analyzed by gamma spectrometry. Profiles of 237Np were obtained for the three columns. A one-dimensional transport model was fitted to the 3HHO breakthrough curves to obtain flow parameters for this experiment. These flow parameters were in turn applied to the 237Np concentration profiles in the columns to produce sorption and dispersion coefficients for Np. The results show a strong dependence of retardation factors ( Rf) on flow rate. The decrease in the retarded velocity of the neptunium ( Vn) varied over one order of magnitude under the geochemical conditions for these experiments.

  7. Partial neutron capture cross sections of actinides using cold neutron prompt gamma activation analysis

    International Nuclear Information System (INIS)

    Genreith, Christoph

    2015-01-01

    Nuclear waste needs to be characterized for its safe handling and storage. In particular long-lived actinides render the waste characterization challenging. The results described in this thesis demonstrate that Prompt Gamma Neutron Activation Analysis (PGAA) with cold neutrons is a reliable tool for the non-destructive analysis of actinides. Nuclear data required for an accurate identification and quantification of actinides was acquired. Therefore, a sample design suitable for accurate and precise measurements of prompt γ-ray energies and partial cross sections of long-lived actinides at existing PGAA facilities was presented. Using the developed sample design the fundamental prompt γ-ray data on 237 Np, 241 Am and 242 Pu were measured. The data were validated by repetitive analysis of different samples at two individual irradiation and counting facilities - the BRR in Budapest and the FRM II in Garching near Munich. Employing cold neutrons, resonance neutron capture by low energetic resonances was avoided during the experiments. This is an improvement over older neutron activation based works at thermal reactor neutron energies. 152 prompt γ-rays of 237 Np were identified, as well as 19 of 241 Am, and 127 prompt γ-rays of 242 Pu. In all cases, both high and lower energetic prompt γ-rays were identified. The most intense line of 237 Np was observed at an energy of E γ =182.82(10) keV associated with a partial capture cross section of σ γ =22.06(39) b. The most intense prompt γ-ray lines of 241 Am and of 242 Pu were observed at E γ =154.72(7) keV with σ γ =72.80(252) b and E γ =287.69(8) keV with σ γ =7.07(12) b, respectively. The measurements described in this thesis provide the first reported quantifications on partial radiative capture cross sections for 237 Np, 241 Am and 242 Pu measured simultaneously over the large energy range from 45 keV to 12 MeV. Detailed uncertainty assessments were performed and the validity of the given uncertainties was

  8. Study of extraction chromatography methods of separation of neptunium and its radiometric determination

    International Nuclear Information System (INIS)

    Reich, M.

    2009-04-01

    In presented dissertation thesis the separation procedure for determination of neptunium in model solutions and also in soil samples was designed. 1. The sorbent was prepared on basis of hydrophobised silica gel with silica oil for hydrophobisation - Lukooil H. Extraction agent was anchored on this modified surface -quarternary ammonium salt Aliquat 336. In experiments was proved, that sorbent prepared like this is resist enough to the elution solutions using in separation procedures. It was found out that maximal concentration of deposited Aliquat 336 in benzene on hydrophobised silica gel selected granulate size is 40%. Sorbent prepared with silica gel lower granulate size and also with higher concentration of Aliquat 336 in benzene became sticky and unsuitable for using in separation columns. 2. The prepared sorbent is similar to commercial produced TEVA resin made by company Eichrom and for purpose of this project it was cheaper but the same effective alternative in comparing to mentioned commercial resin. 3. The separation procedure for isolation of 237 Np from radionuclides interfering during its radiometric determination with alpha spectrometry was designed -in scientific publications hasn't been described yet. The procedure consists of using formic acid for reduction of radionuclides interfering by alpha spectrometric determination of 237 Np and subsequent purification of neptunium on the next column by using ferrous sulphamate as reduction agent. This procedure was applied to the model solutions and also to the soil samples. The model solutions and soil samples for these experiments were contaminated with known amounts of 237 Np, 238 pU, 232 Th and mixture of 234 U/ 238 U. The effective separation of neptunium from described radionuclides was achieved with application of the described separation procedure. 4. The separation procedure for separation of 239 Np from its mother radionuclide 241 Am was designed with prepared sorbent. Different washing and

  9. Fission fragment angular distributions and fission cross section validation

    International Nuclear Information System (INIS)

    Leong, Lou Sai

    2013-01-01

    The present knowledge of angular distributions of neutron-induced fission is limited to a maximal energy of 15 MeV, with large discrepancies around 14 MeV. Only 238 U and 232 Th have been investigated up to 100 MeV in a single experiment. The n-TOF Collaboration performed the fission cross section measurement of several actinides ( 232 Th, 235 U, 238 U, 234 U, 237 Np) at the n-TOF facility using an experimental set-up made of Parallel Plate Avalanche Counters (PPAC), extending the energy domain of the incident neutron above hundreds of MeV. The method based on the detection of the 2 fragments in coincidence allowed to clearly disentangle the fission reactions among other types of reactions occurring in the spallation domain. I will show the methods we used to reconstruct the full angular resolution by the tracking of fission fragments. Below 10 MeV our results are consistent with existing data. For example in the case of 232 Th, below 10 MeV the results show clearly the variation occurring at the first (1 MeV) and second (7 MeV) chance fission, corresponding to transition states of given J and K (total spin and its projection on the fission axis), and a much more accurate energy dependence at the 3. chance threshold (14 MeV) has been obtained. In the spallation domain, above 30 MeV we confirm the high anisotropy revealed in 232 Th by the single existing data set. I'll discuss the implications of this finding, related to the low anisotropy exhibited in proton-induced fission. I also explore the critical experiments which is valuable checks of nuclear data. The 237 Np neutron-induced fission cross section has recently been measured in a large energy range (from eV to GeV) at the n-TOF facility at CERN. When compared to previous measurements, the n-TOF fission cross section appears to be higher by 5-7 % beyond the fission threshold. To check the relevance of n-TOF data, we simulate a criticality experiment performed at Los Alamos with a 6 kg sphere of 237 Np. This

  10. Woods-Saxon potential parametrization at large deformations for plutonium odd isotopes

    International Nuclear Information System (INIS)

    Garcia, F.; Garrote, E.; Yoneama, M.L.; Arruda-Neto, J.D.T.; Mesa, J.; Bringas, F.; Likhachev, V.P.; Rodriguez, O.; Guzman, F.

    1999-01-01

    The structure of single-particle levels in the second minima of 237,239,241 Pu was analyzed with the help of an axially-deformed Woods-Saxon potential. The nuclear shape was parametrized in terms of the cassinian ovaloids. A parametrization of the spin-orbit part of the potential was obtained in the region corresponding to large deformations (second minimum), depending only on the nuclear surface area. With this parametrization, we were able to reproduce successfully the spin, parity and energies of the rotational band built on the 8 μ s isomeric state in 239 Pu and, also, a spin assignment for both isomeric states in 237 Pu and 241 Pu was carried out. (orig.)

  11. Nuclear data for innovative reactors having persistent resistance to nuclear proliferation

    International Nuclear Information System (INIS)

    Yoshida, Tadashi; Hagura, Naoto; Toshinsky, Vladimir; Saito, Masaki

    2005-01-01

    The Protected Plutonium Production (P 3 ) project has been initiated in order to realize the proliferation-resistant plutonium. The first stage of this project is based on the idea to protect plutonium by 238 Pu generated from 237 Np doped in the fresh uranium fuel. Along with the burnup going on, the doped 237 Np is transmuted via 238 Np to 238 Pu, which is the intense neutron source of spontaneous fission (2.6x10 3 n/g/s). These neutrons will deteriorate the quality of the plutonium as the nuclear explosive material. In addition, high alpha-decay heat of 238 Pu (560 W/kg) makes the processes of the explosive fabrication and its maintenance technologically difficult. In this background we surveyed the status of nuclear data relevant to the P 3 -concept reactor design. The reliability of the capture cross section data for 237 Np and 238 Pu are far from satisfactory and more accurate experiments and evaluations are required. As fissions in these nuclides do not always play any decisive role in the P 3 concept LWR, we can be fairly tolerable about the uncertainty of the fission cross section data, but further study is needed. (author)

  12. Measurement of fast neutron induced fission cross section of minor-actinide

    International Nuclear Information System (INIS)

    Hirakawa, Naohiro

    1997-03-01

    In fuel cycles with recycled actinide, core characteristics are largely influenced by minor actinide (MA: Np, Am, Cm). Accurate nuclear data of MA such as fission cross section are required to estimate the effect of MA with high accuracy. In this study, fast neutron induced fission cross section of MA is measured using Dynamitron Accelerator in Tohoku University. The experimental method and the samples, which were developed or introduced during the last year, were improved in this fiscal year: (1) Development of a sealed fission chamber, (2) Intensification of Li neutron target, (3) Improvement of time-resolution of Time-of-Flight (TOF) electronic circuit, (4) Introduction of Np237 samples with large sample mass and (5) Introduction of a U235 sample with high purity. Using these improved tools and samples, the fission cross section ratio of Np237 relative to U235 was measured between 5 to 100 keV, and the fission cross section of Np237 was deduced. On the other hand, samples of Am241 and Am243 were obtained from Japan Atomic Energy Research Institute (JAERI) after investigating fission cross section of two americium isotopes (Am241 and Am 243) which are important for core physics calculation of fast reactors. (author)

  13. Effect of time dependence of neutron flux on the plutonium 238 production

    International Nuclear Information System (INIS)

    Rudik, A.P.

    1975-01-01

    An analytical treatment is given of the dependence of a plutonium-238 yield when irradiating neptunium-237 on the time variation of the neutron flux. This dependence is governed by the two physical factors: the competition between the beta decay and the neptunium-238 depletion, and the differences in the depletion rate of neptunium-237, neptunium-238 and plutonium-238 with thermal and resonance neutrons. The role of the neptunium-238 nonprompt decay has been studied and the order of the effect determined, and it has been established that it is advantageous to irradiate neptunium-237 in the lowest central neutron flux possible for thermal and resonance neutron reactors. A perturbation theory has been developed to determine the role of the time variation of the thermal neutron flux and it has been established that, the integral neutron flux being the same, it is advantageous to irradiate the material in a drooping rather than a constant flux of neutrons. The simplest example of great time variations of a neutron flux has been considered and it has been established that in this particular case the conclusions made in the framework of the perturbation theory find a qualitative support. Convenient formulas are given for determining the number of neutrons used to produce plutonium-238

  14. 78 FR 73565 - Agency Information Collection Activities: Proposed Collection, Comments Requested, New Collection...

    Science.gov (United States)

    2013-12-06

    ..., homicide offenses, human trafficking, kidnapping/abduction, larceny/theft offenses, motor vehicle theft...; Public Law110-457, Title II, Section 237(a), (b), December 23, 2008, the William Wilberforce Trafficking...

  15. The Geochemical Behaviour of Tc, Np, and Pu in Spent Nuclear Fuel in an Oxidizing Environment

    Energy Technology Data Exchange (ETDEWEB)

    Buck, Edgar C.; Hanson, Brady D.; McNamara, Bruce K.; R. Giere and P. Stille

    2004-10-01

    Studies at the Nopal and Shinkolowbwe uranium deposits show that the primary uraninite (UO2) altered to a suite of secondary uranyl minerals similar to those observed in corrosion tests with uranium oxide . Although the Nopal I deposit tells us something about the possible fate of uranium, it tells us little about the likely fate of the important long-lived radionuclides; iodine (129I), cesium (135Cs), technetium (99Tc), neptunium (237Np), and plutonium (239Pu). Most performance assessment (PA) models, assume conservatively, that as the UO2 matrix corrodes, the key radionuclides (129I, 99Tc, 237Np, and 239Pu) will be released congruently. In so doing, these PA models force increased reliance on human engineered barriers.

  16. The Geochemical Behavior of Tc, Np, and Pu in Spent Nuclear Fuel in an Oxidizing Environment

    International Nuclear Information System (INIS)

    Buck, Edgar C.; Hanson, Brady D.; McNamara, Bruce K.; R. Giere; P. Stille

    2004-01-01

    Studies at the Nopal and Shinkolowbwe uranium deposits show that the primary uraninite (UO2) altered to a suite of secondary uranyl minerals similar to those observed in corrosion tests with uranium oxide . Although the Nopal I deposit tells us something about the possible fate of uranium, it tells us little about the likely fate of the important long-lived radionuclides; iodine (129I), cesium (135Cs), technetium (99Tc), neptunium (237Np), and plutonium (239Pu). Most performance assessment (PA) models, assume conservatively, that as the UO2 matrix corrodes, the key radionuclides (129I, 99Tc, 237Np, and 239Pu) will be released congruently. In so doing, these PA models force increased reliance on human engineered barriers

  17. Woods-Saxon potential parametrization at large deformations for odd-plutonium nuclei

    International Nuclear Information System (INIS)

    Garcia, F.; Yoneama, M.L.; Arruda Neto, J.D.T.; Mesa, J.; Bringas, F.; Dias, J.F.; Likhachev, V.P.

    1997-01-01

    The structure of the the single-particle levels in the secondary minima of 237,239,241 Pu fissioning nuclei is analysed with the help of an axially-deformed Woods-Saxon potential. The nuclear shape was parametrized in terms of the Cassinian ovaloids. The parametrization of the spin-orbit part of the potential in the region corresponding to large deformations (second minimum), which depends only on the nuclear surface area, B s , was obtained. With this relation we were able to reproduce successfully the spin (parity) and the energies of the rotational band built on the 8μs isomeric rate in 239 Pu and also to make a spin assignment for both isomer states in 237 Pu and 241 Pu. (author)

  18. Contribution to the study of the influences of the excitation energy on the characteristics of the fission process

    International Nuclear Information System (INIS)

    Wagemans, C.

    1979-01-01

    Neutron induced and spontaneous fission with neutron energies from 10 -2 to 2.10 5 eV have been studied. Thermal neutron induced fission measurements in Pa 231 , Th 232 , Np 237 , U 233 , U 235 , Pu 239 and Pu 241 are reported. Energy and mass distributions of heavy fission fragments due to the spontaneous fission of Pu 240 are compared to the results obtained by thermal neutron fission of Pu 239 ; the events observed with U 236 , Pu 240 , Pa 232 and Np 238 are explained by the Bohr theory of fission channels. Ternary fission phenomena of U 233 , U 235 , Pu 239 , Pa 231 and Np 237 induced by thermal neutrons are explained and compared to models of Carjan and Feather. (MDC)

  19. The fission cross section ratios and error analysis for ten thorium, uranium, neptunium and plutonium isotopes at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.

    1987-03-01

    The error information from the recent measurements of the fission cross section ratios of nine isotopes, 230 Th, 232 Th, 233 U, 234 U, 236 U, 238 U, 237 Np, 239 Pu, and 242 Pu, relative to 235 U at 14.74 MeV neutron energy was used to calculate their correlations. The remaining 36 non-trivial and non-reciprocal cross section ratios and their errors were determined and compared to evaluated (ENDF/B-V) values. There are serious differences but it was concluded that the reduction of three of the evaluated cross sections would remove most of them. The cross sections to be reduced are 230 Th - 13%, 237 Np - 9.6% and 239 Pu - 7.6%. 5 refs., 6 tabs

  20. Neutron-induced cross sections of actinides via the surrogate-reaction method

    Directory of Open Access Journals (Sweden)

    Tveten G. M.

    2013-03-01

    Full Text Available The surrogate-reaction method is an indirect way of determining cross sections for reactions that proceed through a compound nucleus. This technique may enable neutron-induced cross sections to be extracted for short-lived nuclei that otherwise cannot be measured. However, the validity of the surrogate method for extracting capture cross sections has to be investigated. In this work we study the reactions 238U(d,p239U, 238U(3He,t238Np, 238U(3He,4He237U as surrogates for neutroninduced reactions on 238U, 237Np and 236U, respectively, for which good quality data exist. The experimental set-up enabled the measurement of fission and gamma-decay probabilities. First results are presented and discussed.

  1. Fejtová, Olga/Ledvinka, Václav/Pešek, Jiří u.a.: Evropská velkoměsta mezi koncem války světové a války studené 1945–1989.

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2014-01-01

    Roč. 54, - (2014), 233-237 ISSN 0523-8587 Institutional support: RVO:68378076 Keywords : European cities * Cold War * 1945–1989 * urban history * urban anthropology Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Trad. Daniele Vitale, Arquitectos portugueses. Identidade, nacionalidade, modernidade

    OpenAIRE

    Marnoto, Rita

    2010-01-01

    (2010. Trad.). Daniele Vitale, Arquitectos portugueses. Identidade, nacionalidade, modernidade, JA Jornal Arquitectos. Publicação Trimestral da Ordem dos Arquitectos Portugal, 237, 93-101. ISSN 0870 1504 Trad. Daniele Vitale

  3. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

  4. 77 FR 14558 - Announcement of Funding Awards for the Public and Indian Housing Resident Opportunity and Self...

    Science.gov (United States)

    2012-03-12

    ... Wide Resident Council of 555 Wabasha Street Saint Paul......... MN 55102 702,000 the City of St. Paul.... Cherry Court Resident c/o Kenneth Milwaukee WI 53212 237,619 Organization. Barbeau, Contract...

  5. dispersion characteristics of settleable and dissolvable pollutants in ...

    African Journals Online (AJOL)

    The implication of this in waste stabilization pond design was also discussed. KEYWORDS: Dispersion, settleable pollutants, waste stabilization ponds. INTRODUCTION. A waste ...... and Soil Pollution 52, 237-245. Agunwamba, J. C., 1991.

  6. 48 CFR 1213.7101 - Solicitation provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ... Data, in all solicitations and requests for quotations, and the clause at (TAR) 48 CFR 1252.237-72, Prohibition on Advertising, in solicitations, requests for quotations, and all contracts (e.g., purchase...

  7. Elemental speciation of neptunium in ultra trace amount ranges

    International Nuclear Information System (INIS)

    Stoebener, Nils

    2013-01-01

    In the presented work, the detection of the isotope Np-237 with resonance ionization mass spectrometry (RIMS) was developed and optimized. In RIMS, sample atoms are excited and ionized with laser radiation in several, resonant steps and are subsequently detected by a mass spectrometer. Energy levels suitable for the excitation and ionization of Np-237 were identified using resonance ionization spectroscopy (RIS). With RIS, more than 300 previously unknown electronic states and autoionizing resonances of Np-237 were identified. Using in-source-RIMS, a limit of detection of 9E+5 atoms was demonstrated for the isotope. The mobility of Np in the environment strongly depends on its elemental speciation. Therefore, safety assessments of proposed nuclear waste repositories require analytical methods for the detection of Np species. CE (capillary electrophoresis) was hyphenated to ICP-MS (inductively coupled plasma mass spectrometry) to examine the distribution of the Np redox species Np(IV) and Np(V), which was possible at Np concentrations as low as 1E-9 mol/L. The method was used to study the interaction of the element with Opalinus Clay at varying conditions. CE-ICP-MS revealed, that under the presence of Fe(II), Np(V) is reduced to Np(IV), which is sorbed onto the clay. This leads to a higher overall Np sorption.

  8. Experimental studies on the biokinetics of plutonium and americium in the cephalopod Octopus vulgaris

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1982-01-01

    Radiotracer experiments using the photon-emitters 237 Pu and 241 Am were performed to examine uptake, tissue distribution and retention of plutonium and americium in the cephalopod Octopus vulgaris Cuvier. A 2 wk exposure in contaminated sea water resulted in twice as much 237 Pu being taken up by whole octopus as 241 Am. Immediately following uptake approximately 41% and 73% of the 237 Pu and 241 Am respectively were located in the branchial hearts. Depuration rates for both radionuclides were identical; approximately 46% of both radionuclides initially incorporated were associated with a long-lived compartment which turned over very slowly (Tbsub(1/2) = 1.5 yr). Longer exposures to 241 Am resulted in an increase in the size of the slowly exchanging 241 Am pool in the octopus. After 2 mo depuration, the majority of the residual activity of both radionuclides was in the branchial hearts. On average 33% of the 241 Am ingested with food was assimilated into tissues, primarily the hepatopancreas. Different whole-body 241 Am excretion rates were observed at different times following assimilation and were related to transfer processes taking place within internal tissues, most notably between hepatopancreas and the branchial hearts. Relationships between circulatory and excretory functions of these 2 organs are discussed and a physiological mechanism is proposed to explain the observed patterns of 241 Am excretion in O. vulgaris. (orig.)

  9. Clinical value of SPECT/CT imaging in the diagnosis of bone metastasis

    International Nuclear Information System (INIS)

    Wang Xinhua; Zhao Yanping; Lu Haijian; Dong Zhanfei

    2010-01-01

    Objective: To evaluate the clinical value of 99 Tc m -methylene diphosphonic acid (MDP) SPECT/CT imaging for the diagnosis of bone metastasis. Methods: Patients suspected for bone metastasis and with bone pain of unknown origin were included in this study (n=237). All cases underwent SPECT and CT imaging at 180 min after 99 Tc m -MDP injection. Diagnosis was confirmed by pathology (n=21), more than 2 kinds of radiologieal imaging (MRI, CT, X-ray) (n=106), and clinical follow up in 2 years (n=110). χ 2 -test was used to compare the results of planar and SPECT/CT imaging using SAS 6.12 software. Results: In 237 patients, planar imaging of 142 cases matched the final diagnosis in which 72 had benign lesions and 70 had bone metastases. The definite coincidence rate was 95.30% (142/149). SPECT/CT imaging of 224 cases matched the final diagnosis in which 104 had benign lesions and 120 cases diagnosed as bone metastases. The coincidence and definite coincidence rates were 94.51% (224/237), and 99.48% (192/193). Difference in the definite coincidence rate between planar and SPECT/CT imaging was statistically significant (χ 2 = 5.37, P=0.024). Conclusion: SPECT/CT imaging is valuable for accurate localization of osseous pathology and for improvement of diagnosing bone metastasis. (authors)

  10. Advanced core concepts with enhanced proliferation resistance by transmutation of minor actinides

    International Nuclear Information System (INIS)

    Saito, Masaki

    2005-01-01

    ''Protected Plutonium Production (P 3 )'' has been proposed to establish high burn-up cores and to produce protected with high proliferation resistance due to high decay heat and large number of spontaneous fission neutron of 238 Pu by the transmutation of Minor Actinides (MAs) which is presently treated as high-level waste. The burn-up calculations have shown that the advanced fuel with UO 2 (11-13% enrichment of 235 U) by doping 237 Np to produce 238 Pu in the commercialized large LWRs burn up to 100 GWd/t with 238 Pu to Pu ratio of about 20% which means the fuel is highly protected from proliferation. It was also predicted that medium or small size LWR cores with 15-17% enrichment, liquid metal cooled cores, and gas cooled cores added by 1-2% Np could achieve 100 GWd/t burning with bearing high proliferation resistance. The 237 Np mass balance calculations have revealed that more than 20 nuclear P 3 plants of 300 MWe could be supplied with enough 237 Np from the Japanese commercial plants in equilibrium fuel cycles. From the present studies, it is confirmed that MAs are treated as burnable and fertile materials not only to extend the core life but also to improve plutonium proliferation resistance of the future nuclear energy systems instead of their geological disposal or just their burning through fission. (author)

  11. E3 Testing of Directed Energy Systems: A Challenging Future

    National Research Council Canada - National Science Library

    Brown, Lyndell R

    2009-01-01

    .... Compatibility testing and susceptibility to electromagnetic radiation is required. Standards, such as MIL-STD-464 and MIL-STD-237D, are being revised to include HPM levels and frequencies for E3 tests...

  12. Natural Disasters and Adaptive Capacity. OECD Development Centre Working Paper No. 237

    Science.gov (United States)

    Dayton-Johnson, Jeff

    2004-01-01

    Natural disasters (droughts, earthquakes, epidemics, floods, wind storms) damage wellbeing, both in their immediate and long-term aftermath, and because the insecurity of exposure to disasters is in itself harmful to risk-averse people. As such, mitigating and coping with the risk of natural disasters is a pressing issue for economic development.…

  13. 48 CFR 52.237-8 - Restriction on Severance Payments to Foreign Nationals.

    Science.gov (United States)

    2010-10-01

    ... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of... 2003) (a) The Federal Acquisition Regulation (FAR), at 31.205-6(g)(6), limits the cost allowability of...

  14. 28 CFR 2.37 - Disclosure of information concerning parolees; Statement of policy.

    Science.gov (United States)

    2010-07-01

    ...) pursuant to a request under 18 U.S.C. 4203(e). (c) Information deemed to be “public sector” information may be disclosed to third parties without the consent of the file subject. Public sector information...

  15. 34 CFR 237.1 - What is the Christa McAuliffe Fellowship Program?

    Science.gov (United States)

    2010-07-01

    ... to reward excellence in teaching by encouraging outstanding teachers to continue their education, to develop innovative programs, to consult with or assist LEAs, private schools, or private school systems...

  16. SU-E-J-237: Image Feature Based DRR and Portal Image Registration

    Energy Technology Data Exchange (ETDEWEB)

    Wang, X; Chang, J [NY Weill Cornell Medical Ctr, NY (United States)

    2014-06-01

    Purpose: Two-dimensional (2D) matching of the kV X-ray and digitally reconstructed radiography (DRR) images is an important setup technique for image-guided radiotherapy (IGRT). In our clinics, mutual information based methods are used for this purpose on commercial linear accelerators, but with often needs for manual corrections. This work proved the feasibility that feature based image transform can be used to register kV and DRR images. Methods: The scale invariant feature transform (SIFT) method was implemented to detect the matching image details (or key points) between the kV and DRR images. These key points represent high image intensity gradients, and thus the scale invariant features. Due to the poor image contrast from our kV image, direct application of the SIFT method yielded many detection errors. To assist the finding of key points, the center coordinates of the kV and DRR images were read from the DICOM header, and the two groups of key points with similar relative positions to their corresponding centers were paired up. Using these points, a rigid transform (with scaling, horizontal and vertical shifts) was estimated. We also artificially introduced vertical and horizontal shifts to test the accuracy of our registration method on anterior-posterior (AP) and lateral pelvic images. Results: The results provided a satisfactory overlay of the transformed kV onto the DRR image. The introduced vs. detected shifts were fit into a linear regression. In the AP image experiments, linear regression analysis showed a slope of 1.15 and 0.98 with an R2 of 0.89 and 0.99 for the horizontal and vertical shifts, respectively. The results are 1.2 and 1.3 with R2 of 0.72 and 0.82 for the lateral image shifts. Conclusion: This work provided an alternative technique for kV to DRR alignment. Further improvements in the estimation accuracy and image contrast tolerance are underway.

  17. Vapour pressure of D2O - Ice at temperatures below 237 K

    International Nuclear Information System (INIS)

    Heras, J.M.; Asensio, M.C.; Estiu, G.; Viscido, L.

    1984-01-01

    Accurate measurements of heavy water ice vapour pressures between 193 and 253 K have been carried out and an equation based on thermodynamic data has been derived in order to calculate the D 2 O-ice vapour pressures between 173 and 273 K. The agreement between our calculated vapour pressures and the available experimental data including those in this paper, is very good. The comparison between the theoretical calculations of H 2 O-ice and D 2 O-ice vapour pressures confirms the experimental evidence that H 2 O-ice is more volatile than D 2 O-ice at all temperatures in agreement with the vapour isotopic effect theory (VPIE).(author)

  18. Evaluation and compilation of fission product yields 1993

    International Nuclear Information System (INIS)

    England, T.R.; Rider, B.F.

    1995-01-01

    This document is the latest in a series of compilations of fission yield data. Fission yield measurements reported in the open literature and calculated charge distributions have been used to produce a recommended set of yields for the fission products. The original data with reference sources, and the recommended yields axe presented in tabular form. These include many nuclides which fission by neutrons at several energies. These energies include thermal energies (T), fission spectrum energies (F), 14 meV High Energy (H or HE), and spontaneous fission (S), in six sets of ten each. Set A includes U235T, U235F, U235HE, U238F, U238HE, Pu239T, Pu239F, Pu241T, U233T, Th232F. Set B includes U233F, U233HE, U236F, Pu239H, Pu240F, Pu241F, Pu242F, Th232H, Np237F, Cf252S. Set C includes U234F, U237F, Pu240H, U234HE, U236HE, Pu238F, Am241F, Am243F, Np238F, Cm242F. Set D includes Th227T, Th229T, Pa231F, Am241T, Am241H, Am242MT, Cm245T, Cf249T, Cf251T, Es254T. Set E includes Cf250S, Cm244S, Cm248S, Es253S, Fm254S, Fm255T, Fm256S, Np237H, U232T, U238S. Set F includes Cm243T, Cm246S, Cm243F, Cm244F, Cm246F, Cm248F, Pu242H, Np237T, Pu240T, and Pu242T to complete fission product yield evaluations for 60 fissioning systems in all. This report also serves as the primary documentation for the second evaluation of yields in ENDF/B-VI released in 1993

  19. Evaluation and compilation of fission product yields 1993

    Energy Technology Data Exchange (ETDEWEB)

    England, T.R.; Rider, B.F.

    1995-12-31

    This document is the latest in a series of compilations of fission yield data. Fission yield measurements reported in the open literature and calculated charge distributions have been used to produce a recommended set of yields for the fission products. The original data with reference sources, and the recommended yields axe presented in tabular form. These include many nuclides which fission by neutrons at several energies. These energies include thermal energies (T), fission spectrum energies (F), 14 meV High Energy (H or HE), and spontaneous fission (S), in six sets of ten each. Set A includes U235T, U235F, U235HE, U238F, U238HE, Pu239T, Pu239F, Pu241T, U233T, Th232F. Set B includes U233F, U233HE, U236F, Pu239H, Pu240F, Pu241F, Pu242F, Th232H, Np237F, Cf252S. Set C includes U234F, U237F, Pu240H, U234HE, U236HE, Pu238F, Am241F, Am243F, Np238F, Cm242F. Set D includes Th227T, Th229T, Pa231F, Am241T, Am241H, Am242MT, Cm245T, Cf249T, Cf251T, Es254T. Set E includes Cf250S, Cm244S, Cm248S, Es253S, Fm254S, Fm255T, Fm256S, Np237H, U232T, U238S. Set F includes Cm243T, Cm246S, Cm243F, Cm244F, Cm246F, Cm248F, Pu242H, Np237T, Pu240T, and Pu242T to complete fission product yield evaluations for 60 fissioning systems in all. This report also serves as the primary documentation for the second evaluation of yields in ENDF/B-VI released in 1993.

  20. The extraction neptunium by trilaurylamine; L'extraction du neptunium par le trilaurylamine

    Energy Technology Data Exchange (ETDEWEB)

    Champion, J.; Chesne, A. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-07-01

    The extraction by trilaurylamine of neptunium (IV) from nitric acid and sulfuric acid-nitric acid media has been studied with the aim of developing a purification process for this element. Relative to the plutonium-neptunium separation, conditions are given for the oxidation of neptunium (IV) in sulfuric acid-nitric acid medium and data are presented on the stabilisation of the + 4 oxidation state by the organic solvent. Two procedures have been developed for the simultaneous purification of the two actinides. Both are based on the trilaurylamine extraction of the tetravalent nitrate species. The first utilises a constant redox potential fixed by Fe{sup +++} /Fe{sup ++} couple, while in the second, valencies are determined by successive addition of nitrite and ferrous ions. Gram quantities of neptunium 237 has been recovered from plutonium process solution. Alternate procedures are suggested for the chemical processing of irradiated Np{sup 237}. (authors) [French] L'extraction du neptunium par le trilaurylamine en milieu nitrique et sulfonitrique a ete etudiee dans le cadre de la recherche des procedes de purification de cet element. En vue d'effectuer la separation neptunium-plutonium on a precise d'une part les conditions d'oxydation du Np{sup 4+} en milieu sulfonitrique, d'autre part l'influence du solvant sur la stabilite des valences de ces deux elements. Deux procedes de purification simultanee des deux actinides ont ete developpes. Ils sont bases sur l'extraction du nitrate des elements tetravalents dans la trilaury lamine. Dans l'un, la solution a extraire a un potentiel redox fixe par un systeme auxiliaire (Fe{sup +++}/Fe{sup ++}), dans l'autre elle subit dans le meme extracteur des additions successives de nitrite et de fer ferreux. On decrit un essai semi-industriel de recuperation de neptunium 237 a partir de solution provenant de l'usine de production de plutonium de Marcoule. Differents schemas

  1. The extraction neptunium by trilaurylamine; L'extraction du neptunium par le trilaurylamine

    Energy Technology Data Exchange (ETDEWEB)

    Champion, J; Chesne, A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-07-01

    The extraction by trilaurylamine of neptunium (IV) from nitric acid and sulfuric acid-nitric acid media has been studied with the aim of developing a purification process for this element. Relative to the plutonium-neptunium separation, conditions are given for the oxidation of neptunium (IV) in sulfuric acid-nitric acid medium and data are presented on the stabilisation of the + 4 oxidation state by the organic solvent. Two procedures have been developed for the simultaneous purification of the two actinides. Both are based on the trilaurylamine extraction of the tetravalent nitrate species. The first utilises a constant redox potential fixed by Fe{sup +++} /Fe{sup ++} couple, while in the second, valencies are determined by successive addition of nitrite and ferrous ions. Gram quantities of neptunium 237 has been recovered from plutonium process solution. Alternate procedures are suggested for the chemical processing of irradiated Np{sup 237}. (authors) [French] L'extraction du neptunium par le trilaurylamine en milieu nitrique et sulfonitrique a ete etudiee dans le cadre de la recherche des procedes de purification de cet element. En vue d'effectuer la separation neptunium-plutonium on a precise d'une part les conditions d'oxydation du Np{sup 4+} en milieu sulfonitrique, d'autre part l'influence du solvant sur la stabilite des valences de ces deux elements. Deux procedes de purification simultanee des deux actinides ont ete developpes. Ils sont bases sur l'extraction du nitrate des elements tetravalents dans la trilaury lamine. Dans l'un, la solution a extraire a un potentiel redox fixe par un systeme auxiliaire (Fe{sup +++}/Fe{sup ++}), dans l'autre elle subit dans le meme extracteur des additions successives de nitrite et de fer ferreux. On decrit un essai semi-industriel de recuperation de neptunium 237 a partir de solution provenant de l'usine de production de plutonium de Marcoule. Differents schemas utilisables lors du traitement chimique des cibles de

  2. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  3. Preparation of graphite derivatives by selective reduction of graphite oxide and isocyanate functionalization

    Czech Academy of Sciences Publication Activity Database

    Kumar, A. R. S. S.; Piana, Francesco; Mičušík, M.; Pionteck, J.; Banerjee, S.; Voit, B.

    2016-01-01

    Roč. 182, 1 October (2016), s. 237-245 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : graphite oxide * surface modification * conductive nanoparticles Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.084, year: 2016

  4. Sooaspekt ja selle keeleline ülekanne : Emil Tode Piiririik / Riita-Ilona Märka

    Index Scriptorium Estoniae

    Märka, Riita-Ilona

    2003-01-01

    "Piiririigi" tõlge inglise keelde: Õnnepalu, Tõnu. Border state : [novel] / translated from the Estonian by Madli Puhvel. Evanston [USA] : Northwestern University Press, 2000. Autorist lk. 234 (inglise k.) ja lk. 237 (vene k.)

  5. 1417-IJBCS-Article-Tsopmbeng Gaston

    African Journals Online (AJOL)

    pc

    Evaluation of culture media for growth and sporulation of Phytophthora colocasiae Racib., causal ... Corresponding author, E-mail: grnoumbo@yahoo.fr, Tel: +237 99 66 50 42. ABSTRACT ..... Technology and Commerce (vol. 5),. Govil JN ...

  6. Angular distributions in the neutron-induced fission of actinides

    CERN Multimedia

    In 2003 the n_TOF Collaboration performed the fission cross section measurement of several actinides ($^{232}$Th, $^{233}$U, $^{234}$U, $^{237}$Np) at the n_TOF facility using an experImental setup made of Parallel Plate Avalanche Counters (PPAC). The method based on the detection of the 2 fragments in coincidence allowed to clearly disentangle the fission reactions among other types of reactions occurring in the spallation domain. We have been therefore able to cover the very broad neutron energy range 1eV-1GeV, taking full benefit of the unique characteristics of the n_TOF facility. Figure 1 shows an example obtained in the case of $^{237}$Np where the n_ TOF measurement showed that the cross section was underestimated by a large factor in the resonance region.

  7. Inclusive quasifree electrofission cross section for 238U

    International Nuclear Information System (INIS)

    Likhachev, V.P.; Carvalho, W.R. Jr.; Deppman, A.; Hussein, M.S.; Macedo, L.F.R.; Mesa, J.; Vaudeluci, M.S.; Arruda-Neto, J.D.T.; Evseev, I.G.; Pashchuk, S.A.; Schelin, H.R.; Garcia, F.; Rodriguez, O.; Margaryan, A.; Nesterenko, V.O.

    2003-01-01

    We present results from a joint theoretical and experimental study of inclusive quasifree electrofission of 238 U. The off-shell cross sections for the quasifree reaction stage have been calculated within the plane wave impulse approximation with distortion corrections included in the effective momentum approximation. Proton and neutron single-particle momentum distributions were calculated in the macroscopic-microscopic approach. The fissility for proton and neutron single hole excited states of the residual nuclei 237 Pa and 237,238 U was calculated within the compound nucleus model. Final state interaction corrections to residual nucleus excitation energy were calculated using the imaginary part of the optical potential. The total inclusive electrofission cross section was measured with high absolute precision, and all principal partial contributions are analyzed, in particular, the quasifree one

  8. The fission cross section ratios and error analysis for ten thorium, uranium, neptunium and plutonium isotopes at 14. 74 MeV neutron energy

    Energy Technology Data Exchange (ETDEWEB)

    Meadows, J.W.

    1987-03-01

    The error information from the recent measurements of the fission cross section ratios of nine isotopes, /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu, and /sup 242/Pu, relative to /sup 235/U at 14.74 MeV neutron energy was used to calculate their correlations. The remaining 36 non-trivial and non-reciprocal cross section ratios and their errors were determined and compared to evaluated (ENDF/B-V) values. There are serious differences but it was concluded that the reduction of three of the evaluated cross sections would remove most of them. The cross sections to be reduced are /sup 230/Th - 13%, /sup 237/Np - 9.6% and /sup 239/Pu - 7.6%. 5 refs., 6 tabs.

  9. The offline combination of thin-layer chromatography and high-performance liquid chromatography with diode array detection and micrOTOF-Q mass spectrometry for the separation and identification of spinochromes from sea urchin (Strongylocentrotus droebachiensis) shells.

    Science.gov (United States)

    Shikov, Alexander N; Ossipov, Vladimir I; Martiskainen, Olli; Pozharitskaya, Olga N; Ivanova, Svetlana A; Makarov, Valery G

    2011-12-16

    Thin-layer chromatography (TLC) with off-line high-performance liquid chromatography coupled to diode array detection and micrOTOF-Q mass spectrometry (HPLC-DAD-MS) resulted in the successful fractionation, separation and identification of spinochrome pigments from sea urchin (Strongylocentrotus droebachiensis) shells. Two fractions of pigments were separated by TLC and eluted with methanol using a TLC-MS interface. HPLC-DAD-MS analysis of the fractions indicated the presence of six sea urchin pigments: spinochrome monomers B and D, three spinochrome dimers (anhydroethylidene-6,6'-bis(2,3,7-trihydroxynaphthazarin) and its isomer and ethylidene-6,6'-bis(2,3,7-trihydroxynaphthazarin)), and one pigment that was preliminary identified as a spinochrome dimer with the structural formula C(22)H(16)O(16). Copyright © 2011 Elsevier B.V. All rights reserved.

  10. Preliminary analyses of neutronics schemes for three kinds waste transmutation blankets of fusion-fission hybrid

    International Nuclear Information System (INIS)

    Zhang Mingchun; Feng Kaiming; Li Zaixin; Zhao Fengchao

    2012-01-01

    The neutronics schemes of the helium-cooled waste transmutation blanket, sodium-cooled waste transmutation blanket and FLiBe-cooled waste transmutation blanket were preliminarily calculated and analysed by using the spheroidal tokamak (ST) plasma configuration. The neutronics properties of these blankets' were compared and analyzed. The results show that for the transmutation of "2"3"7Np, FLiBe-cooled waste transmutation blanket has the most superior transmutation performance. The calculation results of the helium-cooled waste transmutation blanket show that this transmutation blanket can run on a steady effective multiplication factor (k_e_f_f), steady power (P), and steady tritium production rate (TBR) state for a long operating time (9.62 years) by change "2"3"7Np's initial loading rate of the minor actinides (MA). (authors)

  11. Association of time structures of solar bursts at millimetric waves and at metric waves

    International Nuclear Information System (INIS)

    Sawant, H.S.; Kaufmann, P.; Correia, E.; Costa, J.E.R.; Zlobec, P.; Messerotti, M.; Fornasari, L.

    Due to the lack of simultaneous high sensitivity/time resolution observations at mm-lambda, cm-lambda and m-lambda a program on such investigations has been carried out with data obtained by INPE at Itapetinga and by the Astronomical Observatory of Trieste. Preliminary results obtained by comparing mm-wave burst structures with 408, 327 and 237 MHz indicate that i) for majority of major time structures (time scales of the order of 1 sec) observed at 22 GHz bursts, corresponding type III bursts have been observed at 237 Mhz, however ii) start times at mm-lambda and m-lambda are not often coincident at two wavelengths. These observations favour the hypothesis of (a) time dependent acceleration of energetic electrons and (b) burst emission is the response to a multiple injection of energetic electrons. (Author) [pt

  12. [The importance of the internal picture of the disease for the rehabilitative prognosis in paranoid schizophrenia].

    Science.gov (United States)

    Pkhidenko, S V

    1993-07-01

    Clinico-catamnestic analysis of internal picture of disease was carried out in 237 patients with paranoid schizophrenia. High ratio of anosognosia (52%) was found. As many as 11% of patients aimed at overcoming morbid symptoms.

  13. 77 FR 72197 - Pears Grown in Oregon and Washington; Assessment Rate Decrease for Processed Pears

    Science.gov (United States)

    2012-12-05

    ... Agricultural Statistics Service, the total farm-gate value of summer/fall processed pears grown in Oregon and... introductory text and paragraph (a) are revised to read as follows: Sec. 927.237 Processed pear assessment rate...

  14. Other Concerns & Conditions

    Science.gov (United States)

    ... anxiety, behavioral and mood disorders, substance abuse, or delinquency as teenagers. Parents of children with ADHD report ... United States, 2004–2006. National Center for Health Statistics . Vital Health Statistics, 10 (237), 1-15. Strine, ...

  15. Trematodes of fishes of the Indo-west Pacific: told and untold richness

    Czech Academy of Sciences Publication Activity Database

    Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

  16. risk factors and sero-prevalence of hepatitis b surface antigen

    African Journals Online (AJOL)

    2014-02-01

    Feb 1, 2014 ... Medicine, University of Ilorin, PMB 1515, Ilorin, Kwara State, Nigeria ... Results: High prevalence rate 10.9% was recorded. All the ... school graduate, tertiary school graduate and illiterate respectively with 36.8%, 23.7%,.

  17. Schattenboxen

    Directory of Open Access Journals (Sweden)

    Johannes Berchtold

    2011-01-01

    Full Text Available Rezensiertes Werk: Turan Kayaoğlu, Legal Imperialism. Sovereignty and Extraterritoriality in Japan, the Ottoman Empire, and China, New York: Cambridge University Press 2010, VIII, 237 p., ISBN 978-0-521-76591-6

  18. evaluation of total annual costs of heat exchanger networks using

    African Journals Online (AJOL)

    user

    after solving the first problem using RPA based heat integration gave a minimum total annual cost (TAC) of $237, ... mathematical programming and non-RPA based Hint software. ... The concept of pinch analysis evolved over the years.

  19. Pattern of Histopathological Diagnosis of Breast lesions in Gombe ...

    African Journals Online (AJOL)

    neoplastic proliferative and benign neoplastic disorders, while 118 (40.5%) were malignant neoplasms. Fibroadenoma was the commonest benign breast lesion with 69 (23.7%) cases. Of all the malignancies, invasive ductal carcinoma was the most ...

  20. germplasm collection of highland palms of afikpo in eastern nigeria

    African Journals Online (AJOL)

    DR. AMIN

    1Plant Breeding Division, Nigerian Institute For Oil Palm Research (NIFOR) P.M.B 1030 .... computed following standard statistical methods (Steel .... The production of NIFOR elite ... Malaysia Palm Oil Board, Kualar Lumpur, pp 171 – 237.

  1. Transformation of arsenic-rich copper smelter flue dust in contrasting soils: A 2-year field experiment

    Czech Academy of Sciences Publication Activity Database

    Jarošíková, A.; Ettler, V.; Mihaljevič, M.; Penížek, V.; Matoušek, Tomáš; Culka, A.; Drahota, P.

    2018-01-01

    Roč. 237, JUN (2018), s. 83-92 ISSN 0269-7491 Institutional support: RVO:68081715 Keywords : arsenic * smelter dust * soil Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 5.099, year: 2016

  2. New findings on asteroid spin-vector distributions

    Czech Academy of Sciences Publication Activity Database

    Kryszczynska, A.; La Spina, A.; Paolicchi, P.; Harris, A. W.; Breiter, S.; Pravec, Petr

    2007-01-01

    Roč. 192, č. 1 (2007), s. 223-237 ISSN 0019-1035 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * rotation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.869, year: 2007

  3. Agrese a sebevědomí

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva

    2006-01-01

    Roč. 50, č. 3 (2006), s. 231-237 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : aggression * self - esteem * egotism Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  4. Fuelling Economic Growth The Role of Public–Private Sector ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Types of parts manufactured by domestic firms in the automotive sector. 237. 8.8. The first ... Tanzania Engineering and Manufacturing Design Organization. TIRDO. Tanzania ...... Table 2.3 Distribution of firms according to sector of production ...

  5. Water Jet Technology Used in Medicine

    Czech Academy of Sciences Publication Activity Database

    Hreha, P.; Hloch, S.; Magurová, D.; Valíček, Jan; Kozak, D.; Harničárová, M.; Rakin, M.

    2010-01-01

    Roč. 17, č. 7 (2010), s. 237-240 ISSN 1330-3651 Institutional research plan: CEZ:AV0Z3086906 Keywords : abrasive water jet * medicine * technology Subject RIV: JQ - Machines ; Tools Impact factor: 0.083, year: 2010

  6. 76 FR 27563 - Margin and Capital Requirements for Covered Swap Entities

    Science.gov (United States)

    2011-05-11

    ... Comptroller of the Currency 12 CFR Part 45 Board of Governors of the Federal Reserve System 12 CFR Part 237... Housing Finance Agency 12 CFR Part 1221 Margin and Capital Requirements for Covered Swap Entities...; [[Page 27564

  7. Streptokinase increases the sensitivity of colon cancer cells to chemotherapy by gemcitabine and cis-platine in vitro

    Czech Academy of Sciences Publication Activity Database

    Bobek, V.; Pintérová, D.; Kološtová, K.; Boubelík, Michael; Douglas, J.; Teyssler, P.; Pavlásek, J.; Kovařík, J.

    2006-01-01

    Roč. 237, č. 1 (2006), s. 95-101 ISSN 0304-3835 Institutional research plan: CEZ:AV0Z50520514 Keywords : chemotherapy * radiation * colon cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.277, year: 2006

  8. Combined effects of reduced irrigation and water quality on the soil microbial community of a citrus orchard under semi-arid conditions

    Czech Academy of Sciences Publication Activity Database

    Bastida, F.; Torres, I.F.; Romero-Trigueros, C.; Baldrian, Petr; Větrovský, Tomáš; Bayona, J.M.; Alarcón, J.J.; Hernandéz, T.; García, C.; Nikolás, E.

    2017-01-01

    Roč. 104, JAN 2017 (2017), s. 226-237 ISSN 0038-0717 Institutional support: RVO:61388971 Keywords : Microbial biomass * Bacterial diversity * Enzyme activities Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.857, year: 2016

  9. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration ... Health Administration 216 views 2:37 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health ...

  10. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... from the kidneys. When you have about a cup (237 milliliters) of urine in your bladder, your ... into a bathroom and pee into a plastic cup. Your doctor will give you special wipes to ...

  11. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Infections Diseases & Conditions Pregnancy & Baby Nutrition & Fitness Emotions & Behavior School & Family Life First Aid & Safety Doctors & Hospitals ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  12. Editorial: Special thematic issue on the ecology of soil microorganisms

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr

    2017-01-01

    Roč. 93, č. 2 (2017), s. 1-3, č. článku 237. ISSN 0168-6496 Institutional support: RVO:61388971 Keywords : soil * bacteria * fungi Subject RIV: EE - Microbiology, Virology Impact factor: 3.720, year: 2016

  13. Experimental Analysis of Temperature Differences During Implant Site Preparation: Continuous Drilling Technique Versus Intermittent Drilling Technique.

    Science.gov (United States)

    Di Fiore, Adolfo; Sivolella, Stefano; Stocco, Elena; Favero, Vittorio; Stellini, Edoardo

    2018-02-01

    Implant site preparation through drilling procedures may cause bone thermonecrosis. The aim of this in vitro study was to evaluate, using a thermal probe, overheating at implant sites during osteotomies through 2 different drilling methods (continuous drilling technique versus intermittent drilling technique) using irrigation at different temperatures. Five implant sites 13 mm in length were performed on 16 blocks (fresh bovine ribs), for a total of 80 implant sites. The PT-100 thermal probe was positioned 5 mm from each site. Two physiological refrigerant solutions were used: one at 23.7°C and one at 6.0°C. Four experimental groups were considered: group A (continuous drilling with physiological solution at 23.7°C), group B (intermittent drilling with physiological solution at 23.7°C), group C (continuous drilling with physiological solution at 6.0°C), and group D (intermittent drilling with physiological solution at 6.0°C). The Wilcoxon rank-sum test (2-tailed) was used to compare groups. While there was no difference between group A and group B (W = 86; P = .45), statistically significant differences were observed between experimental groups A and C (W = 0; P =.0001), B and D (W = 45; P =.0005), and C and D (W = 41; P = .003). Implant site preparation did not affect the overheating of the bone. Statistically significant differences were found with the refrigerant solutions. Using both irrigating solutions, bone temperature did not exceed 47°C.

  14. Experimental studies on the biokinetics of plutonium and americium in the cephalopod Octopus vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Guary, J.C.; Fowler, S.W.

    1982-03-05

    Radiotracer experiments using the photon-emitters /sup 237/Pu and /sup 241/Am were performed to examine uptake, tissue distribution and retention of plutonium and americium in the cephalopod Octopus vulgaris Cuvier. A 2 wk exposure in contaminated sea water resulted in twice as much /sup 237/Pu being taken up by whole octopus as /sup 241/Am. Immediately following uptake approximately 41% and 73% of the /sup 237/Pu and /sup 241/Am respectively were located in the branchial hearts. Depuration rates for both radionuclides were identical; approximately 46% of both radionuclides initially incorporated were associated with a long-lived compartment which turned over very slowly (Tbsub(1/2) = 1.5 yr). Longer exposures to /sup 241/Am resulted in an increase in the size of the slowly exchanging /sup 241/Am pool in the octopus. After 2 mo depuration, the majority of the residual activity of both radionuclides was in the branchial hearts. On average 33% of the /sup 241/Am ingested with food was assimilated into tissues, primarily the hepatopancreas. Different whole-body /sup 241/Am excretion rates were observed at different times following assimilation and were related to transfer processes taking place within internal tissues, most notably between hepatopancreas and the branchial hearts. Relationships between circulatory and excretory functions of these 2 organs are discussed and a physiological mechanism is proposed to explain the observed patterns of /sup 241/Am excretion in O. vulgaris.

  15. 76 FR 28625 - Sorghum Promotion, Research, and Information Program; State Referendum Results

    Science.gov (United States)

    2011-05-18

    ... the 1,204 valid ballots cast, 917 or 76.2 percent favored the program and 287 or 23.7 percent opposed... those eligible persons voting for approval who were engaged in the production and sale of sorghum during...

  16. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Feelings Expert Answers Q&A Movies & More for Teens Teens site Sitio para adolescentes Body Mind Sexual Health ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  17. Book review: H. Haeupler & T. Muer: Bildatlas der Farn- und Blütenpflanzen Deutschlands; Eugen Ulmer Verlag, Stuttgart, 2007, 789 pp

    Czech Academy of Sciences Publication Activity Database

    Petřík, Petr

    2007-01-01

    Roč. 42, č. 3 (2007), s. 237-239 ISSN 1211-9520 Institutional support: RVO:67985939 Keywords : distribution atlas * vascular plants * Germany Subject RIV: EF - Botanics OBOR OECD: Plant science s, botany Impact factor: 1.133, year: 2007

  18. Fatigue property and fatigue cracks of ultra-fine grained copper processed by equal-channel angular pressing

    Czech Academy of Sciences Publication Activity Database

    Wang, Q.; Du, Z.; Liu, X.; Kunz, Ludvík

    2011-01-01

    Roč. 2011, č. 682 (2011), s. 231-237 ISSN 1013-9826 Institutional research plan: CEZ:AV0Z20410507 Keywords : ultrafine-grained copper * equal channel angular pressing * fatigue * fatigue cracks Subject RIV: JL - Materials Fatigue, Friction Mechanics

  19. A Model of the Action of the Shockwave Generated by a Multichannel Discharge on the Union of Bone Tissue with Bone Cement

    Czech Academy of Sciences Publication Activity Database

    Zeman, J.; Hach, J.; Mikulaková, W.; Derňarová, Ľ.; Eliášová, A.; Lukeš, Petr; Balážová, L.; Beneš, J.

    2016-01-01

    Roč. 30, č. 3 (2016), s. 237-242 ISSN 0258-851X Institutional support: RVO:61389021 Keywords : Shockwave * bone cement extractions * surgical revision Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.953, year: 2016

  20. Může arbuskulární mykorhiza pomoci v zemědělské produkci?

    Czech Academy of Sciences Publication Activity Database

    Janoušková, Martina

    2017-01-01

    Roč. 65, č. 5 (2017), s. 237-240 ISSN 0044-4812 R&D Projects: GA MŠk(CZ) LH14285 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * agriculture * inoculation Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology

  1. Is neck circumference measurement an indicator for abdominal ...

    African Journals Online (AJOL)

    Methods:A total 411 volunteer adults participated in this study (174 men, 237 women). A questionnaire which .... statistical analyses were performed with SPSS version. 13.0 for Windows. ..... Haslam D (March 2007). “Obesity: a medical history” ...

  2. Facing Guilt: Role of Negative Affectivity, Need for Reparation, and Fear of Punishment in Leading to Prosocial Behaviour and Aggression

    Czech Academy of Sciences Publication Activity Database

    Caprara, G. V.; Barbaranelli, C.; Pastorelli, C.; Čermák, Ivo; Rozsa, S.

    2001-01-01

    Roč. 15, č. 3 (2001), s. 219-237 ISSN 0890-2070 Institutional research plan: CEZ:AV0Z7025918 Keywords : emotional predictors of aggression * Guilt * Negative Affectivity Subject RIV: AN - Psychology Impact factor: 1.081, year: 2001

  3. Aerosol Chemical Mass Closure during the EUROTRAC-2 AEROSOL Intercomparison 2000

    Czech Academy of Sciences Publication Activity Database

    Maenhaut, W.; Schwarz, Jaroslav; Cafmeyer, J.; Chi, X.

    2002-01-01

    Roč. 186, - (2002), s. 233-237 ISSN 0168-583X Institutional research plan: CEZ:AV0Z4072921 Keywords : ion chromatography * chemical composition * atmospheric aerosols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.158, year: 2002

  4. Standardization of 241Am by digital coincidence counting, liquid scintillation counting and defined solid angle counting

    International Nuclear Information System (INIS)

    Balpardo, C.; Capoulat, M.E.; Rodrigues, D.; Arenillas, P.

    2010-01-01

    The nuclide 241 Am decays by alpha emission to 237 Np. Most of the decays (84.6%) populate the excited level of 237 Np with energy of 59.54 keV. Digital coincidence counting was applied to standardize a solution of 241 Am by alpha-gamma coincidence counting with efficiency extrapolation. Electronic discrimination was implemented with a pressurized proportional counter and the results were compared with two other independent techniques: Liquid scintillation counting using the logical sum of double coincidences in a TDCR array and defined solid angle counting taking into account activity inhomogeneity in the active deposit. The results show consistency between the three methods within a limit of a 0.3%. An ampoule of this solution will be sent to the International Reference System (SIR) during 2009. Uncertainties were analysed and compared in detail for the three applied methods.

  5. Neutron-induced cross sections of actinides via the surrogate-reaction method

    Directory of Open Access Journals (Sweden)

    Ducasse Q.

    2013-12-01

    Full Text Available The surrogate-reaction method is an indirect way of determining cross sections for reactions that proceed through a compound nucleus. This technique may enable neutron-induced cross sections to be extracted for short-lived nuclei that otherwise cannot be measured. However, the validity of the surrogate method has to be investigated. In particular, the absence of a compound nucleus formation and the Jπ dependence of the decay probabilities may question the method. In this work we study the reactions 238U(d,p239U, 238U(3He,t238Np, 238U(3He,4He237U as surrogates for neutron-induced reactions on 238U, 237Np and 236U, respectively, for which good quality data exist. The experimental set-up enabled the measurement of fission and gamma-decay probabilities. The first results are hereby presented.

  6. Znovuuvedení kritické analýzy diskurzu do českého prostředí

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila

    2017-01-01

    Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

  7. Toxicity of two plant powders as biopesticides in the management of ...

    African Journals Online (AJOL)

    SARAH

    2015-02-28

    Feb 28, 2015 ... The lowest LC50 value after 6 days was obtained with A. cissampeloides applied at. 2.37g/20g of V. ... Ex Hook.) Harms (Passifloraceae). Cliche: Chougourou, 2015. ..... Innovative Pest Management, Pergamon Press,. Oxford ...

  8. Trace element chemistry and textures of low-temperature pyrites associated with shallow fossil subsurface geothermal discharge in the Eger Graben, northwestern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Zachariáš, J.; Adamovič, Jiří; Langrová, Anna

    2006-01-01

    Roč. 37, 29 (2006), s. 237-239 ISSN 0032-6267 R&D Projects: GA AV ČR IAA3013302 Institutional research plan: CEZ:AV0Z30130516 Keywords : pyrite * geothermal fluids * Eger Graben Subject RIV: DB - Geology ; Mineralogy

  9. Application of SBRA Method in Mechanics of Continental Plates

    Czech Academy of Sciences Publication Activity Database

    Frydýšek, K.; Wandrol, I.; Kalenda, Pavel

    2012-01-01

    Roč. 6, č. 4 (2012), s. 230-237 ISSN 1998-4448 Institutional support: RVO:67985891 Keywords : mathematical modeling * probability * lithosphere plates Subject RIV: JL - Materials Fatigue, Friction Mechanics http://www.naun.org/main/NAUN/mechanics/16-581.pdf

  10. Photorelaxation of imidazole and adenine via electron-driven proton transfer along H2O wires

    Czech Academy of Sciences Publication Activity Database

    Szabla, Rafal; Gora, R.W.; Janicki, M.; Šponer, Jiří

    2016-01-01

    Roč. 195, č. 2016 (2016), s. 237-251 E-ISSN 1364-5498 R&D Projects: GA ČR(CZ) GA14-12010S Institutional support: RVO:68081707 Keywords : excited-state deactivation * induced charge-transfer Subject RIV: BO - Biophysics

  11. Lidská monstra ve Vokabuláři zvaném Lactifer a v dalších středověkých pramenech

    Czech Academy of Sciences Publication Activity Database

    Šedinová, Hana

    2004-01-01

    Roč. 127, 3-4 (2004), s. 237-283 ISSN 0024-4457 Institutional research plan: CEZ:AV0Z9009908; CEZ:AV0Z9062906 Keywords : human monsters * Greek geography * Medieval literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Drinking water ivermectin treatment for eradication of pinworm infections from laboratory rat colonies

    Czech Academy of Sciences Publication Activity Database

    Lytvynets, Andrej; Langrová, I.; Lachout, Josef; Vadlejch, J.; Fučíková, A.; Jankovská, I.

    2010-01-01

    Roč. 47, č. 4 (2010), s. 233-237 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z50110509 Keywords : Syphacia muris * Aspiculuris tetraptera * ivermectin * laboratory rat * pinworm Subject RIV: EG - Zoology Impact factor: 0.847, year: 2010

  13. Production of medically valuable stilbenes and emodin in knotweed

    Czech Academy of Sciences Publication Activity Database

    Frantík, Tomáš; Kovářová, M.; Koblihová, Helena; Bartůňková, Kristýna; Nývltová, Z.; Vosátka, Miroslav

    2013-01-01

    Roč. 50, oct.2013 (2013), s. 237-243 ISSN 0926-6690 R&D Projects: GA MŠk 1M0571 Institutional support: RVO:67985939 Keywords : knokweed * resveratrol * emodin Subject RIV: EF - Botanics Impact factor: 3.208, year: 2013

  14. Trade policy in markets with collusion: the case of North–South R&D spillovers

    Czech Academy of Sciences Publication Activity Database

    Boone, J.; Žigić, Krešimir

    2015-01-01

    Roč. 69, č. 2 (2015), s. 224-237 ISSN 1090-9443 R&D Projects: GA ČR(CZ) GAP402/12/0961 Institutional support: PRVOUK-P23 Keywords : R&D spillovers * tariff protection * supergames Subject RIV: AH - Economics

  15. Detection of field significant long-term monotonic trends in spring yields

    Czech Academy of Sciences Publication Activity Database

    Ledvinka, O.; Lamačová, Anna

    2015-01-01

    Roč. 29, č. 5 (2015), s. 1463-1484 ISSN 1436-3240 Institutional support: RVO:67179843 Keywords : Cross-correlation * Groundwater monitoring * Serial correlation * Spring yields * Trend analysis Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 2.237, year: 2015

  16. Wide frequency independently controlled dual-band inkjet-printed antenna

    KAUST Repository

    AbuTarboush, Hattan F.; Shamim, Atif

    2014-01-01

    .2 and 23.7%, respectively. These dual-bands have the ability to be controlled independently between 1.1 and 7.5 GHz without affecting the other band. In addition, the proposed antenna can be assigned for different mobile and wireless applications

  17. Význam jako jeden-pro-druhého. Etická významovost a identita subjektu u pozdního Levinase

    Czech Academy of Sciences Publication Activity Database

    Bierhanzl, Jan

    2011-01-01

    Roč. 66, Suppl. (2011), s. 228-237 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : meaning * subject * non-sense Subject RIV: AA - Philosophy ; Religion

  18. Nové poznatky ke stavebnímu vývoji kostela sv. Jana Křtitele v Kurdějově

    Czech Academy of Sciences Publication Activity Database

    Bláha, Jiří; Dohnalová, P.

    2013-01-01

    Roč. 20, č. 1 (2013), s. 237-256 ISSN 1212-1487 R&D Projects: GA MK(CZ) DF11P01OVV002 Keywords : fortified church * timber roof * dendrochronology Subject RIV: AL - Art, Architecture, Cultural Heritage www.pruzkumypamatek.cz

  19. El expresionismo de Gutiérrez Girardot

    Directory of Open Access Journals (Sweden)

    Guillermo Linero Montes

    2006-05-01

    Full Text Available Entre la ilustración y el expresionismo. Figuras de la literatura alemana. Rafael Gutiérrez Girardot. Fondo de Cultura Económica. Colombia, colección Tierra Firme, Bogotá, 2004, 237 págs.

  20. New High-Precision Measurement of the Reaction Rate of the O-18(p, alpha)N-15 Reaction via THM

    Czech Academy of Sciences Publication Activity Database

    La Cognata, M.; Spitaleri, C.; Mukhamedzhanov, A. M.; Irgaziev, B.; Tribble, R. E.; Banu, A.; Cherubini, S.; Coc, A.; Crucilla, V.; Goldberg, V. Z.; Gulino, M.; Kiss, G. G.; Lamia, L.; Chengbo, L.; Mrázek, Jaromír; Pizzone, R. G.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Tabacaru, G.; Trache, L.; Trzaska, W.; Tumino, A.

    2009-01-01

    Roč. 26, č. 3 (2009), s. 237-242 ISSN 1323-3580 Institutional research plan: CEZ:AV0Z10480505 Keywords : nuclear reactions * nucleosynthesis * abundances Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.786, year: 2009

  1. Viděno vlastníma očima. Nález neznámého konceptu autobiografie Pavla Janáka

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2008-01-01

    Roč. 56, č. 3 (2008), s. 237-242, 273 ISSN 0049-5123 Institutional research plan: CEZ:AV0Z80330511 Keywords : Pavel Janák * Czech architecture of the 20th century * autobiography Subject RIV: AL - Art, Architecture, Cultural Heritage

  2. An assessment of the applicability of photo trapping to estimate wild boar population density in a forest environment

    Czech Academy of Sciences Publication Activity Database

    Plhal, R.; Kamler, Jiří; Homolka, Miloslav; Adamec, Z.

    2011-01-01

    Roč. 60, č. 3 (2011), s. 237-246 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : Sus scrofa * snow-track counting * photo-traps * feeding site Subject RIV: EH - Ecology, Behaviour Impact factor: 0.554, year: 2011

  3. 2009 USGS Potato Creek Lidar Survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — LiDAR collected for the upper portion of the Flint River in central georgia. 237.6 sqmiles collected between May 1st and May 4th, 2009. The data contains 1 meter...

  4. morbidity and mortality among road users in benin-city,nigeria

    African Journals Online (AJOL)

    Emmanuel Ameh

    A. F. Banjo, 3W. ... Background/objective: Murray and Krug had reported that road traffic injuries are a ... of all accident cases, and 67 patients (23.7%) sustained varying injuries, while 20 ... cervical vertebrae may also occur due to whiplash.

  5. Combined SANS and SAXS study of the action of ultrasound on the structure of amorphous zirconia gels

    Czech Academy of Sciences Publication Activity Database

    Gubanova, N. N.; Baranchikov, A. Y.; Kopitsa, G. P.; Almásy, L.; Angelov, Borislav; Yapryntsev, A. D.; Rosta, L.; Ivanov, V. K.

    2015-01-01

    Roč. 24, May (2015), s. 230-237 ISSN 1350-4177 R&D Projects: GA ČR GAP208/10/1600 Institutional support: RVO:61389013 Keywords : zirconia * ultrasonication * fractals Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.556, year: 2015

  6. Prevalência de lesões intraepiteliais em atipias de significado indeterminado em um serviço público de referência para neoplasias cervicais Prevalencia de lesiones intraepiteliales en atipias de significado indeterminado en un servicio público de referencia para neoplasias cervicales Prevalence of atypical squamous cell intraepithelial lesions of undetermined significance in a public health referral service for cervical cancer

    Directory of Open Access Journals (Sweden)

    Railda Fraga Costa

    2011-01-01

    Full Text Available OBJETIVOS: Determinar a prevalência de lesões intraepiteliais de baixo e alto grau, em mulheres com diagnóstico colpocitológico de atipias de significado indeterminado no Município de Maceió, Alagoas. Conhecer a influência da idade e dos agentes etiológicos para doenças sexualmente transmissíveis sobre o risco de desenvolvimento das lesões intraepiteliais de baixo e alto grau. MÉTODOS: Estudo transversal de prevalência em um serviço público de referência para neoplasias cervicais. Foram estudados 253 prontuários de mulheres com diagnóstico de atipias de significado indeterminado, no ano de 2007. RESULTADOS: A prevalência de lesões intraepiteliais foi a de 23,7%, sendo 26,7% de baixo grau e 73,3% de alto grau. CONCLUSÕES: A prevalência de lesões intraepiteliais de alto grau em mulheres com diagnóstico colpocitológico de atipias de significado indeterminado (ASCUS foi de 23,7%, o aumento do risco foi diretamente proporcional ao da idade e houve maior prevalência de lesão intraepitelial de baixo grau,associada à infecção pelo Papilomavirus humano.OBJETIVOS: Determinar la prevalencia de lesiones intraepiteliales de bajo y alto grado, en mujeres con diagnóstico colpocitológico de atipias de significado indeterminado en el Municipio de Maceió, Alagoas. Conocer la influencia de la edad y de los agentes etiológicos para enfermedades sexualmente transmisibles sobre el riesgo de desarrollo de las lesiones intraepiteliales de bajo y alto grado. MÉTODOS: Se trata de un estudio transversal de prevalencia realizado en un servicio público de referencia para neoplasias cervicales. Fueron estudiadas 253 historias clínicas de mujeres con diagnóstico de atipias de significado indeterminado, en el año 2007. RESULTADOS: La prevalencia de lesiones intraepiteliales fue del 23,7%, siendo 26,7% de bajo grado y 73,3% de alto grado. CONCLUSIONES: La prevalencia de lesiones intraepiteliales de alto grado en mujeres con diagn

  7. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  8. Minor Actinides Recycling in PWRs

    International Nuclear Information System (INIS)

    Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

    2006-01-01

    Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

  9. Self-Monitoring Processes and Holland Vocational Preferences among College Students.

    Science.gov (United States)

    Brown, Michael T.; And Others

    1989-01-01

    Used Holland's Vocational Preference Inventory (VPI) and a self-monitoring scale to examine 237 undergraduates' association between self-monitoring and occupational preferences. Regression analyses revealed correlations between gender, self-monitoring propensity, and preferred occupational types (i.e., social, enterprising, or artistic). (TE)

  10. Controlled dehydration of a biological sample using an alternative form of environmental SEM

    Czech Academy of Sciences Publication Activity Database

    Neděla, Vilém

    2010-01-01

    Roč. 237, č. 1 (2010), s. 7-11 ISSN 0022-2720 Institutional research plan: CEZ:AV0Z20650511 Keywords : biological sample * dehydration * environmental SEM * AQUASEM II * hydration system Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.872, year: 2010

  11. Dicty_cDB: Contig-U04524-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 06281 ) Plasmodium falciparum chromosome 12 clone PFYACB8... 36 6.5 7 ( BV433064 ) S237P691RD10.T0 Portugu...eseWaterDog Canis familiar... 36 6.5 2 ( BX119923 ) Zebrafish DNA sequence from clo

  12. Changes in the Chlorophyll Content and Cytokinin Levels in the Top Three Leaves of New Plant Type Rice During Grain Filling

    Czech Academy of Sciences Publication Activity Database

    Rubia, L.; Rangan, L.; Kamínek, Miroslav; Dobrev, Petre; Malbeck, Jiří; Fowler, M.; Khush, G.; Elliott, M.

    2014-01-01

    Roč. 33, č. 1 (2014), s. 66-76 ISSN 0721-7595 R&D Projects: GA MŠk 1M06030 Institutional support: RVO:61389030 Keywords : Chlorophyll * Cytokinins * Grain filling Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.237, year: 2014

  13. Influence of temperature on the starvation threshold of nauplii of barnacle Balanus amphitrite (Cirripedia: Thoracica)

    Digital Repository Service at National Institute of Oceanography (India)

    Desai, D.V.; Anil, A.C.

    & Rohlf F J , Biometry: The principles and practice of statistics in biological research , (W H Freeman & Comp, San Francisco), 1981. 12 Walley L J, Phil. Trans. R. Soc. (B).256 (1969) 237. 13 Storch V & Anger K, Helgolander Meeresunters, 36 (1983) 67. 14...

  14. 75 FR 54524 - Defense Federal Acquisition Regulation Supplement; Guidance on Personal Services (DFARS Case 2009...

    Science.gov (United States)

    2010-09-08

    ... parts 211 and 237 are being amended to (1) require that statements of work or performance work statements clearly distinguish between Government employees and contractor employees and (2) ensure that... Department, including several checklists currently used. This interim rule adopts best practices and...

  15. The occurrence of PPV in cherry trees in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Navrátil, M.; Šafářová, D.; Fanigliulo, A.; Comes, S.; Petrzik, Karel; Karešová, R.

    2004-01-01

    Roč. 657, - (2004), 237-244 ISSN 0567-7572 R&D Projects: GA MZe(CZ) NAZV QD1407 Institutional research plan: CEZ:AV0Z5051902 Keywords : Plum pox virus * Prunus avium * sweet cherry cultivars * ELISA * RT-PCR Subject RIV: EE - Microbiology, Virology

  16. Occurrence of red tide caused by Karenia mikimotoi (toxic dinoflagellate) in the Southwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Madhu, N.V.; Reny, P.D.; Paul, M.; Ullas, N.; Resmi, P.

    .5-39.9 mu M) and chlorophyll a (av. 56.8 + or -23.7 mg m sup(-3)) concentration were observed during the bloom period. Microscopic analysis revealed that the discoloration was caused by an unarmored toxic dinoflagellate, Karenia mikimotoi Miyake & Kominami...

  17. Repressive coping and alexithymia in ideopathic environmental intolerance

    DEFF Research Database (Denmark)

    Skovbjerg, Sine; Zachariae, Robert; Rasmussen, Alice

    2010-01-01

    participated in a general population-based study and reported symptoms of environmental intolerance (n = 787) and patients with IEI (n = 237). The participants completed questionnaires assessing IEI, namely, a measure of repressive coping combining scores on the Marlowe–Crowne Social Desirability Scale (MCSDS...

  18. 77 FR 112 - Effluent Limitations Guidelines and Standards for the Construction and Development Point Source...

    Science.gov (United States)

    2012-01-03

    ..., developing and general contracting. Heavy and civil 237 engineering construction, including land subdivision..., Engineering and Analysis Division, Office of Water (4303T), Environmental Protection Agency, 1200 Pennsylvania... Treatment Chemicals, Disposal and Toxicity Concerns F. Cold Weather Considerations G. Small Sites That Are...

  19. Download this PDF file

    African Journals Online (AJOL)

    ÿþU s e r

    while nine patients (23.7%) had pin tract infection in the control group. There was a significantly lower ... duration of five days is expected to be incapable of preventing pin-tract .... Shapiro JM, Bond EL, Garman JK. 13. Hannan M; Juste RN; ...

  20. Characterization of nine microsatellite markers and development of multiplex PCRs for the Chinese huge musel Anodonta (Sinanodonta) woodiana Lea, 1834 (Mollusca, Bivalvia)

    Czech Academy of Sciences Publication Activity Database

    Popa, O. P.; Bartáková, Veronika; Bryja, Josef; Reichard, Martin; Popa, L. O.

    2015-01-01

    Roč. 60, June (2015), s. 234-237 ISSN 0305-1978 R&D Projects: GA ČR GA13-05872S Institutional support: RVO:68081766 Keywords : Invasive species * SSRs * Population genetics * Unionidae Subject RIV: EG - Zoology Impact factor: 0.988, year: 2015

  1. Pattern of Maxillofacial Surgical Conditions in North Central Nigeria ...

    African Journals Online (AJOL)

    2018-02-07

    com on Wednesday, February 7, 2018, IP: 197.89.67.237] ... Table 2: Profile of orofacial surgical conditions seen and treated over 5 years during outreach programmes in ..... The North Central zone of the country, with a population of 20.2 ...

  2. Biological Art of Producing Useful Chemicals

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 3. Metabolic Engineering: Biological Art of Producing Useful Chemicals. Ram Kulkarni. General Article Volume 21 Issue 3 March 2016 pp 233-237. Fulltext. Click here to view fulltext PDF. Permanent link:

  3. Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef

    2016-01-01

    Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016

  4. Impact-pressure controlled orientation of shatter cone magnetizations in Sierra Madera, Texas, USA

    Czech Academy of Sciences Publication Activity Database

    Adachi, T.; Kletetschka, Günther

    2008-01-01

    Roč. 52, č. 2 (2008), s. 237-254 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30130516 Keywords : shatter cones * impact crater * shock fractures * magnetism * Mars Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.770, year: 2008

  5. Genetic interaction between Lrp6 and Wnt5a during mouse development

    Czech Academy of Sciences Publication Activity Database

    Andersson, E.; Bryjová, Lenka; Biris, K.; Yamaguchi, T.P.; Arenas, E.; Bryja, Vítězslav

    2010-01-01

    Roč. 239, č. 1 (2010), s. 237-245 ISSN 1058-8388 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Wnt 5a * Lrp6 * somitogenesis Subject RIV: BO - Biophysics Impact factor: 2.864, year: 2010

  6. Ketogenic Diet: Effects on Growth

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2002-12-01

    Full Text Available The effects of the ketogenic diet on growth of 237 children (130 males, 107 females treated for intractable epilepsy has been evaluated in a prospective cohort study (average follow-up 308 days at the Johns Hopkins Hospital, Baltimore, MD.

  7. Les dimensions d’une ombre: résonances intermédiales et collaborations artistiques entre femmes

    Directory of Open Access Journals (Sweden)

    Maryse Larivière

    2014-04-01

    Full Text Available Au sujet de l’ouvrage d’Andrea Oberhuber, Corps de papier : résonances[avec des accompagnements de Catherine Mavrikakis, Nicole Brossard et Verena Stefan] (Québec, QC, Nota Bene, 2012, 237 p. ISBN: 978-2-89518-442-3.

  8. Distribution coefficient of plutonium between sediment and seawater

    International Nuclear Information System (INIS)

    Duursma, E.K.; Parsi, P.

    1974-01-01

    Using plutonium 237 as a tracer, a series of experiments were conducted to determine the distribution coefficient of plutonium onto sediments both under oxic and anoxic conditions, where the plutonium was added to seawater in three different valence states: III, IV and VI

  9. Word order and information structure in Czech 3-and 4-year-olds' comprehension.

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip

    2015-01-01

    Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015

  10. Improved Refolding Efficacy of Recombinant Human Interferon α-2b ...

    African Journals Online (AJOL)

    Different refolding buffers were employed for refolding the target protein. The refolded ... secondary structure of the protein was altered, probably due to increase in alpha-helix from 23.7 % at. pH 7.0 to 28.1 % ... One of the recombinant proteins ...

  11. Regenerative Medicine for Battlefield Injuries

    Science.gov (United States)

    2014-10-01

    Manual of Experimental Embryology . University of Chicago Press, Chicago. Harris JS, Bemenderfer TB, Wessel AR, Kacena MA (2013) A review of mouse...proliferation and apoptosis . Dev Dynam 219:237-247. Patterson TE, Kumagal K, Griffith L, Muschler GF (2008) Cellular strategies for enhancement

  12. Carbothermal Upgrading of the Awaso Bauxite Ore using Sawdust ...

    African Journals Online (AJOL)

    Michael

    2016-12-02

    Dec 2, 2016 ... 1University of Mines and Technology, P.O. Box 237, Tarkwa, Ghana. Fosu, A. Y. ... disposal of red mud in storage areas contribute to about 5 ... LPG was employed as the fuel ... Calcination of hydrated aluminium oxide to form.

  13. Ghana Mining Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. Professor Daniel Mireku-Gyimah Editor-in-Chief University of Mines & Technology Ghana Mining Journal University of Mines & Technology P. O. BOX 237 Tarkwa Ghana Phone: +233 362 20280/20324. Fax: +233 362 20306. Email: dm.gyimah@umat.edu.gh ...

  14. Current knowledge of the species complex Anastrepha fraterculus (Diptera, Tephritidae) in Brazil

    Czech Academy of Sciences Publication Activity Database

    Vaníčková, Lucie; Hernández-Ortiz, V.; Bravo, I. S. J.; Dias, V.; Roriz, A. K. P.; Laumann, R. A.; Mendonca, A. L.; Paranhos, B. A. J.; do Nascimento, R. R.

    -, č. 540 (2015), s. 211-237 ISSN 1313-2989 Institutional support: RVO:61388963 Keywords : South American fruit fly * cryptic species * taxonomy * sexual behavior * chemical communication Subject RIV: EG - Zoology Impact factor: 0.938, year: 2015 http://zookeys.pensoft.net/articles.php?id=6228

  15. Sexospécificités | Page 237 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The word is out: smoking tobacco through a waterpipe — a narghile or hookah — is as dangerous, or more so than smoking cigarettes. So says the World Health Organization, which issued an advisory in 2005 that made news around the world. It noted that "waterpipe smoking is associated with many of the same risks as ...

  16. 48 CFR 1352.237-70 - Security processing requirements-high or moderate risk contracts.

    Science.gov (United States)

    2010-10-01

    ... background inquiries pertaining to verification of name, physical description, marital status, present and... undergo security processing by the Department's Office of Security before being eligible to work on the.... citizens must have: (1) Official legal status in the United States; (2) Continuously resided in the United...

  17. Standardization of {sup 241}Am by digital coincidence counting, liquid scintillation counting and defined solid angle counting

    Energy Technology Data Exchange (ETDEWEB)

    Balpardo, C., E-mail: balpardo@cae.cnea.gov.a [Laboratorio de Metrologia de Radioisotopos, CNEA, Buenos Aires (Argentina); Capoulat, M.E.; Rodrigues, D.; Arenillas, P. [Laboratorio de Metrologia de Radioisotopos, CNEA, Buenos Aires (Argentina)

    2010-07-15

    The nuclide {sup 241}Am decays by alpha emission to {sup 237}Np. Most of the decays (84.6%) populate the excited level of {sup 237}Np with energy of 59.54 keV. Digital coincidence counting was applied to standardize a solution of {sup 241}Am by alpha-gamma coincidence counting with efficiency extrapolation. Electronic discrimination was implemented with a pressurized proportional counter and the results were compared with two other independent techniques: Liquid scintillation counting using the logical sum of double coincidences in a TDCR array and defined solid angle counting taking into account activity inhomogeneity in the active deposit. The results show consistency between the three methods within a limit of a 0.3%. An ampoule of this solution will be sent to the International Reference System (SIR) during 2009. Uncertainties were analysed and compared in detail for the three applied methods.

  18. X-ray structure study of boron chelates with N-(pyridyl-2)- and N-(thiazolyl-2)urea derivatives

    International Nuclear Information System (INIS)

    Teslya, I.A.; Starikova, Z.A.; Boldyreva, O.G.; AN SSSR, Moscow. Inst. Organicheskoj Khimii)

    1987-01-01

    Spectral (IR, Raman) and X-ray structural investigations of CdBr 2 xMB (MB-2,4,6,8-tetramethyl-2,4,6,8-tetraazabicyclo(3.3.0)-octadione-3.7 m, mebicar) (λMo, 634 reflections, R=0.045) are performed. Rhombic crystals: a=3.9921(7), b=10.6938(25), c=14.9947(62)A,L=2, sp. gr. F nmm . The structure is polymerically laminated. Mebicar molecules play the role of bidentate-bridge ligands. O atoms of both carbonyl groups bind Cd atoms of the neighbouring complexes in chains directed along y axis. In the direction of x axis such chains are connected by bridge Br atoms in layers parallel to (xy0) plane. the coordination polyhedron of Cd atoms is a distorted octahedron. Bond lengths Cd-Br 2.738, Cd-O 2.37 A Bond lengths Cd-Br 2.738, Cd-O 2.37 A

  19. The extraction neptunium by trilaurylamine

    International Nuclear Information System (INIS)

    Champion, J.; Chesne, A.

    1964-01-01

    The extraction by trilaurylamine of neptunium (IV) from nitric acid and sulfuric acid-nitric acid media has been studied with the aim of developing a purification process for this element. Relative to the plutonium-neptunium separation, conditions are given for the oxidation of neptunium (IV) in sulfuric acid-nitric acid medium and data are presented on the stabilisation of the + 4 oxidation state by the organic solvent. Two procedures have been developed for the simultaneous purification of the two actinides. Both are based on the trilaurylamine extraction of the tetravalent nitrate species. The first utilises a constant redox potential fixed by Fe +++ /Fe ++ couple, while in the second, valencies are determined by successive addition of nitrite and ferrous ions. Gram quantities of neptunium 237 has been recovered from plutonium process solution. Alternate procedures are suggested for the chemical processing of irradiated Np 237 . (authors) [fr

  20. Energy distribution of neutrons from the (n,2n) reaction in 238U

    International Nuclear Information System (INIS)

    Misulovin, A.

    1978-12-01

    Energy distribution of the first and second neutrons from (n,2n) scattering event in 238 U was evaluated according to the consistent compound nucleus model recently proposed by Segev. The law for deriving the energy distribution of secondary neutrons from a (n,2n) scattering event, depends on whether the reaction is considered as a simultaneous emission of two neutrons from one compound nucleus, or a successive emission of neutrons from different compound nuclei. Segev has presented a means of calculating the energy distribution assuming the latter model. The laws presented in the ENDF/B data files suggest the former model. The evaluation was based on inelastic level excitation and evaporation data for 238 U and 237 U. Data was retrieved from ENDF/B files. The evaporation data for 237 U was based on (γ,n) reaction 238 U. The inelastic level excitation data for 237 U was evaluated at the Soreq Nuclear Research Centre. It is concluded from the application of Segev's model to 238 U, that the energetic spectrum of secondary neutrons, is harder in the high range of energy than the one predicted by the use of the distribution law presented in ENDF/B data files. The spectrum of secondary (n,2n) neutrons, resulting from the interaction of 14 MeV neutrons in 238 U calculated with Segev's model, is compared with the corresponding spectrum of the LLL library, ENDF/B library and the recent evaluation of BNWL. It is found that the spectrum evaluated by LLL and BNWL is harder than that evaluated with Segev's model

  1. Causes of visual loss in uveitis

    Directory of Open Access Journals (Sweden)

    Stanković Zora

    2009-01-01

    Full Text Available Background/Aim. Epidemiological studies of blindness in a working age population require a precise definition of the true connection of uveitis and visual damage. Since most patients with more severe types of uveitis are hospitalized in tertiary referral uveitis service, our aim was to determine whether age, sex and age of onset of uveitis, as well as duration of visual loss and its causes influence the degree of visual damage in patients with different types of uveitis. Methods. The data were collected from medical records of 237 patients at the Department for Uveitis of the Institute for Eye Diseases in Belgrade over a three-year period (March 2005 to March 2008. Results. Visual acuity reduction (≤ 0.3 was found in 161/237 (67.9% patients, 85 of whom had visual acuity of ≤ 0.1 later. Working age patients (up to 60 years of age most often suffered from uveitis (173/237; 73%. The highest number of patients with visual loss was in the group suffering from panuveitis (77/94; 81.91%. The age of onset of uveitis and sex have no statistically significant influence on visual loss. The most common causes of visual loss (34/161; 21.1% were cystoid macular oedema (CMO (43/161; 26.7%, cataract (28/161; 17.39% and combination of CMO and cataract. Conclusion. The risk factors for severe visual loss (≤ 0.1 are panuveitis, bilateral inflammation, prolonged visual reduction and a significant number of relapses. The main causes of visual loss in 65.2% of our patients were CMO and cataract.

  2. Isolation and basic characterization of Zn-binding compounds in spinach biomass

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, D.; Pavlík, Milan; Vašíčková, Soňa; Száková, J.; Tlustoš, P.; Balík, J.; Vokáč, Karel; Grüner, Karel

    2001-01-01

    Roč. 47, č. 12 (2001), s. 549-553 ISSN 0370-663X R&D Projects: GA ČR GA526/97/0845 Institutional research plan: CEZ:AV0Z4055905 Keywords : Zn-binding compounds Subject RIV: CE - Biochemistry Impact factor: 0.237, year: 2001

  3. Dicty_cDB: CHK317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag

  4. Influence of form factors and multistep effects on the 232Th(d,t) 231Th and 230Th(d,p) 231Th reactions

    International Nuclear Information System (INIS)

    Wilcke, W.; Felix, W.; Elze, Th.W.; Huizenga, J.R.; Thompson, R.C.; Dreisler, R.M.

    1977-01-01

    Tables of spectroscopic information are given for the nuclei 233 , 235 , 237 Pa, and 229 , 231 Ac studied in the reactions 234 , 236 , 238 U, and 230 , 232 Th(t,α), including spin, parity, differential cross sections, and spectra. These quantities are discussed and plotted

  5. Depolarization affects lateral microdomain structure of yeast plasma membrane

    Czech Academy of Sciences Publication Activity Database

    Herman, P.; Večeř, J.; Opekarová, Miroslava; Veselá, Petra; Jančíková, I.; Zahumenský, J.; Malínský, Jan

    2015-01-01

    Roč. 282, č. 3 (2015), s. 419-434 ISSN 1742-464X R&D Projects: GA ČR GAP205/12/0720 Institutional support: RVO:68378041 Keywords : gel microdomains * lipid order * transmembrane potential Subject RIV: EA - Cell Biology Impact factor: 4.237, year: 2015

  6. original article the prevalence of intestinal coccidian parasites ...

    African Journals Online (AJOL)

    boaz

    Department of Medical Laboratory Sciences, Faculty of Health Sciences,. University of Bamenda. Email: henrikamga2002@yahoo.fr Tel: (+237)99721972. ABSTRACT. Background: Intestinal coccidia are group of protozoa which parasitize the epithelial cells of the intestinal tract of their hosts. Most infections usually produce ...

  7. A novel fibrinogen variant - Liberec: dysfibrinogenaemia associated with gamma Tyr262Cys substitution

    Czech Academy of Sciences Publication Activity Database

    Kotlín, R.; Sobotková, A.; Suttnar, J.; Salaj, P.; Walterová, L.; Riedel, Tomáš; Reicheltová, Z.; Dyr, J. E.

    2008-01-01

    Roč. 81, č. 2 (2008), s. 123-129 ISSN 0902-4441 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z40500505 Keywords : fibrinogen * missense mutation * dysfibrinogenaemia Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.237, year: 2008

  8. Early career burnout among Dutch nurses : A process captured in a Rasch model

    NARCIS (Netherlands)

    de Vos, Jan Alexander; Brouwers, Andre; Schoot, Tineke; Pat-El, Ron; Verboon, Peter; Näring, Gerard

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  9. Early career burnout among Dutch nurses: A process captured in a Rasch model

    NARCIS (Netherlands)

    Vos, J.A. de; Brouwers, A.; Schoot, T.; Pat-El, R.; Verboon, P.; Näring, G.W.B.

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  10. Family history of systemic lupus erythematosus and risk of autoimmune disease

    DEFF Research Database (Denmark)

    Ulff-Møller, Constance Jensina; Simonsen, Jacob; Kyvik, Kirsten Ohm

    2017-01-01

    Objective.: To provide population-based estimates of relative risk of SLE and other autoimmune diseases (ADs) in relatives of SLE patients. Methods.: A cohort of 5 237 319 Danish residents identified through the Civil Registration System was coupled to their relatives through the parental link...

  11. Electrotunable wetting and micro- and nanofluidics: general discussion

    Czech Academy of Sciences Publication Activity Database

    Bazant, M.; Bennewitz, R.; Bocquet, L.; Kratochvílová, Irena

    2017-01-01

    Roč. 199, Jul (2017), s. 195-237 ISSN 1359-6640 Institutional support: RVO:68378271 Keywords : ionic liquids * wall turbulence * double-layer * water * surfaces * interface * scale * electrolyt * capacitance * relaxation Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.588, year: 2016

  12. 75 FR 67632 - Defense Federal Acquisition Regulation Supplement; Prohibition on Interrogation of Detainees by...

    Science.gov (United States)

    2010-11-03

    ...-AG88 Defense Federal Acquisition Regulation Supplement; Prohibition on Interrogation of Detainees by... National Defense Authorization Act for Fiscal Year 2010 (Pub. L. 111-84) prohibits the interrogation of..., to add DFARS 237.173, Prohibition on Interrogation of Detainees by Contractor Personnel, adding a...

  13. Optimising Shovel-Truck Fuel Consumption using Stochastic ...

    African Journals Online (AJOL)

    Michael

    2017-12-02

    Dec 2, 2017 ... J. Bansah. 1University of Mines and Technology, P. O. Box 237, Tarkwa, Ghana. 2Missouri S&T .... of dump trucks which could be mixed fleets or same fleets. .... another portraying the reality of trucks moving from a shovel to a ...

  14. Interspecific hybridization in the genus Hieracium (s. str.) – evidence for bidirectional gene flow and spontaneous allopolyploidization

    Czech Academy of Sciences Publication Activity Database

    Mráz, P.; Chrtek, Jindřich; Fehrer, Judith

    2011-01-01

    Roč. 293, 1-4 (2011), s. 237-245 ISSN 0378-2697 R&D Projects: GA ČR GAP506/10/1363 Institutional research plan: CEZ:AV0Z60050516 Keywords : additive polymorphism * hybridization * polyploidization Subject RIV: EF - Botanics Impact factor: 1.335, year: 2011

  15. Overtopping Measurements on the Wave Dragon Nissum Bredning Prototype

    DEFF Research Database (Denmark)

    Frigaard, Peter; Kofoed, Jens Peter; Rasmussen, Michael R.

    2004-01-01

    The paper describes the methods used to estimate (calculated from some indirect measurements) the overtopping of the wave energy converter Wave Dragon placed in a real sea environment. The wave energy converter in quistion is the 237-tonne heavy Wave Dragon Nissum Bredning Prototype. Comparisons...

  16. Německé podnikání Baťova koncernu. Studie k hospodářským a sociálním dějinám hornoslezského továrního města Ottmuth (Otmęt)

    Czech Academy of Sciences Publication Activity Database

    Jemelka, M.; Ševeček, Ondřej

    2013-01-01

    Roč. 111, č. 2 (2013), s. 237-274 ISSN 0037-6833 R&D Projects: GA ČR(CZ) GAP410/10/1995 Institutional support: RVO:67985955 Keywords : Baťa concern * Upper Silesia * Ottmuth (Otmęt) * shoe Industry Subject RIV: AB - History

  17. Tracking biochemical changes correlated with ultra-weak photon emission using metabolomics

    Czech Academy of Sciences Publication Activity Database

    Burgos, R.C.R.; Červinková, Kateřina; van der Laan, T.; Ramautar, R.; van Wijk, E.P.A.; Cifra, Michal; Koval, S.; Berger, R.; Hankemeier, T.; van der Greef, J.

    -, č. 163 (2016), s. 237-245 ISSN 1011-1344 R&D Projects: GA ČR GA13-29294S Institutional support: RVO:67985882 Keywords : Ultra-weak photon emission * Capillary electrophoresis-mass spectrometry * HL-60 cells Subject RIV: BO - Biophysics Impact factor: 2.673, year: 2016

  18. Life-history variation in the short-lived herb Rorippa palustris: effects of germination date and injury timing

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka; Sosnová, Monika; Martínková, Jana

    2007-01-01

    Roč. 189, - (2007), s. 237-246 ISSN 1385-0237 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z60050516 Keywords : Bud bank * Cohorts * Life history Subject RIV: EF - Botanics Impact factor: 1.236, year: 2007

  19. 48 CFR 1337.110-70 - Personnel security processing requirements.

    Science.gov (United States)

    2010-10-01

    ... information technology (IT) system, as required by the Department of Commerce Security Manual and Department of Commerce Security Program Policy and Minimum Implementation Standards. (b) Insert clause 1352.237... as National Security Contracts that will be performed on or within a Department of Commerce facility...

  20. South African Journal of Animal Science - Vol 11, No 3 (1981)

    African Journals Online (AJOL)

    Ruproteïenbehoeftes van agtien-maand-oud osse gedurende die afrondingsperiode* · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H.J. Van der Merwe, A.P. van Schalkwyk, L.J.J. van Rensburg, 237-245 ...

  1. 78 FR 75201 - Suspension of Limitations Under the Jerusalem Embassy Act

    Science.gov (United States)

    2013-12-10

    ... Vol. 78 Tuesday, No. 237 December 10. 2013 Part IV The President Presidential Determination No. 2014-04 of December 3, 2013--Suspension of Limitations Under the Jerusalem Embassy Act Proclamation 9067--Death of Nelson Mandela Proclamation 9068--National Pearl Harbor Remembrance Day, 2013 Memorandum...

  2. Aspects of spirituality in medical doctors and their relation to specific views of illness and dealing with their patients' individual situation

    DEFF Research Database (Denmark)

    Büssing, Arndt; Hirdes, Almut Tabea; Baumann, Klaus

    2013-01-01

    . Data from an anonymous survey enrolling 237 medical doctors from Germany (mean age 45.7 +/- 9.6, 58% male, 42% female) indicated that secular forms of spirituality scored highest, while specific religious orientation had the lowest scores. Physicians with a specific specialization in complementary...

  3. SrAl12O19 thin films by chemical solution deposition and their use as buffer layers for oriented growth of hexagonal ferrites

    Czech Academy of Sciences Publication Activity Database

    Buršík, Josef; Uhrecký, Róbert; Kaščáková, Dorota; Kužel, R.; Holý, V.; Dopita, M.

    2016-01-01

    Roč. 616, OCT (2016), s. 228-237 ISSN 0040-6090 R&D Projects: GA ČR(CZ) GA14-18392S Institutional support: RVO:61388980 Keywords : Chemical solution deposition * Hexagonal aluminates * Hexagonal ferrites Subject RIV: CA - Inorganic Chemistry Impact factor: 1.879, year: 2016

  4. A review of opioid prescription in a teaching hospital in Colombia [Corrigendum

    Directory of Open Access Journals (Sweden)

    Moyano J

    2015-05-01

    Full Text Available Moyano J, Figueras A. J Pain Res. 2012;5:237–242.Jairo Moyano is also affiliated with Deparment de Farmacologia, Terapeutica i Toxicologia, Universitat Autonoma de Barcelona, Barcelona, Spain, which was not included in the original publication.Read the original article

  5. Dynamics of Magnetic Bright Points in an Active Region

    Czech Academy of Sciences Publication Activity Database

    Möstl, C.; Hanslmeier, A.; Sobotka, Michal; Puschmann, K.G.; Muthsam, H. J.

    2006-01-01

    Roč. 237, č. 1 (2006), s. 13-23 ISSN 0038-0938 Grant - others:FWF(AT) P-17024 Institutional research plan: CEZ:AV0Z10030501 Keywords : Sun * photosphere * magnetic fields Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.887, year: 2006

  6. Space weathering simulations through controlled growth of iron nanoparticles on olivine

    Czech Academy of Sciences Publication Activity Database

    Kohout, Tomáš; Čuda, J.; Filip, J.; Britt, D.; Bradley, T.; Tuček, J.; Skála, Roman; Kletetschka, Günther; Kašlík, J.; Malina, O.; Šišková, K.; Zbořil, R.

    2014-01-01

    Roč. 237, 15 July (2014), s. 75-83 ISSN 0019-1035 R&D Projects: GA MŠk LH12079 Institutional support: RVO:67985831 Keywords : asteroids, surface * Moon, surface * regoliths * spectroscopy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.038, year: 2014

  7. AcEST: DK954411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available receptor OS=Me... 32 1.8 sp|O43087|KMS2_SCHPO Karyogamy meiotic segregation protein 2 OS=... 32 2.4 sp|Q8RFJ...jct: 237 LHVLLMTFCPNNPYCVCYMSLFQINGML 264 >sp|O43087|KMS2_SCHPO Karyogamy meiotic segregation protein 2 OS=S

  8. Nástroje korektivního a zonálního leštění pro přípravu asférických povrchů

    Czech Academy of Sciences Publication Activity Database

    Václavík, Jan; Lédl, Vít

    2011-01-01

    Roč. 56, č. 9 (2011), s. 237-241 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) ED2.1.00/03.0079 Institutional research plan: CEZ:AV0Z20430508 Keywords : Zonal polishing * polishing instruments * asferic surfaces Subject RIV: JP - Industrial Processing

  9. Norma kasumlikkus kahanes / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2005-01-01

    Autodele turvavöösid tootva Norma ärikasum oli kolmandas kvartalis 23,7 miljonit krooni, mis on ligi viiendiku võrra vähem kui eelmisel aastal samal ajal. Diagramm. Vt. samas: Rootsi analüütik ennustas suvel Norma ülevõtmist

  10. South African Journal of Animal Science - Vol 46, No 3 (2016)

    African Journals Online (AJOL)

    Fatty acid profile and health lipid indices in the raw milk of ewes grazing part-time and hemp seed supplementation of lactating ewes · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Mierlita, 237-246 ...

  11. 78 FR 57866 - Center for Scientific Review; Notice of Closed Meetings

    Science.gov (United States)

    2013-09-20

    ..., 301- 237-1487, [email protected] . Name of Committee: Digestive, Kidney and Urological Systems... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory Committee Act, as [[Page...

  12. Dichelyne (Dichelyne) spinigerus sp. nov. (Nematoda: Cucullanidae) from the marine fish Otolithes ruber (Sciaenidae) off Iran and first description of the male of Philometra otolithi Moravec et Manoharan, 2013 (Nematoda: Philometridae)

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Khosheghbal, M.; Pazooki, J.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 229-237 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : parasitic nematode * Dichelyne * Philometra * marine fish * Otolithes * Iran Subject RIV: EG - Zoology Impact factor: 0.905, year: 2014

  13. Dicty_cDB: Contig-U15153-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42 ) Dictyostelium discoideum gamete cDNA, clone FC-AU21. 400 e-170 4 ( BV426376 ) S237P6125FG3.T0 Portugu...eseWaterDog Canis familiar... 52 0.020 1 ( AC068970 ) Homo sapiens BAC clone RP11-8

  14. Making Teacher Change Visible: Developing an Action Research Protocol for Elementary Mathematics Instruction

    Science.gov (United States)

    Rice, Linda J.; McKeny, Timothy S.

    2012-01-01

    Professional development is a well-established component of teacher change, and action research can make that change visible. In this study, quantitative and qualitative data were collected from 237 elementary teachers and intervention specialists from 33 federally-designated Appalachian counties of Southeastern Ohio who participated in the…

  15. The Study of Prompt and Delayed Muon Induced Fission. I.Total kinetic energies and mass distributions

    NARCIS (Netherlands)

    David, P; Hartfiel, J.; Janszen, H.; Petitjean, C.; Reist, H.W.; Polikanov, S.M.; Konijn, J.; Laat, de C.T.A.M.; Taal, A.; Krogulski, T.; Johansson, T.; Tibell, G.; Achard van Enschut, d' J.F.M.

    1987-01-01

    Mass yield and total kinetic energy release (TKE) distributions of fragments from prompt and delayed muon induced fission, separately, have been measured for the isotopes235U,238U,237Np and242Pu. The distributions from prompt muon induced fission are compared with the corresponding distributions

  16. 78 FR 36232 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year...

    Science.gov (United States)

    2013-06-17

    .......... Chase Manor Chase Manor.... 55-75 Norman Norwich 50 245,565 Associates. Road. CT....... Southern... St. The Green 2412 Franklin Washington 100 124,177 Paul Housing Valley Apts. St Ne. Inc. FL... Apts. MA....... Taunton Green Taunton Green.. 31 School St... Taunton 75 237,008 Associates. MA...

  17. CPAP Tips

    Medline Plus

    Full Text Available ... Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 101,237 views 7:36 6 Best CPAP Masks 2017 - Duration: 2:58. ... 2:58 Donn's Sleep Apnea Story - Duration: 2:36. schneiderjobs 7,691 views 2:36 Loading more ...

  18. Short Note Birds feeding in association with bat-eared foxes on ...

    African Journals Online (AJOL)

    Short Note Birds feeding in association with bat-eared foxes on Benfontein Game Farm, South Africa. Ute Stenkewitz, Jan F Kamler. Abstract. No Abstract. Ostrich 2008, 79(2): 235–237. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  19. Biologically induced formation of realgar deposits in soil

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Mikutta, C.; Falteisek, L.; Duchoslav, V.; Klementová, Mariana

    2017-01-01

    Roč. 218, DEC (2017), s. 237-256 ISSN 0016-7037 Institutional support: RVO:61388980 Keywords : Arsenic speciation * Microbial communities * Realgar * Sulfur isotopes * Wetland soil * X-ray absorption spectroscopy Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.609, year: 2016

  20. Draft genome sequence of pigeonpea (Cajanus cajan), an orphan legume crop of resource-poor farmers

    DEFF Research Database (Denmark)

    Varshney, Rajeev K.; Chen, Wenbin; Li, Yupeng

    2012-01-01

    Pigeonpea is an important legume food crop grown primarily by smallholder farmers in many semi-arid tropical regions of the world. We used the Illumina next-generation sequencing platform to generate 237.2 Gb of sequence, which along with Sanger-based bacterial artificial chromosome end sequences...