Science.gov (United States)

Not Available

Science.gov (United States)

Tb3+-activated Sr3AlO4F phosphors were synthesized by a high-temperature solid-state reaction method. The investigation of photoluminescence and cathodoluminescence indicates that these phosphors can be effectively excited by ultraviolet light and low-voltage electron beam. The phosphors exhibit a tunable-green emission. The luminescence behaviors are explained by the site occupancy of Tb3+ ions in the host crystal and the cross-relaxation of 5D3 to 5D4 state.

International Nuclear Information System (INIS)

The temperature and concentration dependence of the densities of binary CaBr_2-(Li, Na, K, Rb, Cs)Br, NaBr-(Sr, Ba)Br_2 and KBr-SrBr_2 mixtures have been measured using the method of hydrostatic weighing. With exception of the systems LiBr-CaBr_2 and NaBr-(Sr, Ba)Br_2 the calculated molar excess volumes are positiv in the investigated mixtures. (author).

Science.gov (United States)

The development of new efficient afterglow phosphors is currently hampered by a limited understanding of the persistent luminescence mechanism. Radioluminescence (RL) and x-ray absorption measurements on the persistent phosphor SrAl2O4:Eu,Dy were combined to reveal possible valence state changes for the rare earth (co)dopants. Traps in the phosphor material are quickly filled when exposing thermally emptied SrAl2O4:Eu,Dy powder to x rays. On the same time scale a partial oxidation of Eu2+ to Eu3+ is observed by x-ray absorption near-edge spectroscopy (XANES), while for the trivalent dysprosium the valence state remains unchanged. The impact of these observations on the recently proposed models for persistent luminescence is discussed.

Energy Technology Data Exchange (ETDEWEB)

Short communication

International Nuclear Information System (INIS)

In this study, we use electron paramagnetic resonance (EPR), optical absorption, and photoluminescence (PL) spectroscopies to determine the various Ce environments in SrS phosphor materials and how these affect absorption and emission properties. As the Ce concentration is increased from 450 to 7500 ppm, the total EPR-active Ce"3"+ and optical absorption signals increase linearly with Ce concentration; by contrast, the PL intensity saturates at fairly low Ce concentrations (1000 ppm Ce). We suggest that the nonlinear behavior of the PL arises from the presence of nonradiative deexcitation pathways such as defects associated with Ce sites, or Ce endash Ce pairs. copyright 1996 American Institute of Physics.

British Library Electronic Table of Contents (United Kingdom)

Ferroelectric barium strontium titanate (Ba0.7Sr0.3TiO3)(BST) thin films have been prepared from barium 2-ethylhexanoate [Ba[CH3(CH2)3CH(C2H5)CO2]2], strontium 2-ethylhexanoate [Sr[CH3(CH2)3CH(C2H5)CO2]2] and titanium(IV) isopropoxide [TiOCH(CH3)2]4 precursors using a modified sol-gel technique. The precursor except [TiOCH(CH3)2]4 were synthesized in the laboratory. Transparent and crack-free films were fabricated on pre-cleaned quartz substrates by spin coating. The structural and optical properties of films annealed at different temperatures have been investigated. The as-fired films were found to be amorphous that crystallized to the tetragonal phase after annealing at 550degreeC for 1h in air. The lattice constants "a" and "c" were found to be 3.974A and 3.990A, respectively. The grain...

CERN Document Server

We report Sr, Pd and Ag abundances for a sample of metal-poor field giants and analyze a larger sample of Y, Zr, and Ba abundances. The [Y/Zr] and [Pd/Ag] abundance ratios are similar to those measured for the r-process-rich stars CS 22892-052 and CS 31082-001. The [Pd/Ag] ratio is larger than predicted from the solar-system r-process abundances. The constant[Y/Zr] and [Sr/Y] values in the field stars places strong limits on the contributions of the weak s-process and the main s-process to the light neutron-capture elements. Stars in the globular cluster M 15 possess lower [Y/Zr] values than the field stars. There is a large dispersion in [Y/Ba]. Because the r-process is responsible for the production of the heavy elements in the early Galaxy, these dispersions require varying light-to-heavy ratios in r-process yields.

Energy Technology Data Exchange (ETDEWEB)

New phosphates with NaZr{sub 2}(PO{sub 4}){sub 3} structure of the B{sub 0.5}FeTa(PO{sub 4}){sub 3}-type (where B-Ca, Sr, Ba) are synthesized and characterized by X-ray diffraction analysis and IR-spectroscopy. The heating behavior of the phosphates is studied using high-temperature X-ray crystallography in the range 15-625 deg. C. The unit-cell parameters, the coefficients of thermal expansion {alpha}{sub a}, {alpha}{sub c} and their thermal expansion anisotropy |{alpha}{sub c} - {alpha}{sub a}| of the phosphates under study are determined and the dependences of these characteristics on the nature of cations are established and analyzed.

International Nuclear Information System (INIS)

Spectral-luminescent characteristics of Sr2Y8(SiO4)6O2: Eu powder crystal phosphor with the apatite structure and high-intensity luminescence of Eu3+ ions have been studied. The charge state of europium in the samples has been characterized by means of X-ray L3-adsorption spectroscopy. It was established that Eu3+ forms two types of optical centers. Besides, luminescence of Eu2+ions was found. Reduction Eu3+#->#Eu2+ was considered, which may be due to VSr|| vacancy formation in the 4f crystal lattice position and to negative charge transfer by this vacancy to two EuY3+ ions. Thus, in the silicate lattice there exist inhomogeneously distributed oxygen-deficient centers, which are responsible for nonradiative transfer of excitation energy to Eu3+ and Eu2+ ions. To study electron-vibrational interactions in the crystal phosphor samples, their IR and Raman spectra were examined. In the luminescence spectrum of Eu2+, a series ...

Energy Technology Data Exchange (ETDEWEB)

This invention relates to new phosphor materials and to combinatorial methods of synthesizing and detecting the same. In addition, methods of using phosphors to generate luminescence are also disclosed.

International Nuclear Information System (INIS)

We report ab initio calculations of positron wave functions in the high-T/sub c/ superconductors YBa_2Cu_3O_7, Bi_2Sr_2CaCu_2O_8, and Tl_2Ba_2CaCu_2O_8 using the general potential linearized augmented plane-wave method. The calculated positron wave functions are fairly insensitive to whether or not electron-positron correlation is included in the calculation for YBa_2Cu_3O_7 and Tl_2Ba_2CaCu_2O_8, but the calculated positron density is quite sensitive to correlation in Bi_2Sr_2CaCu_2O_8. While the positron wave function samples primarily the chain region in YBa_2Cu_3O_7, the results indicate that positrons should be good probes of the Cu-O layer-derived electronic states near the Fermi energy in Tl_2Ba_2CaCu_2O_8 since a large overlap with these states is predicted.

International Nuclear Information System (INIS)

Novel hybrid organic/inorganic nanocomposites made of metal oxide and conjugated polymer nanocomposite and its application in bulk-heterojunction solar cells were studied. The composite was composed of different concentrations of strontium titanate (SrTiO_3) and polyaniline doped phosphoric acid. The optimum concentration of strontium titanate was found to be 0.2 v/v. An inorganic-organic photovoltaic device with a structure of Ag/Pani-H_3PO_4-SrTiO_3/Al has been fabricated. The ideality factor value of the diode was found to be 1.8. This n value of the diode implies a deviation from ideal junction behaviour. The barrier height #phi#_b value for the diode was found to be 0.56 eV. The Ag/Pani-H_3PO_4-SrTiO_3/Al diode shows a photovoltaic behaviour with a maximum open-circuit voltage V_o_c of 2.49 V, and short-circuit current I_s_c of 5.6 mA under light illumination #lambda# = 460 nm. The conversion ...

International Nuclear Information System (INIS)

Highly conductive biaxially textured RuO_2 thin films were deposited on technically important SiO_2/Si substrates by pulsed laser deposition, where yttria-stabilized zirconia (YSZ) produced by ion-beam-assisted-deposition (IBAD) was used as a template to enhance the biaxial texture of RuO_2 on SiO_2/Si. The biaxially oriented RuO_2 had a room-temperature resistivity of 37 #mu##OMEGA#-cm and residual resistivity ratio above 2. We then deposited Ba_0_._5Sr_0_._5TiO_3 thin films on RuO_2/IBAD-YSZ/SiO_2/Si. The Ba_0_._5Sr_0_._5TiO_3 had a pure (111) orientation normal to the substrate surface and a dielectric constant above 360 at 100 kHz. copyright 1998 Materials Research Society.

International Nuclear Information System (INIS)

M-type hexagonal ferrite composition, Ba(1-x)SrxFe12O19 (x=0.0, 0.2, 0.4, 0.6, 0.8 and 1.0), was prepared by a two route ceramic method. Complex permittivity (?'-j?'') and complex permeability (?'-j?'') have been measured using a network analyzer from 8.2 to 12.4 GHz X-ray diffraction confirmed the M-type hexagonal structure and a scanned electron micrograph was used to analyze the grain size distribution of ferrite. Substitution of Sr2+ ions causes an increase in porosity that deteriorates the electromagnetic and microstructural properties in the doped samples. Both dielectric constant and dielectric loss are enhanced in comparison to the permeability and magnetic loss over the entire frequency region. This is due to a resistivity variation and the formation of Fe2+ ions, which increases the hopping mechanism between Fe2+ and Fe3+ ions.

International Nuclear Information System (INIS)

The layered GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# (GBSC) perovskite oxides are synthesized by modified Pechini method and investigated as a novel cathode material for solid oxide fuel cells (SOFCs) based on a stable perovskite oxide BaCe_0_._5Zr_0_._3Y_0_._1_6Zn_0_._0_4O_3_-_#delta# (BCZYZ) as electrolyte. The fabricated single cells of NiO-BCZYZ/BCZYZ (#approx#20 #mu#m)/GBSC (#approx#20 #mu#m) were operated from 550 to 700 "oC with humidified hydrogen (#approx#5% H_2O) as fuel. The BCZYZ perovskite electrolyte was completely dense after sintered at 1250 "oC for 5 h, lower than that without zinc dopant about 150 "oC. An open circuit voltage of 1.009 V and a maximal power density of 0.35 W cm"-"2 were achieved at 700 "oC. The interfacial polarization resistance was as low as 1.46, 0.45, 0.25 and 0.15 #OMEGA# cm"2 at 550, 600, 650 and 700 "oC, respectively. The ratio of polarization resistance to total cell resistance decreased ...

Energy Technology Data Exchange (ETDEWEB)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ({sup ...

International Nuclear Information System (INIS)

BaZr_0_._1Ce_0_._7Y_0_._2O_3_-_#delta# (BZCY7) exhibits adequate proton conductivity as well as sufficient chemical and thermal stability over a wide range of SOFC operating conditions, while layered GdBa_0_._5Sr_0_._5Co_2O_5_+_#delta# (GBSC) perovskite deposited on a doped ceria electrolyte demonstrates advanced electrochemical properties. This research fully takes advantage of these advanced properties and develops novel protonic ceramic membrane fuel cells (PCMFCs) of Ni-BZCY7|BZCY7|GBSC. The results show that the open-circuit potential of 1.003 V, maximum power density of 430 mW cm"-"2, and a low polarization resistance of the electrodes of 0.08 #OMEGA# cm"2 are achieved at 700 "oC. With temperature increases, the total cell resistance decreases, among which electrolyte resistance becomes increasingly dominant over polarization resistance. The results also indicate that GBSC perovskite cathode is a good candidate for ...

British Library Electronic Table of Contents (United Kingdom)

A rapid and cost-effective assessment was required to provide advice to management on the connectivity between juvenile and adult life cycle stages of Baldchin Groper Choerodon rubescens, a labrid endemic to the west coast of Australia, which has high social value, but relatively low commercial fishery importance. To minimise costs we used laser ablation ICP-MS to analyse levels of a small suite of elements (Ca, Mg, Mn, Cu, Zn, Sr, Rb, Ba and Pb) at the margin (adult phase) and core (juvenile phase) of the same otoliths of adult C. rubescens, collected at ten locations in five management zones. The elemental composition of both otolith margins and cores differed significantly among management zones and in some cases among locations within zones. Similarity of the pattern of among-zone elem...

Energy Technology Data Exchange (ETDEWEB)

The distribution of the alkaline earth elements strontium and barium between the solid phases of phosphates of transition elements of group 4 and chloride melts was studied. The distribution coefficients of strontium and barium were found at T = 700-800/sup 0/C. Phosphates of the type NaM/sub 2//sup (IV)/(PO/sub 4/)/sub 3/, where M/sub (IV)/ represents titanium, zirconium, and hafnium, were used as the solid phases. It was established that there is an enrichment of the precipitates with the distributed components. The distribution coefficient depends on the nature of the solid phase and the temperature. It was suggested that M/sup (II)/ x M/sub 4//sup (IV)/(PO/sub 4/)/sub 6/ is formed in processes of distribution, where M/sup (II)/ represents Sr, Ba.

Energy Technology Data Exchange (ETDEWEB)

Specific parts of several plants (fruits, leaves, stem, bark and roots) often used as medicines in the Indian Ayurvedic system have been analysed for 20 elements (As, Ba, Br, Ca, Cl, Co, Cr, Cu, Fe, K, Mn, Mo, Na, P, Rb, Sb, Sc, Se, Sr and Zn) by employing instrumental neutron activation analysis (INAA). The samples were irradiated with thermal neutrons in a nuclear reactor and the induced activity was counted using high resolution gamma ray spectrometry. Most of the medicinal herbs have been found to be rich in one or more of the elements under study. (Author).

International Nuclear Information System (INIS)

New RNAA determinations of Ba, Sr, Zr, U, Re, Pd, Ag, Zn and Se and INAA measurements of Lu are added to published data for 21 other elements in the same suite of ten samples. On the average, 21 refractory elements are not significantly fractionated from one another. The mean of their enrichment factors relative to C1 chondrites is 17.5 +- 0.4, indicating that the high-temperature condensate inclusions represent 5.7 wt% of the total condensable matter. Os, Ir, Ru, Re and most of the W condensed in one or more refractory siderophile element alloys along with small fractions of the Pd, Co, Au and Ag. The bulk of the Eu and Sr condensed in solid solution in melilite. Sc, Zr, Hf, Ta, U and the remaining REE condensed in a phase whose abundance in the inclusions in negatively correlated with that of melilite, either diopside or one or more minor or trace phases, including perovskite. Ba condensed in a ...

CERN Document Server

Aerial picture of BA4 at SPS (LHC T18 building site).

International Nuclear Information System (INIS)

The fundamental optical properties of dysprosium (Dy) doped strontium sulfide bulk samples for various dopant concentrations from 0.1 to 1.0 at.% were investigated by X-ray diffraction (XRD), electron paramagnetic resonance spectroscopy (EPR), room temperature photoluminescence (PL), photoluminescence excitation (PLE) and diffuse reflectance spectroscopy (DRS). Investigations by electron paramagnetic resonance yielded the state of Dy in the sample as Dy3+. An additional ESR line due to F+ center was observed. The PL emission spectrum consisted of several intense lines and a number of weaker ones which were identified as transitions between energy levels of Dy3+. The optimum doping concentration for maximum intensity was found to be 0.25 at.%. Blue shift of the absorption edge energy and red shift of the PLE spectrum were observed with increasing doping concentration. The former is due to Burstein-Moss (BM) effect and the latter is attributed due to the presence of band tailing states.

Science.gov (United States)

Not Available

Medline Plus

... There has been a role for placement of yttrium or radioactive phosphorous in a tumor called craniopharyngioma, ...

Science.gov (United States)

(Watkins and. Corbett,. 1964) which is a phosphorous-vacancy complex, i.e., ...... Grover. 1965. Semiconductor. Surfaces. ...

International Nuclear Information System (INIS)

The behavior of afterglow (AG), thermoluminescence (TL), infrared stimulated luminescence (IRSL) and phototransferred TL (PTTL) under thermal and/or infrared (IR) stimulation in blue (470 nm) light illuminated at room temperature (RT) SrAl2O4:Eu2+, Dy3+ is presented. The TL glow curve consists of four peaks with maxima at about 340, 430, 560 and 680 K. The 340 and 440 K peaks are described well by second order kinetics with activation energies of 0.83 and 1.05 eV, respectively. The AG decay is fitted by the Becquerel's law with exponent 1.5 and correlates well with the thermal emptying of the traps responsible for the 340 K peak. The 340 and 430 K TL peak traps are destroyed under IR (830 nm) stimulation creating IRSL. IR stimulation after illumination with blue light and preliminary heating restore partially the 340 and 430 K TL peaks by phototransfer from deeper traps. The shape of the IRSL decay curves depends strongly on the preheating temperature and is ...

International Nuclear Information System (INIS)

Oxide superconducting thin films were irradiated with X-rays and ultra-violet (UV) light, and induced radiation effects on electrical and chemical properties were examined by transport measurement, X-ray diffraction analysis (XRD), diamagnetization measurement and X-ray photoemission spectroscopy (XPS). After irradiation for ErBa_2Cu_3O_x films with X-rays emitted from a Rh tube for 100 hours, superconductivity was remarkably damaged, destroying the zero-resistance state. The UV-light irradiation for Bi_2Sr_2CaCu_2O_x films was performed in He gas of about 500 Pa with a low pressure mercury lamp. The superconductivity was gradually degraded with the UV irradiation time up to 70 minutes. In both cases, adequate oxygen-annealing treatments restored superconductivity. The X-ray photoemission spectra showed that the mean Cu valence of the films was decreased approximately from +2 to +1 by the irradiation. From these results we can find that ...

Energy Technology Data Exchange (ETDEWEB)

A single crystalline ternary nanostructure having the formula A.sub.xB.sub.yO.sub.z, wherein x ranges from 0.25 to 24, and y ranges from 1.5 to 40, and wherein A and B are independently selected from the group consisting of Ag, Al, As, Au, B, Ba, Br, Ca, Cd, Ce, Cl, Cm, Co, Cr, Cs, Cu, Dy, Er, Eu, F, Fe, Ga, Gd, Ge, Hf, Ho, I, In, Ir, K, La, Li, Lu, Mg, Mn, Mo, Na, Nb, Nd, Ni, Os, P, Pb, Pd, Pr, Pt, Rb, Re, Rh, Ru, S, Sb, Sc, Se, Si, Sm, Sn, Sr, Ta, Tb, Tc, Te, Ti, Tl, Tm, U, V, W, Y, Yb, and Zn, wherein the nanostructure is at least 95% free of defects and/or dislocations.

Energy Technology Data Exchange (ETDEWEB)

Recently, the lithium ion-conductive solid electrolyte draws attention because there is a possibility of producing the maintenance-free battery which is characterized by having such advantages as high energy density and no possibility of electrolyte leak because of solid state structure. The invented lithium ion-conductive solid electrolyte is formed by sintering the granular electrolyte expressed in the following general formula: Li(1+(4-n)x)MxTi(2-x)(PO4)3 (M = mono- or di-valent cation, x = 0.1 - 0.5). Examples of the monovalent cation are Na[sup +], K[sup +], Rb[sup +], Cs[sup +], and Cu[sup +]. Examples of divalent cation are Mg[sup 2+], Fe[sup 2+], Be[sup 2+], Ca[sup 2+], Sr[sup 2+], Ba[sup 2+], Ra[sup 2+], Mn[sup 2+], Co[sup 2+], Cu[sup 2+], Ni[sup 2+], Zn[sup 2+], and Cd[sup 2+]. The electric conductivity of lithium ion is increased with the increase in the content of Li[sup +] in the electrolyte. 4 figs.

International Nuclear Information System (INIS)

Results of our systematic NMR study in high T_c cuprates are reviewed. The antiferromagnetic spin fluctuations (AFSF) decrease in the order of La_1_._8_5Sr_0_._1_5CuO_4. YBa_2Cu_3O_7 and Tl_2Ba_2CuO_6_+_y. 1/T_1 of "6"3Cu in the CuO_2 plane in the normal state follows essentially a Curie-Weiss law at high temperature and T_1T = const. law at low temperature. The temperature dependence of 1/T_1 and the Knight shift together with their impurity effect in the superconducting state strongly suggest d-wave pairing implying the AFSF to be responsible for the occurrence of superconductivity. From the NQR frequency measurement the density of Cu 3d and O 2p holes decreases and increases, respectively, in the order of La, Y and Tl compounds, which is consistent with the change of AFSF. The relation between T_c and #nu#_Q, and their pressure dependence suggest that there exists and optimum value of the ratio of Cu 3d and O 2p hole density to give a ...

Energy Technology Data Exchange (ETDEWEB)

A simple and rapid method is described for the determination of major and trace elements in rock and sediment samples by wavelength dispersive XRF. Sample measured were made from cellulose powder pressed into 4 cm diameter aluminium ring 0.4 t cm/sup -2/, and then 1 g of powdered sample (0.08 g cm/sup -2/) was placed on the disk and repressed at 1.6 t cm/sup -2/. X-ray measurements were performed for total XRF intensity (I/sub p/) at the characteristic line of each element and background intensity (I/sub b/) in vicinity of the line. The correction of matrix effect was achieved by X-ray intensity ratio of peak to background for each element. Eight standard rock samples from Geological Survey of Japan were used as standard materials, and linear calibration curves were obtained by the plot of I/sub p/ - I/sub b/ vs. concentration for Ca, Na and Pb and by the plot of I/sub p//I/sub b/ ratio vs. concentration for Si, Fe, Ti, K, P, Cl, Cr, Mn, Ni, Cu, Zn, Pb, Sr and ...

Science.gov (United States)

Polymethlylmethacrylate (PMMA) is the most frequently used cement for percutaneous vertebroplasty and kyphoplasty. To aid visualisation during surgery cements are doped with radiopacifying agents such as Barium sulphate (Ba(2)SO(4)) or Zirconium Dioxide (ZiO(2)). Mounting research suggests that these agents may impair the biocompatibility of the cements. However, incorporating an alternative radiopacifier agent with excellent biocompatibility would be a significant step forward. Bioactive radiopaque glasses incorporating elements such as strontium (Sr) and zinc (Zn), known to have beneficial and therapeutic effects on bone, are of great interest in this respect. In this study, the Ba(2)SO(4) of the commercially available Spineplex was incrementally replaced with a radiopaque therapeutic glass composition. The resulting effects on cement setting time, peak isotherm, ultimate compressive strength, Young's modulus (up to 30 ...

International Nuclear Information System (INIS)

1 - Description of program or function: MCB-JEF2.2 is a continuous-energy cross section libraries in ACE Format suitable for the MCB-1C and MCNP codes. Libraries for various materials were generated at six different Temperatures, and cover the energy range up to 20 MeV. Format: ACE. Number of groups: Continuous energy. Nuclides: H-1, H-2, H-3, He-3, He-4, Li-6, Li-7, Be-9, B-10, B-11, C-nat., N-14, N-15, O-16, O-17, Na-23, F-19, Mg-nat., Al-27, Si-nat., P-31, S-32, S-33, S-34, S-36, Cl-nat, K-nat, Ca-nat., Ti-nat, V-nat, Cr-50, Cr-52, Cr-53, Cr-54, Mn-55, Fe-54, Fe-56, Fe-57, Fe-58, Co-59, Ni-58, Ni-59, Ni-60, Ni-61, Ni-62, Ni-64, Cu-nat, Ga-nat, Ge-72, Ge-73, Ge-74, Ge-76, As-75, Se-74, Se-76, Se-77, Se-78, Se-80, Se-82, Br-79, Br-81, Kr-78, Kr-80, Kr-82, Kr-83, Kr-84, Kr-85, Kr-86, Rb-85, Rb-86, Rb-87, Sr-84, Sr-86, Sr-87, Sr-88, Sr-89, Sr-90, Y-89, Y-90, ...

International Nuclear Information System (INIS)

The electronic structures of BaSnO_3, BaSbO_3, and BaPbO_3, calculated using an extended general-potential linearized augmented-plane-wave method, are reported. The electronic structures of BaSnO_3 and its 6s analog BaPbO_3 are found to be very different, explaining the absence of superconductivity in the Ba(Sn,Sb)O_3 system. These differences are explained by a combination of the relativistic lowering of the 6s states and ion-size effects. Muffin-tin-approximation augmented-plane-wave calculations for BaSnO_3 are also reported and the utility of the muffin-tin approximation for this and similar materials is discussed in terms of the differences between the two sets of calculations.

International Nuclear Information System (INIS)

Full text: It was recently-established for hexagonal barium ferrite-industrially important magnetically hard material that refinement of the crystallite dimensions into the nanoscale regime, typically #<=# 10 nm, leads after heat treatment at temperatures 800-1000 deg C to significant coercivity increase of up to 6.5 kOe (#approx#3-4 times) with saturation magnetisation values of 50-55 emu/g (#approx#95% of bulk at room temperature). High-energy mechanochemical processing has been applied to prepare nanostructural (nanocrystalline-amorphous) composites. High resolution electron microscopy studies reveal that the enhancement of the final magnetic properties was due to formation of magnetically noninteracting #approx#l,#mu#m Ba-ferrite particles with 5-10 nm amorphous surface layer - depending on annealing parameters. Similar situation was established also for ball milled strontium ferrite (SrFe_1_2O_1_9) powders where short annealing 4 h at ...

Energy Technology Data Exchange (ETDEWEB)

The inhibiting effects of two mineral compounds on corrosion of nickel in phosphoric acid (H[sub 3]PO[sub 4]) polluted by sulfide ions (S[sup 2[minus

Energy Technology Data Exchange (ETDEWEB)

Low-temperature specific-heat measurements have been carried out between 0.5 and 30--50 K on the high-T/sub c/ copper oxide superconductors La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and RBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ (R = Y, Eu, Ho, Tm, and Yb). The specific heat of the La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and YBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ compounds below T/sub c/ can be resolved into a contribution of the form C/sub e/(T) = ..gamma..'T with a finite ..gamma..' and a lattice contribution that consists of Debye and Einstein terms. Specific-heat data for the RBa/sub 3/Cu/sub 3/O/sub 7-//sub delta/ compounds with R = Ho, Tm, and Yb exhibit no features due to magnetic order above 0.5 K, but reveal electronic Schottky anomalies associated with crystalline electric field (CEF) splitting of the Hund's-rules ground-state multiplet of the R/sup 3+/ ions. The Schottky anomalies can be described by ...

Science.gov (United States)

The biological age (BA) of the majority of the liquidators of the consequences of the radiation accidents in the Navy and of the liquidators of the Chernobyl' APS accident exceeds the medium standard and the DBA (due BA). The index of the BA can be a characteristic of the influence of the social-hygienic factors on the health condition of the Special Risk Subunit--the liquidators of the consequences of the radiation accidents. It was established, that the radiation influence concerns to the factors dramatically increasing the BA and the rate of senescence of the liquidators of the consequences of the radiation accidents. PMID:21809627

International Nuclear Information System (INIS)

This study was carried out mainly to produce uranium trioxide (UO_3), with the standard of commercial specifications from rock phosphate deposits in eastern part of Nuba mountains, south Kurdufan state. A simplified hydrometallurgical procedure has been adopted for production of yellow cake from the ore. Elemental analysis has shown that the ore is rich in Ca and deficient in elements of potential interest such as Fe, Cu and Zn. Uranium content in ore, phosphoric acid and purified yellow cake (UO_3) obtained with different precipitants was analyzed using alpha-spectrometry. On the average, the activity concentration of uranium in ore corresponds to 82 #+-# 24 ppm (0.10%). From the data of pregnant liquor, it was observed that the addition of KCIO_3 as an oxidant improves the dissolution of uranium from the ore by almost 20%. Data has also indicated that the yellow cake purified by hydrogen peroxide has higher concentration of uranium by 44.5% over the one purified ...

International Nuclear Information System (INIS)

The complex phase relationships near the BaO-poor region of the quaternary Ba-Sm-Y-Cu-O oxide system prepared in pure air (pO2=22 kPa, 950 oC) and in 0.1% O2 (pO2=100 Pa, 810 oC) have been determined. This investigation also included the subsolidus compatibilities in ten subsystems (Ba-Sm-Y-O, Ba-Sm-Cu-O, Ba-Y-Cu-O, Sm-Y-Cu-O, Ba-Sm-O, Ba-Y-O, Ba-Cu-O, Sm-Y-O, Sm-Cu-O, and Y-Cu-O), and the homogeneity range of five solid solutions (Ba(SmxY2-x)CuO5, (Sm,Y)2O3, (Sm,Y)2CuO4, (Y,Sm)2Cu2O5, and Ba(Sm,Y)2O4). The single phase range of the superconductor solid solution, (Ba2-xSmx)(Sm1-yYy)Cu3O6+z, and the phase compatibilities in its vicinity, which are particularly important for processing, are described in detail. The phase equilibrium data of the ...

International Nuclear Information System (INIS)

Various compositions of Y(Ta,Nb)O4:Eu3+,Tb3+ with different Nb and activator concentrations have been investigated under UV and VUV excitation. Some compounds with very strong emission under VUV excitation were found. Such phosphors could be proposed as very good emissive materials for Displays and Lightings. The growing interest in luminescence spectroscopy of rare earth ions in the vacuum ultraviolet (VUV) and the visible (VIS) spectral range is due to industrial demands for new applications. YTaO4 and YNbO4 phosphors are a perspective class of efficient materials that are generally used in X-ray intensifying screens. These phosphors exhibit satisfying luminescence whenever excited by UV light, cathode radiation or X ray. However, to our knowledge, no work has been published on the VUV-excited luminescence for Eu3+ and Tb3+ double activated yttrium niobate and yttrium tantalate based phosphors. In ...

International Nuclear Information System (INIS)

The University of Georgia, in collaboration with GE Global Research, has investigated the relevant quenching mechanism of phosphor coatings used in white light devices based on UV LEDs. The final goal of the project was the design and fabrication of a high-efficacy white light UV-LED device through improved geometry and optimized phosphor coatings. At the end of the research period, which was extended to seamlessly carry over the research to a follow-up program, we have demonstrated a two-fold improvement in the conversion efficiency of a white light LED device, where the increase efficacy is due to both improved phosphor quantum efficiency and lamp geometry. Working prototypes have been displayed at DOE sponsored meetings and during the final presentation at the DOE Headquarters in Washington, DC. During the first phase of the project, a fundamental understanding of quenching processes in UV-LEDs was obtained, and the ...

International Nuclear Information System (INIS)

Elemental substitution of Ca by Y was investigated for Ca-#alpha#-SiAlON:Eu yellow phosphors, which is useful for the white light-emitting diode lamps of phosphor conversion type. Depending on the ratio of the elemental substitution, not only the red shift of emission in wavelength occurred but also the figure of the excitation spectra changed. Their excitation band widths and flatness were discussed. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

International Nuclear Information System (INIS)

Total mercury (THg), methylmercury (MeHg) and 22 other trace elements were measured in ice algae, three species of zooplankton, mixed zooplankton samples, Arctic cod (Boreogadus saida), ringed seals (Phoca hispida) and eight species of seabirds to examine the trophodynamics of these metals in an Arctic marine food web. All samples were collected in 1998 in the Northwater Polynya (NOW) located between Ellesmere Island and Greenland in Baffin Bay. THg and MeHg were found to biomagnify through the NOW food web, based on significant positive relationships between log THg and log MeHg concentrations vs. #delta# "1"5N muscle and liver . The slope of these relationships for muscle THg and MeHg concentrations (slope = 0.197 and 0.223, respectively) were similar to those reported for other aquatic food webs. The food web behavior of THg and #delta# "1"5N appears constant, regardless of trophic state (eutrophic vs. oligotrophic), latitude (Arctic vs. tropical) or salinity (marine vs. freshwater) ...

International Nuclear Information System (INIS)

Description of problem or function: Format: EXREM III; Nuclides: radioactive decay data on 252 Nuclides: 1H-3, 4Be-7, 6C-11, 6C-14, 7N-13, 8O-15, 9F-18, 11Na-22, 11Na-24, 12Mg-28, 13Al-28, 15P-32, 15P-33, 16S-35, 17Cl-36, 17Cl-38, 18A-37, 18A-39, 19K-40, 19K-42, 19K-43, 20Ca-45, 20Ca-47, 20Ca-49, 21Sc-46, 21Sc-47, 21Sc-49, 24Cr-51, 25Mn-52M, 25Mn-52, 25Mn-54, 26Fe-52, 26Fe-55, 26Fe-59, 27Co-56, 27Co-57, 27Co-58, 27Co-60, 28Ni-56, 28Ni-63, 29Cu-64, 30Zn-65, 30Zn-69M, 30Zn-69, 31Ga-67, 31Ga-68, 32Ge-77, 33As-76, 33As-77, 34Se-75, 35Br-80M, 35Br-80, 35Br-82, 35Br-83, 35Br-84, 36Kr-79, 36Kr-83M, 36Kr-85M, 36Kr-85, 36Kr-87, 36Kr-88, 37Rb-84, 37Rb-86, 37Rb-87, 37Rb-88, 37Rb-89, 37Rb-90M, 37Rb-90, 38Sr-85, 38Sr-87M, 38Sr-89, 38Sr-90, 38Sr-91, 38Sr-92, 38Sr-93, 39Y-87, 39Y-88, 39Y-90, 39Y-91M, 39Y-91, 39Y-92, 39Y-93, 40Zr-93, 41Nb-93M, 40Zr-95, ...

Science.gov (United States)

... }wtv{tv|l^\\h xuwxsqs |qhlnnusnvsqvwzvsrsstrpokfb`ba`]chc][TSWg nkjsrkjkdcenz |{|{{{w khghfbddkmhkljnkeexhgrnimppqsovr|umnmgloplqqqv ~soljowwvvt{|rsuqtp ...

UK PubMed Central (United Kingdom)

The structure of the title compound, Sr-bearing oxonitrido­aluminosilicate (Sr-sialon), contains two types of channels running along the a axis, with the three unique Sr atoms...Full Text Available

International Nuclear Information System (INIS)

... isobaric analogs mev range 01-10 neutrons nuclear reactions nuclear theory

International Nuclear Information System (INIS)

The aims of investigation were to follow the Sr transport in the food chain from the flora to the fauna and humans, and its dependence on the geological origin og the plant site, industrial emissions, the age and site of plants, the part of plant used for nutrition and the strontium content in the drinking water, to determine the Sr intake of humans with the help of the duplicate method, and to estimate the apparent absorption rate and balance of strontium depending on of the form of diet (mixed or ovolactovegetarian), sex, season, age, region (geological origin of the living space) and method of intake measurement (duplicate or basket method). Strontium, an ultra trace element widespread in the earth's crust, is not essential and only mildly toxic for plants, animals and man according to current knowledge. The biological essentiality of Sr has not been investigated yet. Amoeba species living in sea water use ...

International Nuclear Information System (INIS)

The unknow parities of five strong dipole states between 6 and 8 MeV in "8"8Sr are shown to be negative. (orig.).

International Nuclear Information System (INIS)

... levels excited states mev range 10-100 proton reactions proton spectra protons

International Nuclear Information System (INIS)

The local environment of Ca dopants in barium titanate, BaTiO_3, is investigated by Ca K-edge X-ray absorption near-edge structure (XANES) spectroscopy. In conjunction with experiments, first-principles calculations by two methods are systematically made. The projector-augmented wave (PAW) method is used to optimize the local structure and obtain the formation energy. The augmented plane wave plus local orbitals method is adopted to obtain theoretical XANES spectra. A comparison between experimental and theoretical XANES spectra shows that Ca dopants are located at the Ba"2"+ sites forming Ca"2"+. Formation energy calculations of Ca doped BaTiO_3 by the PAW method also give the same results. The Ca atom in BaTiO_3 is off-centering in comparison with the Ba site in BaTiO_3. The off-centering of Ca atom is newly revealed by the combination of XANES spectroscopy ...

International Nuclear Information System (INIS)

AIM: To define the value of digital radiography with a clinical flat panel detector system for evaluation of wrist fractures in comparison with state of the art storage phosphor radiography. MATERIAL AND METHODS: Hard copy images of 26 fractured wrist specimens were acquired with the same exposure dose on a state of the art storage phosphor radiography system and a clinical flat panel detector. Image features like cortical bone surface, trabecular bone, soft tissues and fracture delineation were independently analysed by 4 observers using a standardised protocol. Image quality ratings were evaluated with an analysis of variance (ANOVA). RESULTS: Flat panel detector radiographs were rated superior with respect to cortical and trabecular bone representation as well as fracture evaluation, while storage phosphor radiographs produced better soft tissue detail. CONCLUSION: In some of the observed image quality aspects, the ...

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

KoreaScience (Korea)

Full Text Available

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

Energy Technology Data Exchange (ETDEWEB)

Many thermoluminescent materials has been developed and used for photon personal dosimetry but no one has all desired characteristics alone. These characteristics include robustness, high sensitivity, energy photon independence, large range of photon energy detection, good reproducibility, small fading and simple glow curve with peaks above 150 deg C. Calcium Sulfate Dysprosium doped (CaSO{sub 4}:Dy) phosphor Thermoluminescent Dosimeter (TLD) has been used by many laboratories, mainly in Brazil and India. Another interesting phosphor is Calcium Fluoride (CaF{sub 2}). These phosphor advantages begin to be more required and its disadvantages have became more apparent, in a global market more and more competitive. These phosphors are used in environmental and area monitoring, once they present more sensibility than other phosphors, like LiF:Mg. Theirs mainly disadvantage is a strong ...

British Library Electronic Table of Contents (United Kingdom)

A novel microcapsule adsorbent for separation of uranium from phosphoric acid solutions was developed by immobilizing the di(2-ethylhexyl) phosphoric acid-?trioctyl phosphine oxide extractants in the polymeric matrix of calcium alginate. Physical characterization of the microcapsules was accomplished by scanning electron microscopy and thermogravimetric techniques. Equilibrium experiments revealed that both ion exchange and solvent extraction mechanisms were involved in the adsorption of Formula Not Shown ions, but the latter prevailed in a wider range of acid concentration. According to the results of kinetics study, at low acidity level, the rate controlling step was slow chemical reaction of Formula Not Shown ions with the microdroplets of extractant, whereas it changed to intraparticle...

International Nuclear Information System (INIS)

Luminescence properties of SiAlON phosphors codoped with Ca and Yb were investigated by changing the host lattice composition. These modifications of the host lattice were obtained by replacing Si-N bonds by Al-N and Al-O bonds. Their photoluminescence (PL) and cathodoluminescence (CL) properties were measured and compared with each other. PL allows observing the influence of the host lattice modifications by measuring wider areas. CL can excite all luminescent centers, in particular the UV luminescence centers, even if their amount is small. Thus, two additional peaks in the ultraviolet and infrared regions were observed in CL, which is not observed by PL. This work suggests that the combination of PL and CL gives more understanding about the luminescence of SiAlON phosphors, in particular the role of the secondary phases on their properties.

British Library Electronic Table of Contents (United Kingdom)

The main objective of this work was to investigate the biosorption performance of unmodified and Cetylpyridinium chloride (CPC)-modified biomass of Penicillium YW 01 for Acid Blue 25 (AB 25). Maximum biosorption capacity of AB 25 onto CPC-modified biosorbent was 118.48mgg^-^1 under phosphoric-phosphate buffer with initial dye concentration of 200mgL^-^1 at 30^oC. The biosorption pattern of AB 25 onto unmodified biosorbent in aqueous solution and phosphoric-phosphate buffer was well fitted with both Langmuir and Freundlich isotherm models. While the equilibrium data of CPC-modified biosorbent in aqueous solution and phosphoric-phosphate buffer failed to fit the Freundlich isotherm model, indicating the monolayer biosorption formed onto CPC-modified biosorbent. The values of initial biosorpt...

International Nuclear Information System (INIS)

Focused ion beam (FIB) processes have been developed for Y--Ba--Cu--O superconductor films. A Y--Cu liquid metal ion source has been fabricated, using a Y_6_7 --Cu_3_3 eutectic alloy as the ion source. As-sputtered Y--Ba--Cu--O film etch rate ratios to GaAs(100) and Si(100) substrates are 0.28 and 1.4 for 130-keV Au"+ FIB ion etching, respectively. Y--Ba--Cu--O submicron patterns have been demonstrated by using FIB lithography and Cl_2 reactive ion beam etching. Moreover, a Y--Ba--Cu--O superconducting line with 4-#mu#m linewidth has been fabricated by annealing an as-sputtered Y--Ba--Cu--O line pattern. T/sub c/ control of Y--Ba--Cu--O film has been achieved by 200-keV Ne"+, using conventional ion implantation and 300 keV Si"+"+ FIB ion implantation.

Science.gov (United States)

... Two types of combustible cartridge cases, post impregnated (PI) and beater additive (B/A) are available for the 120 mm tank gun system. ...

KoreaScience (Korea)

Full Text Available

CERN Document Server

We report a measurement of the branching fractions for $B^{0} \\rightarrow \\pi^- \\ell^+\

Science.gov (United States)

... estrogen receptor status. Cancer Lett., 253, 291-300. 39. Xin,X ... and resistant mice. Brain Res.Bull., 52, 235-242. 40. Foster,BA ...

Science.gov (United States)

... Voltage noise power spectral density measurements as a function of temperature, frequency, current, and magnetic field on DyBa2Cu3O7.x (DBCO ...

International Nuclear Information System (INIS)

The kinetics of the reactions between mixed powders of BaCO_3 and CuO, as well as BaCO_3 and Y_2O_3, have been studied using DXRD techniques as a function of particle size, temperature, and CO_2 pressure. Except for initial nucleation phenomena, the reaction rates are governed by shrinking core behavior for BaCO_3 particle sizes between 6 and 33 #mu#m. During the initial stages of the reactions, the surface reaction kinetics are governing, whereas the diffusion of CuO, Y_2O_3, and CO_2 are limiting factors at later stages in the reactions. Quantitative conversion data were used to determine the values of the activation energies and the pertinent diffusivities in these systems.

Energy Technology Data Exchange (ETDEWEB)

A permeable reactive mixture has been developed using low cost, readily available materials that is capable of providing effective, long-term phosphorous treatment in areas impacted by on-land wastewater disposal. The reactive mixture creates a geochemical environment suitable for P-attenuation by both adsorption and precipitation reactions. Potential benefits include significant reductions in phosphorous loading to receiving groundwater and surface water systems, and the accumulation of P-mass in a finite and accessible volume of material. The mixture may be applied as a component within surface treatment systems or in subsurface applications such as horizontal or vertical permeable reactive walls. The mixture averaged > 90% treatment efficiency over 3.6 years of continuous-flow laboratory column experiments. The mixture was further evaluated at the pilot-scale to treat municipal wastewater, and the field-scale to treat a well-characterized ...

International Nuclear Information System (INIS)

The #gamma#-ray spectrum emitted after thermal neutron capture in "8"7Sr was studied at the ILL high flux reactor with pair- and intrinsic Ge-spectrometers. 661 transitions were assigned to the reaction "8"7Sr(n,#gamma#)"8"8Sr and 205 of them were placed into a "8"8Sr level scheme of 47 levels. This represents 88% of the observed intensity. The level energies were determined with a precision of better than 22 ppm; the neutron binding energy was determined as 11 112.69 (22) keV. To aid the analysis high resolution particle spectra of the reaction "8"7Sr(d,p)"8"8Sr were measured at 20 MeV deuteron energy with the Munich Q3D spectrometer. 85 states were observed with this reaction. The data helped to establish newly found levels and to differentiate between primary and secondary transitions in the (n,#gamma#) data. The observed level densities and primary ...

Energy Technology Data Exchange (ETDEWEB)

Single crystals of RbBaTaS{sub 4} (1) and K{sub 2}BaTa{sub 2}S{sub 11} (2) were obtained from the reactions of Ta, with in situ formed fluxes of A{sub 2}S{sub 3} (A = K, Rb), BaS, and S at 500 C. Compound 1 crystallizes in the orthorhombic space group Pnma with a = 9.3286(5), b = 7.0391(4), c = 12.4365(7) A, V = 816.6(1) A{sup 3}, Z = 4. Compound 2 crystallizes in the monoclinic space group P2{sub 1}/c with a = 14.5280(10), b = 12.6347(7), c = 17.5148(12) A, {beta} = 94.744(8) , V = 3203.9(4) A{sup 3}, Z = 4. The structure of RbBaTaS{sub 4} (1) consists of isolated tetrahedral [TaS{sub 4}]{sup 3-} anions and Rb{sup +} and Ba{sup 2+} cations. The Ba{sup 2+} cations are surrounded by nine sulfur atoms forming distorted tricapped trigonal prisms, whereas the Rb{sup +} cations are in an irregular environment of ten sulfur atoms. The structure of K{sub ...

Energy Technology Data Exchange (ETDEWEB)

The g factors of the 2/sub 1//sup +/ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g(/sup 84/Sr)= + 0.419(47), g(/sup 86/Sr)= + 0.273(50) and g(/sup 88/Sr)= + 1.15(17). The mean lifetimes of the 2/sub 1//sup +/ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions.

International Nuclear Information System (INIS)

The valence and spin-state distributions of Co ions and the complex structure of antiferromagnetic Ba_2Co_9O_1_4 have led to the suggestion that doped Ba_2Co_9O_1_4 compounds may be good thermoelectric materials. We have checked this suggestion by measuring the magnetic properties as well as the transport properties of nominal Ba_1_._9A_0_._1Co_9O_1_4 (A=La or Na). We show that although all compounds are indicated to be single phase by powder X-ray diffraction analysis, they are all p-type polaronic conductors with low mobile-hole concentrations. Magnetic-susceptibility data of the parent and La-doped compounds give evidence of a second magnetic phase with ferromagnetic order setting in below 215 K; but this second phase is not seen in the Na-doped sample. We conclude that the structure is stabilized by oxidation and that cation exolution from the Ba_2Co_9O_1_4 structure creates cation vacancies that ...

International Nuclear Information System (INIS)

Radionuclide x-ray fluorescence analysis was used for the determination of Y, Ba and Cu in thin high-temperature superconducting films. Atomic emission ICP spectrometry was used to estimate the precision and accuracy of analytical results. Reasonable agreement between both methods was obtained when a polynomial calibration curve was applied. (author) 4 refs.; 4 tabs.

Energy Technology Data Exchange (ETDEWEB)

The angular ..gamma gamma..-correlations for nuclei of Sr even-even isotopes with A=82, 84, 86, 88 were measured. Multipole structurs of ..gamma..-transtion series and th coefficients multipole mixing were determined.

Energy Technology Data Exchange (ETDEWEB)

In this letter we report the outcome for the microscopic approach for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. For comparison, we have also treated the semi-phenomenological version for the Migdal and SDI force.

Energy Technology Data Exchange (ETDEWEB)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions /sup 88/Sr(p, p/sub 0/)/sup 88/Sr at 5.06 MeV and /sup 86/Sr(p, p/sub 0/)/sup 86/Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90/sup 0/ and 155/sup 0/ is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d..cap omega..)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction /sup 88/Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d..cap omega..)sub(CE) for the resonance in /sup 86/Sr+p at 6.02 MeV.

Energy Technology Data Exchange (ETDEWEB)

A newly constructed Fourier transform microwave spectrometer has been used to record the pure rotational spectra of four isotopomers of SrS ({sup 88}Sr{sup 32}S, {sup 87}Sr{sup 32}S, {sup 86}Sr{sup 32}S, and {sup 88}Sr{sup 34}S) between 6 and 26 GHz. The molecules were produced by reacting laser ablated strontium with carbonyl sulfide (0.1% in argon). Pure rotational transitions in the ground, first and second vibrational states have been observed. The data set has enabled a multi-isotopomer fit. Born-Oppenheimer breakdown terms for both atoms have been determined. The {sup 87}Sr nuclear quadrupole coupling constant in {sup 87}Sr{sup 32}S has been determined for the first time.

International Nuclear Information System (INIS)

... states gamma radiation mev range 01-10 photonuclear reactions polarization

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

KoreaScience (Korea)

Full Text Available

British Library Electronic Table of Contents (United Kingdom)

We have successfully grown single crystalline Formula Not Shown with the range of Formula Not Shown using the floating-zone method. All compounds show orthorhombic symmetry in this substitution range, but the difference between lattice constants a and b decreases with increasing Sr concentration and becomes almost zero at Formula Not Shown . Characteristic temperatures, which correspond to antiferromagnetic ordering and structural transition, decrease with increasing Sr concentration. The value of the magnetic susceptibility below 30K increases with increasing Sr concentration. The temperature dependence of the electrical resistivity revealed that Sr substitution significantly suppresses the highly anisotropic electric structure of Formula Not Shown .

International Nuclear Information System (INIS)

... bcs theory electron reactions excited states form factors inelastic scattering

Science.gov (United States)

Insect host/parasitoid interactions are co-evolved systems in which host defenses are balanced by parasitoid mechanisms to disable or hide from host immune effectors. Although there is a rich literature on these systems, parasitoid immune-disabling mechanisms have not been fully elucidated. Here we report on a newly discovered immune-disabling mechanism in the Pieris rapae/Pteromalus puparum host/parasitoid system. Because venom injections and parasitization suppresses host phagocytosis, we turned attention to the P. rapae scavenger receptor (Pr-SR), posing the hypothesis that P. puparum venom suppresses expression of the host Pr-SR gene. To test our hypothesis, we cloned a full-length cDNA of the Pr-SR. Multiple sequences alignment showed the deduced amino acid sequence of Pr-SR is similar to scavenger receptors of other lepidopterans. Bacterial and bead injections induced Pr-SR ...

International Nuclear Information System (INIS)

This paper describes stable strontium as composed of four stable isotopes ( Sr 88, Sr 87, Sr 86, and Sr 84), of which Sr 88 contributes more than 82% to its composition. Strontium exists in three crystalline, plymorphic forms; face-centered cubic alpha form, hexagonal beta form and body-centered cubic gamma form. Strontium occupies in many physicochemical aspects an intermediate position between calcium and barium, as does the solubility of strontium salts. As a result of its oxidation potential, strontium readily forms oxides, halides, and sulfide. The author proposes that the slight discrimination against strontium incorporation into bony tissues may be due to the difference in ionic potential (14%) between strontium and calcium. Ionic potential is an indicator of the strength of ionic bonds: strontium has a smaller ratio of ionic charge to ionic radius when compared with calcium.

British Library Electronic Table of Contents (United Kingdom)

Fine-grained BaTiO3-based X7R ceramic materials were prepared and the effects of milling process on the core-shell structures and dielectric properties were investigated using scanning electron microscope, transmission electron microscope, and energy dispersive spectroscopy (EDS). As the milling time extends, the dielectric constant of the ceramics increases, whereas the temperature coefficient of capacitance at 125degreeC drops quickly. The changes in dielectric properties are considered relevant to the microstructure evolution caused by the milling process. Defects on the surface of BaTiO3 particles increase because of the effects of milling process, which will make it easier for additives to diffuse into the interior grains. As the milling time increases, the shell region gets thicker a...

International Nuclear Information System (INIS)

Free Electron Laser (FEL) with the wide wavelength tunability has been developed and used for various applications. The FEL gives high efficiency for the photo-induced ablation when the laser is tuned to an absorption maximum of the target. The FEL was tuned to 9.4 #mu#m, which is an absorption maximum of phosphoric acid ion, a known major component of dentine. The FEL pulse length was several ps. The average output power was varied from 5 to 20 mW by filters. The change of irradiated dentine surface was analyzed by mass spectroscopy and Energy Dispersive X-ray (EDX) spectroscopy. Positive ions which correspond to Na"+, CO_3"+ and many phosphoric acid ions were measured. It was found that atomic ratio of P/Ca had reduced from 0.65-0.60. The atomic ratio of P/Ca, however had not changed with irradiation by Er:YAG laser (2.9 #mu#m), or CO_2 laser (10.6 #mu#m). These results indicate the selective ablation of phosphoric acid ...

Energy Technology Data Exchange (ETDEWEB)

Monitoring brine chemistry to determine the extent of potential adverse reactions has been simplified by the development of a field-brine test kit and a series of nomographs. Results of the kit analyses serve as input to the nomographs, which provide a graphic means of determining the scaling tendency (Saturation Index value) of a brine. Brines that do not tend to form scale may be corrosive. Saturation Index values were correlated with various processes using data from geopressured wells in the Gulf Coast area. Control of scale in surface equipment with chemical inhibitors has been successful. Numerous laboratory simulations of inhibitor squeeze operations were completed using core material with calcite present and absent. The corresponding wells were squeezed with phosphorous-containing inhibitors, and the flowback of brine was monitored for phosphorous concentrations vs time. A new procedure to measure the concentration of ...

Energy Technology Data Exchange (ETDEWEB)

Methods for improving the sensitivity of scintillation cells for radon concentration measurements were studied with emphasis on improving light collection efficiency. This allows the length and hence the volume of the cell to be increased. Variables studied were choice of scintillator material, its method of application and thickness, length of cell, cell material, type and configuration of reflectors, choice of photomultipliers, and factors affecting background. Response from various areas of the cell surface was studied with an alpha source and with radon filling. Coating the window with phosphor was found to be counter-productive. The optimum results obtained were with the inside of the cell (other than the window) covered with a thick layer of ZnS(Ag), or with a thick layer of reflective material coated with a thin layer of phosphor. With it, a 10 cm diameter plexiglass cell can be extended to at least 50 cm length without difficulty from ...

British Library Electronic Table of Contents (United Kingdom)

Lithium phosphorous oxynitride(Lipon) thin films as a lithium ion conductive electrolyte were prepared by radio frequency reactive sputtering in N2 plasma. The properties of the amorphous Lipon solid electrolyte were investigated as a function of N2 pressure during reactive sputtering. The ionic conductivity and the electrochemical stability of Lipon thin films improved drastically as the N2 pressure decreased. The ionic conductivity closed to 10?6 S cm?1 and obtained a stability window of 1.0?5.0 V with an N2 pressure of 5 mTorr, where the number of nitrogen bonds between the phosphate groups were more than those formed at higher pressure. It was possible to fabricate the Li//LiCoO2 complete thin film battery using this Lipon solid electrolyte, which exhibited excellent discharge characte...

Wastenet

... Tschantz, Performance Evaluation of Constructed Urban Stormwater Detention Ponds in the Knoxville Area, proceedings and presentation to International Conference on Decision Making in Urban and Civil Engineering, Lyon, France, November 22, 2000. B.A. Tschanz, Current Problems, Practices, and ...

UK PubMed Central (United Kingdom)

The specific binding of transcription factors to cognate sequence elements is thought to be critical for the generation of specific gene expression programs. Members of the nuclear factor ba;B...Full Text Available

UK PubMed Central (United Kingdom)

SummaryIn the classic example of the McGurk effect, when subjects see a speaker say /ga/ and hear a simultaneous /ba/, they typically perceive /da/, a syllable that was not presented...Full Text Available

International Nuclear Information System (INIS)

The authors have measured the magnetization of single-phase 90-K superconductors, GdBa_2Cu_3O/sub 6+#delta#/, EuBa_2Cu_3O/sub 6+#delta#/, and SmBa_2Cu_3O/sub 6+#delta#/ with a SQUID magnetometer. They have shown that, in the superconducting state, each magnetization-field curve exhibits a maximum at #approx# 100 G, followed by a linear increase of the magnetization with a slope only approximately one-fifth of the slope for a field smaller than 50 G. They have also investigated the effect of #gamma#-irradiation on YBa_2Cu_3O/sub 6+#delta#/, SmBa_2Cu_3O/sub 6+#delta#/, and have found that the radiation damage results in the appearance of a tail in the superconducting transition. They have also shown that the normal resistance decreases with increasing radiation exposure up to a dose of 10 Mrad.

CERN Document Server

The CKM angle $\\gamma/\\phi_{3}$ had been measured by two B-factories, the PEPII collider for the BaBar experiment and the KEKB collider for the Belle experiments. The present paper reports recent progress in $\\gamma/\\phi_{3}$.

Science.gov (United States)

A 12-month program was conducted to advance the technology of the Electrical Discharge Machining (EDM) process to be applicable to the stringent requirements of gun barrel boring and rifling. The type of barrels employed in the test were .220 swift gun ba...

Energy Technology Data Exchange (ETDEWEB)

Semiconducting properties of passive films formed on AISI 304 stainless steel grade were investigated by capacitances measurements in chloride containing aqueous solutions for different surface finishes: BA (bright annealing in hydrogen containing atmospheres) and 2B (standard annealing in oxidising atmospheres followed by pickling in acid, then water rinsing). Mott-Schottky analysis shows that for high enough electrode potential, and whatever the surface finish, the films behave like n-type semiconductors. 2B passive film appears to be more donor-doped than BA one and the density of donor states increases with chloride concentration. The electron donor levels are assumed to be generated by negatively charged cations vacancies produced by the chloride ions reaction with the outer passive film. This reaction looks easier for 2B than BA condition, which explains why BA resists better than 2B to pit ...

UK PubMed Central (United Kingdom)

The sirtuin Sirt6 is a NAD-dependent histone deacetylase that is implicated in gene regulation and lifespan control. Sirt6 can interact with the stress-responsive transcription factor NF-ba;B...Full Text Available

UK PubMed Central (United Kingdom)

Objectives. The inescapable relationship between chronic inflammation and carcinogenesis has long been established. Our objective was to investigate COX-2 and NF-ba;B...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

The effect of additives on the grafting of a monomer, butylmethacrylate (BA), into simul (a soft wood) has been studied using {sup 60}Co source at 3 Mrad. The enhancement of polymer loading (grafting) by the addition of minute amounts (1%) of oligomers and of polyfunctional monomers into simul + BA system has been further increased in the presence of acid and urea. The synergistic polymer loading yields by acid addition cause substantial decrease of tensile strength values of wood-plastic composite; but urea increases both polymer loading and tensile strength values synergistically in these systems. (author).

Energy Technology Data Exchange (ETDEWEB)

The paper demonstrates that the photocatalytic activity of TiO{sub 2} towards the decomposition of gaseous benzene in a batch reactor can be greatly improved by loading TiO{sub 2} on the surface of Sr{sub 2}CeO{sub 4}. The research investigates the optimum loading amount of TiO{sub 2} on Sr{sub 2}CeO{sub 4} in enhancing the photocatalytic activity of TiO{sub 2}. The prepared photocatalyst was characterized by XRD, UV-vis diffuse reflectance and XPS analyses. TiO{sub 2} is loaded on Sr{sub 2}CeO{sub 4} at 773 K. TiO{sub 2}/Sr{sub 2}CeO{sub 4} absorbs much more visible light than TiO{sub 2}. The XPS spectrum shows that there are Ti, O, C, Sr elements on the surface of the TiO{sub 2}/Sr{sub 2}CeO{sub 4}, and that the binding energy value of Ti2p transfers to a lower value. TiO{sub 2}/Sr{sub 2}CeO{sub 4} demonstrates 2.0 times the photocatalytic ...

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

International Nuclear Information System (INIS)

The results are presented of a study in radioactivity of forage (grass, alfalfa, clover), cereals (wheat, oats, rye, barley) and different agriculture products (fodder beet, sugar beet, leguminous plants, poppy, tobacco, maize, potatoes). Total beta activity, "4"0K, "9"0Sr and "1"3"7Cs activities were studied for the period 1962 to 1975 in selected localities in Slovakia. The highest values of "9"0Sr and "1"3"7Cs were measured in 1963, the lowest levels of "9"0Sr in 1975 while the lowest levels of "1"3"7Cs in 1973. (B.S.).

Environmental Research Database

DescriptionThis project has two independent aims: (1) to investigate the use of struvite as an alternative to chemical P fertilisers and (2) to develop an oligonucleotide microarray to monitor the P status of the potato crop. The UK horticultural and agricultural industries rely on large inputs of phosphate (P) fertilisers to maintain crop yields and quality. However, the use of non-renewable, chemical P fertilisers is unsustainable, and the alternatives to chemical P-fertilisers must be identified as an [continued...

Energy Technology Data Exchange (ETDEWEB)

Hydrothermal method for preparing crystal borophosphate with zeolite structure is suggested. To increase absorption capacity and thermal stability of final product, aluminium hydroxide sol, ethylenediamine and ethyl acetate are added to the mixture of crystal boric and concentrated phosphoric acids. Thermal stability of the specimens prepared constitutes 880-950 deg, water absorption capacity is within the limits of 0.30-0.32 cmT/g. 1 table.

British Library Electronic Table of Contents (United Kingdom)

In a suicide committed using aluminium phosphide (AlP) the liberated toxic phosphine gas was detected in post-mortem specimens using a headspace gas chromatographic procedure with a nitrogen-phosphorous detector (HS-GC/NPD). At autopsy a direct sampling into airtight headspace vials for a later analysis is recommended. AlP has to be considered a potent pesticide and its use and availability should be restricted as much as possible.

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

International Nuclear Information System (INIS)

Full text: The surface properties of poly (tetrafluoroethylene) (PTFE) are changed by the exposure to synchrotron radiation (SR). We succeeded in controlling the wettability of the PTFE surface from hydrophobic to hydrophilic by varying the substrate temperature during the SR irradiation and found that the wettability was ascribable to microstructure and chemical composition of surface.In these previous works, oxygen atoms were found to inhabit on the hydrophobic surface of PTFE. In this study, we investigated the surface modification of PTFE from the SR exposure experiment under the O_2 gas atmosphere. The SR exposure to the PTFE sheet was carried out at beamline 6 (BL6) of the New- SUBARU. The PTFE sheet was irradiated to the white beam, ranging 50-1000 eV at BL6 at room temperature. The gas cell was mounted at the irradiation chamber. The O_2 gas pressure in the gas cell can be maintained at about ...

International Nuclear Information System (INIS)

... 900526-11-8 277 p. MATERIALS SCIENCE antiferromagnetic materials cerium

British Library Electronic Table of Contents (United Kingdom)

ABSTRACT Aim The study aimed to test simultaneously our understanding of the effects of bupropion sustained-release (SR) treatment on putative mediators and our understanding of determinants of post-quit abstinence, including withdrawal distress, cigarette craving, positive affect and subjective reactions to cigarettes smoked during a lapse. The specificity of bupropion SR effects was also tested in exploratory analyses. Design Data from a randomized, placebo-controlled clinical trial of bupropion SR were submitted to mediation analyses. Setting Center for Tobacco Research and Intervention, Madison, WI, USA. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Intervention Participants were assigned randomly to receive a 9-week course of bupropion...

International Nuclear Information System (INIS)

... excited states inelastic scattering mev range 10-100 mev range 100-1000

International Nuclear Information System (INIS)

... minutes living radioisotopes nuclear reactions nuclei nucleons odd-odd nuclei

International Nuclear Information System (INIS)

... functions intermediate structure isobaric analogs level widths mev range

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

Energy Technology Data Exchange (ETDEWEB)

Er{sub 3}NbO{sub 7} phosphor was synthesized by sintering a mixture of Er{sub 2}O{sub 3} and Nb{sub 2}O{sub 5} powder in a molar ratio of 3:1 at 1600 deg. C over 55 h. Optical absorption and emission characteristics of Er{sup 3+} ions in the calcined Er{sub 3}NbO{sub 7} powder were investigated and discussed compared with ErNbO{sub 4} phosphor and a Z-cut congruent Er (2 mol%):LiNbO{sub 3} single crystal. The absorption and emission studies show that, due to different crystal structures, the spectroscopic properties of these niobates have some differences in spectral shape, peak position, and relative intensity, especially at 1.5 {mu}m. The most obvious spectral feature of the Er{sub 3}NbO{sub 7} is that the spectral structure of band instead of peak is observed in its absorption or emission spectrum due to the existence of local structural disorder and multiple Er{sup 3+} sites. The Er{sub 3}NbO{sub 4} shows stronger upconversion emission than ...

Science.gov (United States)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2/sup +//sub 1/ level in /sup 88/Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

Science.gov (United States)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at /sup 88/Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in /sup 87/Sr and /sup 89/Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic.) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,..gamma..) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

Energy Technology Data Exchange (ETDEWEB)

The neutron deficient Sr and Zr nuclei are studied in the relativistic mean-field approach. Large deformations and shape coexistence are predicted for these nuclei in the vicinity of the proton drip line. The charge radii are found to increase with the removal of neutrons from the semimagic {sup 88}Sr and {sup 90}Zr, in close agreement with the recent isotopic-shift measurements.

Science.gov (United States)

A large double-focusing mass spectrometer was used to obtain new values for the masses of Sr/sup 86/, Sr/sup 88/, and Zr/sup 90/. Mass differences calculated from these values are found to be in better agreement with nuclear transmutation information than were previous mass spectroscopically derived values. (auth)

International Nuclear Information System (INIS)

Radiometric X-ray fluorescence analysis was used for the determination of Mn, Fe, Cu, Zn and Pb in wastewater and sludges from three wastewater treatment plants in Bratislava (SR). Metals were determined in wastewaters after preconcentration by 8-hydroxyquinoline and in sludges by drying and pressing to pellets. "2"3"8Pu and "1"0"9Cd was used for excitation of fluorescence radiation. (author).

Energy Technology Data Exchange (ETDEWEB)

The electron scattering form factor for excitation of the 1/sup +/ state of /sup 88/Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no ..delta..-h admixtures are required.

International Nuclear Information System (INIS)

Neutron-hole states in /sup 87/Sr were studied by means of the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction at 36 MeV. Angular distribution measurements were carried out from 3"0 to 41"0 (lab) and analyzed with the zero-range distorted-wave Born approximation method. Spectroscopic factors have been determined for about 50 discrete levels in /sup 87/Sr located below 6 MeV excitation energy and for the three lowest isobaric analog states 2p(3/2, 1f(5/2, and 2p(1/2 observed around 11 MeV. Many l = 1 and l = 3 discrete levels are observed in the 3--6 MeV excitation energy range. In addition, a large part of the 1f-2p strength is found to lie in the higher-lying continuum up to 13 MeV (about 10% and 40% for the l = 1 and 3 contributions, respectively). The distribution of the 1f-2p neutron-hole strength is compared to previous data on neighboring nuclei /sup 89/Zr and /sup 91/Mo. In addition, angular ...

Science.gov (United States)

Objective:? Primary hyperparathyroidism (HPT) is characterised by autonomous secretion of PTH from enlarged parathyroid glands leading, in most patients, to asymptomatic hypercalcaemia. Familial hypocalciuric hypercalcaemia (FHH) is an autosomal dominant disorder caused by inactivating mutations in the calcium sensing receptor (CaSR) gene; it is characterised by lifelong and usually asymptomatic hypercalcaemia. Establishing the correct diagnosis is important because surgery can be curative in HPT, but ineffective in FHH. There is overlap in the diagnostic criteria for the two disorders and some patients carrying inactivating mutations in the CaSR gene, which is suggestive of FHH, also have HPT with hyperplastic parathyroid glands or adenomas. Design and Patients:? CaSR gene mutations were analyzed and clinical and biochemical parameters evaluated in 139 consecutive out-patients presenting with hypercalcaemia and suspected ...

Energy Technology Data Exchange (ETDEWEB)

The gamma-ray spectrum following neutron capture on /sup 87/Sr was measured at 3 neutron energies: E/sub n/ = thermal, 2 keV, and 24 keV. Gamma rays were detected in a three-crystal Ge(Li)-NaI-NaI pair spectrometer. Gamma-ray intensities deduced from these spectra by spectral unfolding are presented.

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence method with Si/Li semiconductor detector and "2"3"8Pu exciting source was used for the determination of Cu, Ni, Zn and Pb in plant samples (Taraxacum officinale) from various localities near the highway D-61 Bratislava-Trnava (SR). (author) 2 refs.; 1 fig.; 1 tab.

International Nuclear Information System (INIS)

The low excitation energy spectroscopy of "8"6Sr, "8"8Sr, "8"9Sr, "8"6Rb, and "8"7Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, "8"7Sr and "8"8Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various analytical function forms of the ...

International Nuclear Information System (INIS)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

Energy Technology Data Exchange (ETDEWEB)

Changes in radiostrontium clearance (SrC) and bone formation (tetracycline labeling) were observed in the femurs of skeletally mature dogs following the various operative steps involved in bone screw fixation. Drilling, but not periosteal stripping, produced a small but statistically significant increase in SrC and endosteal bone formation in the distal third of the bone. Strontium clearance values equivalent to those produced by drilling alone were recorded after screw fixation at low or high torque (5 versus 20 inch pounds), as well as by the insertion of loosely fitting stainless steel implants. Bone formation (equals the percentage tetracycline-labeled trabecular bone surfaces) was increased by 30% when SrC values exceeded 3.5 ml/100 g bone/min, and the relationship was linear when SrC values ranged between 1.0 and 7.0 ml/100 g bone/min. The changes in SrC and bone formation ...

British Library Electronic Table of Contents (United Kingdom)

BaxSr1-xTiO3 (x=0.6, 0.75, 0.80, 0.85 and 0.9) compositions are prepared by solid-state reaction route using controlled heating and cooling. Density optimization by varying sintering temperature was achieved. X-ray diffraction (XRD) analysis shows the phase pure materials. The lattice constant decreases from 3.9868A (x=0.90) to 3.9449A (x=0.60) with increasing Sr2+; the tetragonal distortion also decreases. Dielectric constant show sharp peaks for samples having low strontium content (0.10, 0.15) and gets smeared out as the strontium content is increased (0.20, 0.25). For further higher Sr2+ composition (0.40), the dielectric peak could not be observed in the measured temperature range. The peak broadening in Sr2+ rich compositions indicates that diffused transitions and is attributed to t...

International Nuclear Information System (INIS)

Radiation damage and its recovery in the light emittance efficiency and the attenuation length of barium fluoride (BaF_2) scintillator have been investigated. The light yield and transmittance of small samples of BaF_2 scintillator were measured after #gamma#-irradiation from 0.5x10"4 to 1.1x10"5 Gy for deterioration, and after sunlight exposure for recovery. Suspension of deterioration was observed both in light yield and in attenuation length at an integrated dose of #gamma#-rays of about 10"4 Gy. Fairly good and quick recovery of the deteriorated BaF_2 scintillator was obtained by sunlight exposure. Using a Monte Carlo simulation method, the dependence of the light emittance efficiency on #gamma#-irradiation and sunlight exposure was studied. It has been found that the light emittance efficiency, as well as the attenuation length, is influenced by #gamma#-irradiation and sunlight exposure. (orig.).

British Library Electronic Table of Contents (United Kingdom)

Holmium doped barium based hexaferrites BaFe12-2xHo2xO19 with (x=0.0-1.0) were synthesized by solid state reaction method. Structural and magnetic characterization of these ferrites provide significant information about their reactive physical properties. X-ray analysis reveals that in all samples M-type structure exist with few secondary phases. Scanning electron microscope revealed the grain size of the specimen. The results show that grain size decreases with the substitution degree of Holmium. Thus rare earth element Holmium Ho^3^+ acts as a grain growth inhibitor. The magnetic hysteresis loops show the variation in the values of magnetic parameters like saturation magnetization (Ms), remanent magnetization (Mr) and coercivity (Hc) were observed by changing Ho^3^+ content in BaFe12-2xH...

Energy Technology Data Exchange (ETDEWEB)

Ba(Ti{sub 1-x}Ce{sub x})O{sub 3} ceramics with x = 0.1, 0.2, 0.3, 0.33, 0.4 and 0.5 have been synthesized by the mixed oxide method. Dielectric measurements were performed for Ba(Ti{sub 1-x}Ce{sub x})O{sub 3} ceramics from 10{sup 2} to 10{sup 5} Hz in the temperature range 85 - 700 K. The dielectric measurements confirmed that the solid solution range extends up to about x=0.3. In the solid solutions, the temperature of the permittivity maximum was shifted at a rate of -7 K/mol% Ce atom and the permittivity maximum decreased with increasing Ce content. The temperature and frequency dependence of the permittivity was fitted by the Curie - Weiss law beyond the transition temperature and characterized by parameters that are used to describe relaxor behaviour. (author)

Energy Technology Data Exchange (ETDEWEB)

The magnetic properties of the superconductive materials HoBa/sub 2/Cu/sub 3/O/sub z/ and YBa/sub 2/Cu/sub 3/O/sub z/ have been measured and compared. Both had superconductive transition temperatures T/sub c/ in low magnetic fields near 90 K and exhibited nearly complete magnetic-flux exclusion. The susceptibility of the Ho-based materials followed a Curie-Weiss law both above and below T/sub c/. These results give clear experimental evidence for a nearly complete decoupling of the magnetic and superconductive layers, demonstrating that the superconductivity is highly anisotropic.

British Library Electronic Table of Contents (United Kingdom)

Abstract Lysis and extraction of cells are essential sample processing steps for investigations pertaining to metabolism of xenobiotics in cell culture studies. Of particular importance to these procedures are maintaining high lysis efficiency and analyte integrity as they influence the qualitative and quantitative distribution of drug and toxicant metabolites in the intra- and extracellular milieus. In this study we have compared the efficiency of different procedures viz. homogenization, sonication, bead beating, and molecular grinding resin treatment for disruption of HT-29 colon cells exposed to benzo(a)pyrene (BaP), a polycyclic aromatic hydrocarbon (PAH) compound and a suspected colon carcinogen. Also, we have evaluated the efficiency of various procedures for extracting BaP parent c...

International Nuclear Information System (INIS)

This paperwork explain the method of water sampling to obtain the precipitate of BaCO3 solutions that will be used to analyze 13C from field work in Kelana Jaya, Selangor, Langkawi, Kedah and Taiping, Perak. The sampling involves collecting of water samples for groundwater from boreholes and surface water from canal, river, pond and ex-mining pond from several locations at the study sites. This study also elaborates the instruments and chemicals used. The main purpose of this sampling is to obtain the precipitate of BaCO3 for 13C analysis of dissolved inorganic carbon (DIC). A correct sampling method according to standard is very important to ensure an accurate and precise result. With this, the data from the laboratory analysis result can be fully utilized to make the interpretation of the pollutants movement. (Author)

Energy Technology Data Exchange (ETDEWEB)

Ion Beam Induced Luminescence (IBIL) and Ion Beam Induced Charge Collection (IBICC) have been applied in the study of the luminescence emission efficiency and investigation of the homogeneity of the luminescence emission in phosphors. The IBIL imaging was performed by using sharply focused ion beams or broad/partially-focused ion beams. The luminescence emission homogeneity in samples was examined to reveal possible distributed crystal-defects that may lead to the inhomogeneity of the luminescence emission in samples.The purpose of the study is to search for suitable luminescent thin films that have high homogeneity of luminescence emission, large IBIL efficiency under heavy ion excitation, and can be placed as a thin layer on the top of microelectronic devices to be analyzed with Ion Photon Emission Microscopy (IPEM). The emission yield was found to be low for organic materials, due to saturation of the light output dependence on the energy deposition of heavy ...

International Nuclear Information System (INIS)

In this work, new LaSi3N5:Ce3+ phosphors have been synthesized by solid-state reaction. Rietveld refinement of the crystal structure of La1-xCexSi3N5 reveals that Ce atoms substituted for La atoms occupy 4a crystallographic positions. Broad emission and excitation bands observed were attributed to the transitions between the doublet ground state of the 4f1 configuration and the crystal field components of the 5d1 excited state. At 77 K, the centroid and crystal field splitting ?cfs of the 5d levels of Ce3+ in LaSi3N5:Ce3+ compounds were valuated at 33.4x103 and 11.3x103 cm-1, respectively. The zero-phonon line and the Stokes shift were measured to be 26.0x103 and 5.0x103 cm-1, respectively.

Energy Technology Data Exchange (ETDEWEB)

Alloy 800 is an austenitic Fe-Ni-Cr steel containing relatively minor but important amounts of carbon, aluminium and titanium. Special grades of alloy 800 known as 800H, 800HT and 800LC differ in the concentrations of these elements. In addition to these industrial specifications, further melts were prepared containing phosphorous or sulphur. Using a radioactive tracer method the bulk and grain-boundary diffusion of {sup 59}Fe was investigated in these alloys in the temperature range 800 to 1000 C. For evaluation of the diffusion profiles the approximation of Suzuoka was used, which considers the depletion of the tracer on the surface. By autoradiography it was confirmed that such depletion occurs. In alloy 800H the activation energy of grain-boundary diffusion of {sup 59}Fe was found to be (209{+-}17) kJ/mol; dissolved elements, especially phosphorous, increase the activation energy. The same materials - aged at 800 C for 100 h - were used for ...

International Nuclear Information System (INIS)

Phosphoro-uraniferous deposit of Itataia is situated in Precambrian metamorphic terrains, into the litho-stratigraphic unit named Caico Complex. Regionally, the rocks are linearly folded, as a result of compressive tectonic that fits in the regmatic pattern. Rio Groairas' and Itatira's wrench faults form shearing couples in which the drag folds' climax are thrusting faults with axial plane dipping north. Uranium mineralization occurs into a phosphatic rock containing about 80% of collophane - 'collophanite - in association chiefly with marbles or feldsphatic rocks and gneisses. The ore (collophanite) occurs mainly as a stockwork, and it may be massive, (into big joints) or disseminated (impregnating the host rocks). Dark ore appears only in brecciated zones; it is richer in uranium content, but poorer in phosphorous. The highest grade ore is in a very fractured zone, associated to marbles. Supergene enrichment took place in this area. Underground works show that ...

British Library Electronic Table of Contents (United Kingdom)

Monodisperse europium-activated titania hollow phosphors had been synthesized by a facile one-pot hydrothermal method using carbon spheres as hard templates. Samples were characterized by X-ray powder diffraction, transmission electron microscopy, X-ray photoelectron spectroscopy, energy dispersive spectrometer and photoluminescence spectrum. The strongest emission intensity was observed with TiO2:Eu0.2 hollow spheres and TiO2:Eu0.2 hollow spheres calcining at 550^oC. Moreover, the strongest excitation of TiO2:Eu0.2 hollow spheres transferred from 400 to 500^oC and the effective nonradiative energy transfer from the TiO2 hollow spheres host matrix to Eu^3^+ ions crystal field states was realized due to changes of crystalline field in the environment around Eu^3^+ ions occupying Ti^4^+ site...

Energy Technology Data Exchange (ETDEWEB)

Reaction of At(I) with triphenylphosphine, triethylphosphite and tri-n-octylphosphine oxide was investigated in ethanolic solution by means of electromigration. A cationic complex with triphenylphosphine was identified being stable at pH = 1,9 in the concentration range of the ligand between c = 10{sup -5} to 10{sup -3} M. At a higher ligand concentration and at pH>2, the reduction effect of phosphine is superimposed on the complex formation. Complex formation is confirmed by ligand exchange reactions with Br{sup -} and I{sup -}. A comparatively weak complex is formed by triethylphosphite and At(I). No compound is formed by tri-n-octylphosphine oxide and At(I). (orig.).

International Nuclear Information System (INIS)

The results and techniques of radiographic study on solidification of iron and steel mould castings are described. The study was made to determine the causes of the mold castings defects. The liquid metal is either labelled in the ladle, or relabelled inside the mould in present time intervals. In the former case, the radioactive phosphorus is segregated in the last-solidifying casting locations, and in the latter, the radioactive phosphorous is distributed along the solid-liquid interface at the time of the next addition in turn. The solidification process parameters may be arrived at by the autoradiograms taken in the pipe-sensitive casting sections. Using these data it is possible to proceed to the proper modifications in the steel casting process.

Energy Technology Data Exchange (ETDEWEB)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860[degrees]C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

International Nuclear Information System (INIS)

Scanning spreading resistance microscopy (SSRM) has been applied to study focused ion beam (FIB) induced damage in silicon in dependence on ion irradiation doses from 10"1"2 cm"-"2 to 2#centre dot#10"1"6 cm"-"2. Starting from the lowest dose, SSRM detects increasing spreading resistance (SR) with increasing dose. For doses from 2#centre dot#10"1"3 cm"-"2 to 4#centre dot#10"1"4 cm"-"2, a slight decrease of SR is measured whereas for higher doses SR again slightly increases. The results are explained by physical effects like decreased carrier mobility due to increased scattering, amorphisation of silicon and precipitation of implanted Ga ions. The results clearly prove that SSRM is well suited for the fast detection of ion beam induced damage with high lateral resolution.

International Nuclear Information System (INIS)

Summary of cyclotron production methods of "2"3"7Pu (45,2 d), "8"8Y (106,65 d) and "8"5Sr (64,84 d) tracers via nuclear reactions with protons and alphas on "2"3"5U, "8"8Sr and "8"5Rb targets in wide energy range is given. Chemical methods of separation and purification of the tracers from the irradiated uranium, strontium and rubidium targets are described. The tracers were used for determination of Pu (239-240), Sr-90 and Am-241 in the samples (soil, plants, underground waters) from Semipalatinsk Test Site. Obtained results are discussed.

Science.gov (United States)

Because of its small cross section, the 88Sr(n,g) reaction is an important bottleneck during s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. We have completed the resonance analysis of our new and improved measurements of the neutron capture and total cross sections for 88Sr made at the Oak Ridge Electron Linear Accelerator (ORELA). We describe our experimental procedures and resonance analysis, compare our results to previous data, and discuss their astrophysical impact.

British Library Electronic Table of Contents (United Kingdom)

SR proteins are essential splicing factors whose function is controlled by multi-site phosphorylation of a C-terminal domain rich in arginine-serine repeats (RS domain). The protein kinase SRPK1 has been shown to polyphosphorylate the N-terminal portion of the RS domain (RS1) of the SR protein ASF/SF2, a modification that promotes nuclear entry of this splicing factor and engagement in splicing function. Later, dephosphorylation is required for maturation of the spliceosome and other RNA processing steps. While phosphates are attached to RS1 in a sequential manner by SRPK1, little is known about how they are removed. To investigate factors that control dephosphorylation, we monitored region-specific mapping of phosphorylation sites in ASF/SF2 as a function of the protein phosphatase PP1. W...

International Nuclear Information System (INIS)

A nuclear resonance fluorescence experiment on "8"8Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The #gamma#-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in "8"8Sr, in contrast to the previous interpretation as a 1"- two-phonon (2"+_1 x 3"-_1) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1"+ state at 3.486 MeV may be considered as the 1"+_1 one-phonon state and the very strong 1"+_1#->#0"+_1 deexcitation as proton spin-flip 2p_1_/_2#->#2p_3_/_2 transition. (orig.)

International Nuclear Information System (INIS)

We have measured the isotope shifts of some dipole transitions between excited states of the even strontium isotopes 88 and 86 by applying the technique of Doppler-free intermodulated optogalvanic spectrocopy to a heat-pipe discharge. We were also able to investigate the isotope shift of the Sr II resonance line at 4216.6 A optogalvanically in the mentioned pair of isotopes. Because the 5 snf"1F_3 series appear to have zero level isotope shifts for n>=6, we can give residual level isotope shifts (RLIS) of several odd-parity states of sup(88,86) Sr I. The RLIS of the 5 snp "1P_1 series show pronounced configuration mixing around n=7. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Intrinsic crossluminescence (CRL) of CsBr, CsCl, and of BaF{sub 2} was investigated with electron-beam and synchrotron radiation excitation. From the CRL spectra, the excitation spectra and the reflectivity, energy level schemes were deduced. Extrinsic CRL was observed changing either the initial (CsCl:Br{sup -}) or the final (RbCl:Cs{sup +}; KCl:Cs{sup +}) state of CRL by doping. (author).

Science.gov (United States)

The reports in this series are designed primarily to familiarize professional land use and resource planners with the range of possibilities and effective procedures for achieving integrated mining, reclamation, and land use planning. These reports are ba...

Science.gov (United States)

Erosion is the main contributing factor to the decrease in lifetime of gun barrels. The precision, muzzle velocity and fire range deteriorate when the surface inside the gun tube is eroded. This study deals with gun barrel material, what happens in the ba...

Energy Technology Data Exchange (ETDEWEB)

In connection with the ERP project 'Dynamic modelling of staged gasification processes' a gasification simulator has been constructed. The simulator consists of: a mathematical model of the gasification process developed at Technical University of Denmark, a user interface programme, IGSS, and a communication interface between the two programmes. (BA)

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting Sr-Fe-Co oxides have potential applications in dense ceramic membranes for high-purity oxygen separation and/or methane conversion to produce syngas (CO + H{sub 2}), because of their combined high electronic/ionic conductivity and significant oxygen permeability. We studied the crystal structure and microstructure of the system in X-ray diffraction experiments and by using scanning electron microscopy, respectively. Thermogravimetric analysis was conducted on the SrFeCo{sub 0.5}O{sub x} sample in environments of various oxygen partial pressures (pO{sub 2}). Conductivity increased while weight decreased with increasing temperature. Activation energy decreased while conductivity increased with increasing pO{sub 2}. The pO{sub 2}-dependent conducting behavior of the SrFeCo{sub 0.5}O{sub x} system can be understood by considering the trivalent-to-divalent transition of transition-metal ions.

UK PubMed Central (United Kingdom)

Striated muscle fibers from the body and tail myotomes of a fish, the black Mollie, have been examined with particular attention to the sarcoplasmic reticulum (SR) and transverse tubular (or T) system....Full Text Available

Science.gov (United States)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich {sup 101}Sr to the neutron-deficient {sup 101}In.

International Nuclear Information System (INIS)

... reactions selenium 74 target selenium 77 target strontium 84 target strontium

UK PubMed Central (United Kingdom)

BackgroundMicroarray data are often used for patient classification and gene selection. An appropriate tool for end users and biomedical researchers should combine user friendliness...Full Text Available

International Nuclear Information System (INIS)

... mev range 100-1000 molybdenum 92 molybdenum 92 target nuclear radii

Energy Technology Data Exchange (ETDEWEB)

This article describes the processes for the treatment of plastic waste: sampling, sorting, comminution. The requirements for the different processes for waste treatment (as recycling, utilization as raw material, energy recovery, combustion) are listed. (SR)

UK PubMed Central (United Kingdom)

Observations made during biochemical and toxicological studies of the housefly, in which the WHO standard reference (SR) strain was used as a standard, indicated that this strain differs from other...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

We propose a novel method for ultrasensitive isotope analysis that combines magnetic mass selection, resonant charge-exchange neutralization, and resonant laser ionizaion. Our method attains high isotopic abundance selectivity by means of continuous multistage separation of ions stored in a small ring. For the environmentally interesting case of /sup 90/Sr versus /sup 88/Sr we estimate that sensitivity better than 10/sup -15/ for a throughput of 10/sup 13/ atoms/sec and an efficiency (after the ion source) greater than 10% are readily achievable.

Energy Technology Data Exchange (ETDEWEB)

The Sundsta granite is a reddish, acidic granite, situated in the Western Pregothian mega-unit in Vaermland, south-western Sweden. Its Rb-Sr whole-rock age is 1566+-39 Ma with an initial ratio 0f 0.705 +-0.003. The region is dominated by grey, migmatized granitoids presumably belonging to the Aamaal-I group which has ages of 1650-1700 Ma. The marked difference in degree of migmatization between these two rock-units may indicate that the intrusion of the Sundsta granite post-dates the main migmatization phase of the Aamaal-I granitoid in this region.

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of the 1/sup +/ state at 3.48 MeV in /sup 88/Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm/sup -1/. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual ..delta..-hole excitations.

Energy Technology Data Exchange (ETDEWEB)

The results of an investigation on the production of Group IIA atomic and molecular negative ion beams formed in a cesium-sputter negative ion source are presented. The sputtering material was formed by pressing pellets of stoichiometric mixtures of the Group IIA element carbonates and 10% copper powder. Negative ions of several alkaline-earth elements and their oxides have been observed. Beam intensities as high as 180 pA have been observed for Sr{sup -}and 20 nA for SrO{sup -}. (orig.).

British Library Electronic Table of Contents (United Kingdom)

We present the low-temperature physical properties of the polycrystalline perovskite systems La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1) including electrical resistance, magnetization, ac and dc susceptibilities. The experimental data suggest the presence of correlated ferromagnetic clusters embedded in some non-ferromagnetic matrix. The systems show semiconducting behavior and negative magnetoresistance.

International Nuclear Information System (INIS)

The (p,n) cross section on "8"8Sr was measured for proton energies between 5.75 and 11 MeV. Overall resolution was sufficient to separate the "8"8Y ground state (J/sup #pi#/ = 4"-), the first excited state (J/sup #pi#/ = 5"-) at 0.232 MeV, and the second excited state (J/sup #pi#/ = 1"+) at 0.393 MeV. A Legendre polynomial fit was made to the angular distributions and the resulting integrated cross sections are shown. 1 figure.

International Nuclear Information System (INIS)

The present work gives preliminary results of analysis of drug mixtures (NEPHROSAL tea bag) and its water infusion. In a sample of dried drugs the elements K, Ca, Mn, Fe, Ni, Cu, Zn, Br, Rb, Sr, Pb were identified, whereas in their water infusion only Ca, Mn, Zn and Sr were found. The method applied was radionuclide X-ray fluorescence analysis using a radionuclide source "1"0"9Cd, a Si/Li semiconductor detector and a multichannel analyzer Canberra 8100. (author) 6 refs.; 3 figs.

Energy Technology Data Exchange (ETDEWEB)

We discuss the algebraic structure of the generator coordinate method for triaxial quadrupole collective motion. The collective solutions are classified according to the representations of the permutation group of the intrinsic axes. Our method amounts to an approximate angular-momentum projection. We apply it to a study of the spherical-to-deformed-shape transition in light even strontium isotopes {sup 78-88}Sr. We find that triaxial configurations play a significant role in explaining the structure of the transitional isotopes {sup 80-82}Sr. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Data for the excitation of the 2/sub 1//sup +/ and 2/sub 2//sup +/ states in the /sup 88/Sr(p,p') reaction at 25 and 31 MeV indicate sustantial contributions from the interior of the nucleus, Microscopic DWBA calculations reproduce this and yield a fair description of the data. A detailed description, especially of the 2/sub 2//sup +/ state, is sensitive to the effective nucleon-nucleon interaction used and the non-locality of the optical potential, which are insufficiently known at present.

International Nuclear Information System (INIS)

In a (p,p') study of "8"8Sr at Esub(p) = 201 MeV both a large resonance centered at 9.4 MeV excitation energy and the known 1"+ state at 3.486 MeV are excited. Several discrete states are observed in the resonance. The cross section of the whole resonance is 27% of a simple particle-hole prediction. The strength of the low-lying 1"+ state is only about 15% of that calculated from a wave function including core-polarization contributions, whereas (e,e') scattering finds about 50%. (orig.).

Energy Technology Data Exchange (ETDEWEB)

The form factor for excitation of 1/sup +/ state at 3.846 MeV in /sup 88/Sr by inelastic electron scattering has been measured for q=0.22-2.57 fm/sup -1/. Both nuclear core polarization and ..delta..-hole polarization seem to be necessary to describe the observed reduction of the B(M1)-value and data at low q and the peculiar shape of the form factor at intermediate values of q.

Energy Technology Data Exchange (ETDEWEB)

Since chlordecone (Kepone, CD) interferes with cardiac Na{sup +} ion translocases, we have studied CD effects on cardiac SR calcium pump activity. SR was isolated from heart ventricles of male Sprague-Dawley rats. Cardiac SR Ca{sup 2+}-ATPase, {sup 45}Ca-uptake and cAMP as well as calmodulin (CaM) dependent protein phosphorylation were measured. Ca{sup 2+}-ATPase was differentiated into low affinity and high affinity forms by measuring the activity using 50 and 0.7 {mu}M free Ca{sup 2+} respectively. CD in vitro inhibited {sup 45}Ca-uptake by SR in a concentration dependent manner with an IC50 value of 7 {mu}M and SR {sup 45}Ca-uptake was totally inhibited at 20-30 {mu}M CD. In agreement with this, both high affinity and low affinity Ca{sup 2+}-ATPases, which are involved in Ca{sup 2+} transport across membranes, were also inhibited by CD in a concentration dependent manner with ...

International Nuclear Information System (INIS)

A study of the #pi#1g/sub 9/2/ orbit size in "8"8Sr, "9"0Zr, and "9"2Mo is presented. The rms radius for the point-proton density is extracted by studying transitions to 8"+ states in these nuclei. The radii are consistently larger than a value determined in a magnetic electron scattering experiment on "9"3Nb. A qualitative discussion of the ground state occupation of the #pi#1g/sub 9/2/ orbit based on the transition amplitudes to the 8"+ states is given.

Energy Technology Data Exchange (ETDEWEB)

Sorption studies of cesium, strontium, and cobalt (Cs, Sr, and Co) on bentonite under various experimental conditions, such as contact time, pH, sorbent and sorbate concentration, and temperature, have been performed. The sorption data for all these metals have been interpreted in terms of Freundlich, Langmuir, and Dubinin-Radushkevich equations. Thermodynamics parameters, such as heat of sorption {Delta}H{degrees}, free energy change {Delta}G{degrees}, and entropy change {Delta}S{degrees}, for the sorption of these metals on bentonite have been calculated. The value of {Delta}H{degrees} shows that the sorption of Cs was exothermic, while the sorption of Sr and Co on bentonite were endothermic in nature. The value of {Delta}G{degrees} for their sorption was negative, showing the spontaneity of the process. The maximum loading capacity of Cs, Sr, and Co were 75.5, 22, and 27.5 meq, respectively, for 100 g of bentonite. The ...

Science.gov (United States)

A facile solution chemistry is demonstrated to fabricate high-quality polycrystalline strontium ruthenium oxide (SrRuO{sub 3}) thin film electrodes on silicon substrates suppressing the formation of undesired ruthenium oxide (RuO{sub 2}) for the deposition of dielectric and ferroelectric materials like lead lanthanum zirconate titanate (PLZT). The robust, highly crystalline SrRuO{sub 3} film fabrication process does not favor the formation of RuO{sub 2} because of molecular level modification of the precursors possessing analogous melting points, yielding homogeneous films. This chemistry is further understood and complemented by kinetic and thermodynamic analysis of the DTA data under nonisothermal conditions, with which the activation energies to form RuO{sub 2} and SrRuO{sub 3} were calculated to be 156 {+-} 17 and 96 {+-} 10 kJ/mol, respectively. The room-temperature resistivity of the SrRuO{sub 3} ...

British Library Electronic Table of Contents (United Kingdom)

In this study, a two-step process was developed to produce biodiesel from Calophyllum inophyllum oil. Pre-treatment with phosphoric acid modified b-zeolite in acid catalyzed esterification process preceded by transesterification which was done using conventional alkali catalyst potassium hydroxide (KOH). The objective of this study is to investigate the relationship between the reaction temperatures, reaction time and methanol to oil molar ratio in the pre-treatment step. Central Composite Design (CCD) and Response Surface Methodology (RSM) were utilized to determine the best operating condition for the pre-treatment step. Biodiesel produced by this process was tested for its fuel properties.

British Library Electronic Table of Contents (United Kingdom)

Abstract Acid-treated cobia (Rachycentron canadum) skin was extracted in a retort (121C) to obtain retorted skin gelatin hydrolysates (RSGHs) containing antioxidant peptides with noticeable antioxidant properties. To improve the antioxidant activity of cobia RSGHs, five processing factors including alkali concentration, alkali pretreatment time, phosphoric acid concentration (PC), water/skin ratio (WS) and retorting time (RT) in RSGH production were screened using a fractional factorial design to identify critical factors. It indicated that PC, WS and RT had significant effects on ,-diphenyl--picrylhydrazyl (DPPH) scavenging by RSGHs. Subsequently, the optimization of PC, WS and RT on the DPPH scavenging of RSGHs was studied using a central composite design to collect data that resulted in...

Energy Technology Data Exchange (ETDEWEB)

The authors present the results of their investigation of the effect of phosphorus compounds on the activity of tungsten-containing catalysts in the oxidation of ethane. They investigated tungsten-phosphorus catalysts with different phosphorus concentrations (calculated on the basis of P/sub 2/O/sub 5/). The catalysts were prepared by heat decomposition of the starting compounds at 750/sup 0/C for 4 h. As their starting compounds, they used two types of materials: heteropoly acids mixtures of monosubstituted ammonium phosphoric and tungstic acids. The specific surface area of the catalysts was determined using the nitrogen desorption method. The x-ray phase analysis was carried out using a DRON-1.5 diffractometer. The catalytic activity was determined using the impulse method in a reactor with a vibrofluidized catalyst layer.

International Nuclear Information System (INIS)

A real time neutron radiography system has been developed at the University of Michigan Phoenix Memorial Laboratory (PML) and has recently been used to test the imaging capabilities of a neutron imaging device developed by Lixi, Inc. of Downers Grove, Ill. This device uses an input phosphor that is high in gadolinium to generate a light image which is then sent through an intensifier stage to provide images that can be viewed by eye, video camera, or standard 35 mm camera. It was determined that this device provides images of much higher resolution and sensitivity than those obtained with the imaging system currently being used at PML. Using computerized image enhancement techniques, the images obtained with the Lixi neutron imaging device can then be further enhanced or processed to obtain quantitative information on the object being imaged. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Portal localization images for high-energy electron beam therapy are necessary to confirm the treatment field by comparing them with a simulation image obtained before treatment or portal verification images after treatment. In this study, portal localization images were acquired using the computed radiography (CR) system and bremsstrahlung X-rays generated in the electron beam irradiations. All images obtained with phantom and the irradiations of in the electron energy of 8, 10, 12 and 15 MeV were feasible for clinical use. The CR system used in this study included general diagnostic imaging cassette and storage phosphor plate, but none of other special devices. The system can usually supply portal localization images, which maintains the quality assurance of high-energy electron beam therapy. (author)

British Library Electronic Table of Contents (United Kingdom)

Abstract Within the framework of the CRC 799 -TRIP-Matrix-Composites- at the TU Bergakademie Freiberg new composite materials consisting of TRIP steel and zirconium dioxide ceramics are designed in a powder route and a casting route. To manufacture faultless samples basic investigations of the feeding and infiltration behaviour within macro porous ceramics such as filters were needed. The effects of bottom pouring and top pouring were investigated as well as the effects of different preheating temperatures, contents of phosphorous in the steel and flow trough rates. Bottom pouring corrupts the feeding mainly of filters with high ppi (pores per inch). Top pouring improves the feeding, but generates inhomogeneous infiltration qualities, which can affected and enhanced by a increasing preheat...