WorldWideScience

Sample records for azorhizobium caulinodans ors571

  1. Azorhizobium caulinodans Transmembrane Chemoreceptor TlpA1 Involved in Host Colonization and Nodulation on Roots and Stems

    Directory of Open Access Journals (Sweden)

    Wei Liu

    2017-07-01

    Full Text Available Azorhizobium caulinodans ORS571 is a motile soil bacterium that interacts symbiotically with legume host Sesbania rostrata, forming nitrogen-fixing root and stem nodules. Bacterial chemotaxis plays an important role in establishing this symbiotic relationship. To determine the contribution of chemotaxis to symbiosis in A. caulinodans ORS571-S. rostrata, we characterized the function of TlpA1 (transducer-like protein in A. caulinodans, a chemoreceptor predicted by SMART (Simple Modular Architecture Research Tool, containing two N-terminal transmembrane regions. The tlpA1 gene is located immediately upstream of the unique che gene cluster and is transcriptionally co-oriented. We found that a ΔtlpA1 mutant is severely impaired for chemotaxis to various organic acids, glycerol and proline. Furthermore, biofilm forming ability of the strain carrying the mutation is reduced under certain growth conditions. Interestingly, competitive colonization ability on S. rostrata root surfaces is impaired in the ΔtlpA1 mutant, suggesting that chemotaxis of the A. caulinodans ORS571 contributes to root colonization. We also found that TlpA1 promotes competitive nodulation not only on roots but also on stems of S. rostrata. Taken together, our data strongly suggest that TlpA1 is a transmembrane chemoreceptor involved in A. caulinodans-S. rostrata symbiosis.

  2. Monitoring the persistence of a genetically modified strain of the Azorhizobium caulinodans in the rhizosphere of Triticum aestivum L.

    Directory of Open Access Journals (Sweden)

    Jan Jacek Slaski

    2013-01-01

    Full Text Available A protocol was developed to monitor persistence and spread of a genetically modified strain of the growth promoting diazotroph Azorhizobium caulinodans used to inoculate field grown wheat. The protocol was used to identify an endogluconase (egl overproducing strain of A. caulinodans isolated from inoculated soils. A detection limit of 2500 cfu g-1 and 108_1010cfu g-1 of soil was determined using the BIOLOG® fingerprinting method and PCR technique, respectively. Since none of the tested samples were positive for the bacteria or the Egl 1 gene construct, it was concluded that A. caulinodans ORS 571 pGV910-C1 did not persist or spread in any of the tested field locations. This result may be due to low soil temperatures and competition of indigenous microorganisms: environmental factors that were not favorable for the diazotroph to thrive in the test locations. The application of different inoculation methodologies, as well as the study of other rhizobial genera for the inoculation of wheat in further experiments, is strongly recommended. Key words: detection, diazotroph, endogluconase, ORS 571, wheat

  3. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  4. Effects of Glucosinolates and Flavonoids on Colonization of the Roots of Brassica napus by Azorhizobium caulinodans ORS571

    Science.gov (United States)

    O'Callaghan, Kenneth J.; Stone, Philip J.; Hu, Xiaojia; Griffiths, D. Wynne; Davey, Michael R.; Cocking, Edward C.

    2000-01-01

    Plants of Brassica napus were assessed quantitatively for their susceptibility to lateral root crack colonization by Azorhizobium caulinodans ORS571(pXLGD4) (a rhizobial strain carrying the lacZ reporter gene) and for the concentration of glucosinolates in their roots by high-pressure liquid chromatography (HPLC). High- and low-glucosinolate-seed (HGS and LGS) varieties exhibited a relatively low and high percentage of colonized lateral roots, respectively. HPLC showed that roots of HGS plants contained a higher concentration of glucosinolates than roots of LGS plants. One LGS variety showing fewer colonized lateral roots than other LGS varieties contained a higher concentration of glucosinolates than other LGS plants. Inoculated HGS plants treated with the flavonoid naringenin showed significantly more colonization than untreated HGS plants. This increase was not mediated by a naringenin-induced lowering of the glucosinolate content of HGS plant roots, nor did naringenin induce bacterial resistance to glucosinolates or increase the growth of bacteria. The erucic acid content of seed did not appear to influence colonization by azorhizobia. Frequently, leaf assays are used to study glucosinolates and plant defense; this study provides data on glucosinolates and bacterial colonization in roots and describes a bacterial reporter gene assay tailored easily to the study of ecologically important phytochemicals that influence bacterial colonization. These data also form a basis for future assessments of the benefits to oilseed rape plants of interaction with plant growth-promoting bacteria, especially diazotrophic bacteria potentially able to extend the benefits of nitrogen fixation to nonlegumes. PMID:10788398

  5. Cyanuric acid hydrolase from Azorhizobium caulinodans ORS 571: crystal structure and insights into a new class of Ser-Lys dyad proteins.

    Directory of Open Access Journals (Sweden)

    Seunghee Cho

    Full Text Available Cyanuric acid hydrolase (CAH catalyzes the hydrolytic ring-opening of cyanuric acid (2,4,6-trihydroxy-1,3,5-triazine, an intermediate in s-triazine bacterial degradation and a by-product from disinfection with trichloroisocyanuric acid. In the present study, an X-ray crystal structure of the CAH-barbituric acid inhibitor complex from Azorhizobium caulinodans ORS 571 has been determined at 2.7 Å resolution. The CAH protein fold consists of three structurally homologous domains forming a β-barrel-like structure with external α-helices that result in a three-fold symmetry, a dominant feature of the structure and active site that mirrors the three-fold symmetrical shape of the substrate cyanuric acid. The active site structure of CAH is similar to that of the recently determined AtzD with three pairs of active site Ser-Lys dyads. In order to determine the role of each Ser-Lys dyad in catalysis, a mutational study using a highly sensitive, enzyme-coupled assay was conducted. The 10⁹-fold loss of activity by the S226A mutant was at least ten times lower than that of the S79A and S333A mutants. In addition, bioinformatics analysis revealed the Ser226/Lys156 dyad as the only absolutely conserved dyad in the CAH/barbiturase family. These data suggest that Lys156 activates the Ser226 nucleophile which can then attack the substrate carbonyl. Our combination of structural, mutational, and bioinformatics analyses differentiates this study and provides experimental data for mechanistic insights into this unique protein family.

  6. Stringent Expression Control of Pathogenic R-body Production in Legume Symbiont Azorhizobium caulinodans

    Directory of Open Access Journals (Sweden)

    Jun-ichi Matsuoka

    2017-07-01

    Full Text Available R bodies are insoluble large polymers consisting of small proteins encoded by reb genes and are coiled into cylindrical structures in bacterial cells. They were first discovered in Caedibacter species, which are obligate endosymbionts of paramecia. Caedibacter confers a killer trait on the host paramecia. R-body-producing symbionts are released from their host paramecia and kill symbiont-free paramecia after ingestion. The roles of R bodies have not been explained in bacteria other than Caedibacter. Azorhizobium caulinodans ORS571, a microsymbiont of the legume Sesbania rostrata, carries a reb operon containing four reb genes that are regulated by the repressor PraR. Herein, deletion of the praR gene resulted in R-body formation and death of host plant cells. The rebR gene in the reb operon encodes an activator. Three PraR binding sites and a RebR binding site are present in the promoter region of the reb operon. Expression analyses using strains with mutations within the PraR binding site and/or the RebR binding site revealed that PraR and RebR directly control the expression of the reb operon and that PraR dominantly represses reb expression. Furthermore, we found that the reb operon is highly expressed at low temperatures and that 2-oxoglutarate induces the expression of the reb operon by inhibiting PraR binding to the reb promoter. We conclude that R bodies are toxic not only in paramecium symbiosis but also in relationships between other bacteria and eukaryotic cells and that R-body formation is controlled by environmental factors.

  7. Plant nodulation inducers enhance horizontal gene transfer of Azorhizobium caulinodans symbiosis island.

    Science.gov (United States)

    Ling, Jun; Wang, Hui; Wu, Ping; Li, Tao; Tang, Yu; Naseer, Nawar; Zheng, Huiming; Masson-Boivin, Catherine; Zhong, Zengtao; Zhu, Jun

    2016-11-29

    Horizontal gene transfer (HGT) of genomic islands is a driving force of bacterial evolution. Many pathogens and symbionts use this mechanism to spread mobile genetic elements that carry genes important for interaction with their eukaryotic hosts. However, the role of the host in this process remains unclear. Here, we show that plant compounds inducing the nodulation process in the rhizobium-legume mutualistic symbiosis also enhance the transfer of symbiosis islands. We demonstrate that the symbiosis island of the Sesbania rostrata symbiont, Azorhizobium caulinodans, is an 87.6-kb integrative and conjugative element (ICE Ac ) that is able to excise, form a circular DNA, and conjugatively transfer to a specific site of gly-tRNA gene of other rhizobial genera, expanding their host range. The HGT frequency was significantly increased in the rhizosphere. An ICE Ac -located LysR-family transcriptional regulatory protein AhaR triggered the HGT process in response to plant flavonoids that induce the expression of nodulation genes through another LysR-type protein, NodD. Our study suggests that rhizobia may sense rhizosphere environments and transfer their symbiosis gene contents to other genera of rhizobia, thereby broadening rhizobial host-range specificity.

  8. Regulation of Azorhizobium caulinodans ORS571 nitrogen fixation (NIF/FIX) genes

    NARCIS (Netherlands)

    Stigter, J.

    1994-01-01

    Biological nitrogen fixation is the microbial process by which atmospheric dinitrogen (N 2 ) is reduced to ammonia. In all microbes studied, dinitrogen reduction is catalyzed by a highly conserved enzyme complex, called nitrogenase.

  9. Dicty_cDB: Contig-U16305-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-79 AM494938_8( AM494938 |pid:none) Leishmania braziliensis chromosome... 300 2...7( CP001154 |pid:none) Laribacter hongkongensis HLHK9, ... 182 7e-44 CP001322_2533( CP001322 |pid:none) Desulfatibacillum alkeni...tckkmgiktva ihsdvdknakhvnmadeaicvgpaptsesylnidaiveaikmtgaqavhpgygflsensr fvkelenigvtfigpgsyamhalgdkie...84 |pid:none) Azorhizobium caulinodans ORS 57... 249 4e-64 AY810800_1( AY810800 |pid:none) Schistosoma japoni...e-57 CP000529_2359( CP000529 |pid:none) Polaromonas naphthalenivorans C... 226 4e-57 CP000821_1453( CP000821 |pid:none) Shewan

  10. A novel endo-hydrogenase activity recycles hydrogen produced by nitrogen fixation.

    Directory of Open Access Journals (Sweden)

    Gordon Ng

    Full Text Available BACKGROUND: Nitrogen (N(2 fixation also yields hydrogen (H(2 at 1:1 stoichiometric amounts. In aerobic diazotrophic (able to grow on N(2 as sole N-source bacteria, orthodox respiratory hupSL-encoded hydrogenase activity, associated with the cell membrane but facing the periplasm (exo-hydrogenase, has nevertheless been presumed responsible for recycling such endogenous hydrogen. METHODS AND FINDINGS: As shown here, for Azorhizobium caulinodans diazotrophic cultures open to the atmosphere, exo-hydrogenase activity is of no consequence to hydrogen recycling. In a bioinformatic analysis, a novel seven-gene A. caulinodans hyq cluster encoding an integral-membrane, group-4, Ni,Fe-hydrogenase with homology to respiratory complex I (NADH: quinone dehydrogenase was identified. By analogy, Hyq hydrogenase is also integral to the cell membrane, but its active site faces the cytoplasm (endo-hydrogenase. An A. caulinodans in-frame hyq operon deletion mutant, constructed by "crossover PCR", showed markedly decreased growth rates in diazotrophic cultures; normal growth was restored with added ammonium--as expected of an H(2-recycling mutant phenotype. Using A. caulinodans hyq merodiploid strains expressing beta-glucuronidase as promoter-reporter, the hyq operon proved strongly and specifically induced in diazotrophic culture; as well, hyq operon induction required the NIFA transcriptional activator. Therefore, the hyq operon is constituent of the nif regulon. CONCLUSIONS: Representative of aerobic N(2-fixing and H(2-recycling alpha-proteobacteria, A. caulinodans possesses two respiratory Ni,Fe-hydrogenases: HupSL exo-hydrogenase activity drives exogenous H(2 respiration, and Hyq endo-hydrogenase activity recycles endogenous H(2, specifically that produced by N(2 fixation. To benefit human civilization, H(2 has generated considerable interest as potential renewable energy source as its makings are ubiquitous and its combustion yields no greenhouse gases. As

  11. A novel endo-hydrogenase activity recycles hydrogen produced by nitrogen fixation.

    Science.gov (United States)

    Ng, Gordon; Tom, Curtis G S; Park, Angela S; Zenad, Lounis; Ludwig, Robert A

    2009-01-01

    Nitrogen (N(2)) fixation also yields hydrogen (H(2)) at 1:1 stoichiometric amounts. In aerobic diazotrophic (able to grow on N(2) as sole N-source) bacteria, orthodox respiratory hupSL-encoded hydrogenase activity, associated with the cell membrane but facing the periplasm (exo-hydrogenase), has nevertheless been presumed responsible for recycling such endogenous hydrogen. As shown here, for Azorhizobium caulinodans diazotrophic cultures open to the atmosphere, exo-hydrogenase activity is of no consequence to hydrogen recycling. In a bioinformatic analysis, a novel seven-gene A. caulinodans hyq cluster encoding an integral-membrane, group-4, Ni,Fe-hydrogenase with homology to respiratory complex I (NADH: quinone dehydrogenase) was identified. By analogy, Hyq hydrogenase is also integral to the cell membrane, but its active site faces the cytoplasm (endo-hydrogenase). An A. caulinodans in-frame hyq operon deletion mutant, constructed by "crossover PCR", showed markedly decreased growth rates in diazotrophic cultures; normal growth was restored with added ammonium--as expected of an H(2)-recycling mutant phenotype. Using A. caulinodans hyq merodiploid strains expressing beta-glucuronidase as promoter-reporter, the hyq operon proved strongly and specifically induced in diazotrophic culture; as well, hyq operon induction required the NIFA transcriptional activator. Therefore, the hyq operon is constituent of the nif regulon. Representative of aerobic N(2)-fixing and H(2)-recycling alpha-proteobacteria, A. caulinodans possesses two respiratory Ni,Fe-hydrogenases: HupSL exo-hydrogenase activity drives exogenous H(2) respiration, and Hyq endo-hydrogenase activity recycles endogenous H(2), specifically that produced by N(2) fixation. To benefit human civilization, H(2) has generated considerable interest as potential renewable energy source as its makings are ubiquitous and its combustion yields no greenhouse gases. As such, the reversible, group-4 Ni,Fe-hydrogenases, such

  12. Evaluation for dinitrogen fixation of induced wheat nodules by 15N isotope dilution method

    International Nuclear Information System (INIS)

    Yao Yunyin; Zhen Ming; Chang Xizhong

    1993-11-01

    The results in pot experiments showed that the treating of 2,4-D and Azorhizobium caulinodans (2,4-D+A) could induce para-nodule formation on wheat roots. Plants treated grew normally. The plant height and dry weight are significantly higher than reference plants which are treated with 2,4-D+azorhizobium sterilized (2,4-D+AS). The nitrogenase activity is detected by ARA method. The N yield of most treated plants, especially in root systems, is higher than reference group that is measured by Kjeldahl method. The atom % 15 N excess in leaf and stem of treated plants measured by 15 N isotope dilution method is lower than that of reference group. Through four years experiments, it shows that para-nodules of wheat treated with 2,4-D+A could fix N 2 from air, but the ability of nitrogen fixation is lower and unstable. Although the nodulation efficiency could reach 100%, not each para-nodule induced can present activity of dinitrogen fixation. The amount of N fixed is 0.05∼18.1 mg/pot (0.01∼3.87 mg/plant). The net %Ndfa is 2.32%∼18.07%. The free-living N 2 fixing activity of azorhizobium is detected by 15 N isotope dilution method. The calculation of %Ndfa of nodulated wheat accurately is also discussed

  13. Sobrevivência de Bradyrhizobium e Azorhizobium em misturas de solo contaminadas com metais pesados

    Directory of Open Access Journals (Sweden)

    A. Matsuda

    2002-03-01

    Full Text Available Estudos foram realizados no Departamento de Ciência do Solo da Universidade Federal de Lavras (MG, no período de novembro/1999 a janeiro/2000, com o objetivo de avaliar a sobrevivência de estirpe e isolados de rizóbio em solo contaminado com metais pesados e verificar a relação entre tolerância do rizóbio a metais pesados em meio de cultura e sua sobrevivência em solo contaminado. Foram utilizados os dois microrganismos mais tolerantes [BR-4406 (estirpe recomendada para Enterolobium spp. e UFLA-01-457 (isolado de solo contaminado, ambos pertencentes ao gênero Bradyrhizobium ] e os dois mais sensíveis (UFLA-01-486 e UFLA-01-510, isolados de solo contaminado, pertencentes ao gênero Azorhizobium , todos selecionados de um grupo de 60estirpes/isolados em estudos prévios deste laboratório, em meio de cultura suplementado com metais pesados.Empregaram-se misturas de um Latossolo Vermelho-Escuro (LE que continham 0, 15 e 45% (v/v de um Latossolo Vermelho-Amarelo plíntico contaminado com Zn, Cd, Pb e Cu. As misturas de solo contaminado foram inoculadas com 20mL de cultura em YM na fase log das estirpes mencionadas, as quais foram testadas separadamente com três repetições. A avaliação do número de células viáveis no solo, realizada aos 0, 7, 14, 21 e 28dias de incubação, pelo método das diluições sucessivas e inoculação em placas com meio YMA, revelou comportamento diferenciado entre os organismos estudados. O número médio de células que sobreviveram ao final de 28 dias de incubação foi de (em UFCg-1de solo: 10(10,36, 10(10,29 e 10(9,70, para Bradyrhizobium, e 10(9,36, 10(7,54 e 0, para Azorhizobium em misturas de 0, 15 e 45% de solo contaminado, respectivamente. Portanto, houve maior sobrevivência de Bradyrhizobium do que de Azorhizobium , indicando maior tolerância a metais pesados do primeiro gênero.Como Bradyrhizobium foi também mais tolerante "in vitro", os resultados indicam haver relação entre o

  14. Tolerância de estirpes e isolados de Bradyrhizobium e de Azorhizobium a zinco, cádmio e cobre "in vitro"

    Directory of Open Access Journals (Sweden)

    I. C. B. Trannin

    2001-06-01

    Full Text Available Com o objetivo de avaliar a tolerância a metais pesados "in vitro" de estirpes inoculantes (I, isolados de solos contaminados com metais (ISC e de solos não contaminados (ISNC de Bradyrhizobium, simbiontes de Enterolobium contortisiliquum (tamboril e de Acacia mangium (acácia e de Azorhizobium, simbiontes de Sesbania virgata (sesbânia, foram realizados dois experimentos. No primeiro, dez estirpes e, ou, isolados para cada espécie vegetal foram testados em meio YMA modificado por adição de tampões biológicos (HEPES e MES, suplementado com diferentes concentrações de Cu, Cd e Zn. Cobre e Cd foram testados em concentrações de 0 a 40 mg L-1, para ambos os gêneros, enquanto Zn variou de 0 a 1.000 mg L-1, para Bradyrhizobium, e de 0 a 500 mg L-1, para Azorhizobium. O crescimento de rizóbio nas diferentes concentrações de metais foi avaliado com atribuição de valores para os padrões observados (0 a 5. Os ISC de ambos os gêneros foram mais tolerantes, mas Bradyrhizobium tolerou Zn (800 mg L-1 até duas vezes e Cu (40 mg L-1 até oito vezes mais que Azorhizobium. No segundo experimento, estirpes e isolados tolerantes (T, sensíveis (S e de tolerância média (TM a metais selecionados em meio YMA modificado foram estudados em soluções aquosas com diferentes concentrações de Cu (0 a 0,01 mg L-1, Cd e Zn (0 a 1,0 mg L-1. A avaliação do número de células viáveis em soluções de metais foi feita por contagem das unidades formadoras de colônia em 0, 24, 48, 72 e 96 h de incubação, pelo método das diluições sucessivas e inoculação em YMA. Embora as soluções de metais tenham sido mais discriminatórias quanto a tolerância a metais que o meio YMA, estes dois métodos mostraram que: (a Azorhizobium foi mais sensível que Bradyrhizobium, (b os ISC de ambos os gêneros foram mais tolerantes do que os ISNC e (c a ordem de toxidez dos metais foi Cu > Cd > Zn.

  15. mkt 571 new,uop mkt 571 new,uop mkt 571 new complete course,uop mkt 571 new entire course

    OpenAIRE

    admin

    2018-01-01

    UOP MKT 571 Final Exam Guide (New, 2018) NEW Check this A+ tutorial guideline at http://www.assignmentcloud.com/mkt-571-uop/mkt-571-final-exam-guide-new-2018-new For more classes visit http://www.uopassignments.com/ 1. A fundamental and distinctive mode of expression that appears in a field of human endeavor is called a __________. • style • theme • trend • pattern 2. A firm should use undifferentiated marketing...

  16. 25 CFR 571.13 - Copies of audit reports.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Copies of audit reports. 571.13 Section 571.13 Indians... MONITORING AND INVESTIGATIONS Audits § 571.13 Copies of audit reports. (a) Each tribe shall prepare and.../or reports as a result of the audit setting forth the results of each fiscal year. The submission...

  17. 28 CFR 571.12 - General characteristics.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false General characteristics. 571.12 Section 571.12 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE COMMUNITY PROGRAMS AND RELEASE RELEASE FROM CUSTODY Release Preparation Program § 571.12 General characteristics. (a) Staff shall...

  18. 25 CFR 571.10 - Geographical location.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Geographical location. 571.10 Section 571.10 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR COMPLIANCE AND ENFORCEMENT PROVISIONS MONITORING AND INVESTIGATIONS Subpoenas and Depositions § 571.10 Geographical location. The attendance of...

  19. UOP FIN 571 Final Exam Guide New

    OpenAIRE

    ADMIN

    2018-01-01

    UOP FIN 571 Final Exam Guide New Check this A+ tutorial guideline at http://www.fin571assignment.com/fin-571-uop/fin-571-final-exam-guide -latest For more classes visit http://www.fin571assignment.com Question 1 The underlying assumption of the dividend growth model is that a stock is worth: A. An amount computed as the next annual dividend divided by the required rate of return. B. An amount computed as the next annual dividend divided by the ma...

  20. 32 CFR 571.5 - Enlistment options.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Enlistment options. 571.5 Section 571.5 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY PERSONNEL RECRUITING AND ENLISTMENTS Recruiting and Enlistment Eligibility § 571.5 Enlistment options. Personnel who enlist in the Regular Army...

  1. 31 CFR 500.571 - Transactions related to telecommunications authorized.

    Science.gov (United States)

    2010-07-01

    ... telecommunications authorized. 500.571 Section 500.571 Money and Finance: Treasury Regulations Relating to Money and... telecommunications authorized. All transactions of U.S. common carriers incident to the receipt or transmission of telecommunications involving North Korea are authorized. Note: Exports or reexports to North Korea of goods and...

  2. 46 CFR 5.71 - Maritime labor disputes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Maritime labor disputes. 5.71 Section 5.71 Shipping... REGULATIONS-PERSONNEL ACTION Statement of Policy and Interpretation § 5.71 Maritime labor disputes. Under no circumstances will the Coast Guard exercise its authority for the purpose of favoring any party to a maritime...

  3. 12 CFR 571.2 - Examples.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Examples. 571.2 Section 571.2 Banks and Banking... Examples. The examples in this part are not exclusive. Compliance with an example, to the extent applicable, constitutes compliance with this part. Examples in a paragraph illustrate only the issue described in the...

  4. Dicty_cDB: SSD571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD571 (Link to dictyBase) - - - Contig-U16581-1 SSD571Z (Link... to Original site) - - SSD571Z 415 - - - - Show SSD571 Library SS (Link to library) Clone ID SSD571 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...Brassica oleracea genomic clone BONRK12, DNA sequence. 50 0.025 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  5. 12 CFR 571.20 - Coverage and definitions.

    Science.gov (United States)

    2010-01-01

    ... Affiliate Marketing § 571.20 Coverage and definitions. (a) Coverage. Subpart C of this part applies to... account numbers, names, or addresses. (4) Pre-existing business relationship. (i) In general. The term “pre-existing business relationship” means a relationship between a person, or a person's licensed...

  6. 25 CFR 571.6 - Access to papers, books, and records.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Access to papers, books, and records. 571.6 Section 571.6... PROVISIONS MONITORING AND INVESTIGATIONS Inspection of Books and Records § 571.6 Access to papers, books, and... operation shall provide the authorized representative with access to all papers, books, and records...

  7. 28 CFR 571.22 - Release clothing and transportation.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Release clothing and transportation. 571... AND RELEASE RELEASE FROM CUSTODY Release Gratuities, Transportation, and Clothing § 571.22 Release clothing and transportation. (a) Staff shall provide release clothing appropriate for the time of year and...

  8. STI571 (Gleevec) improves tumor growth delay and survival in irradiated mouse models of glioblastoma

    International Nuclear Information System (INIS)

    Geng Ling; Shinohara, Eric T.; Kim, Dong; Tan Jiahuai; Osusky, Kate; Shyr, Yu; Hallahan, Dennis E.

    2006-01-01

    Purpose: Glioblastoma multiforme (GBM) is a devastating brain neoplasm that is essentially incurable. Although radiation therapy prolongs survival, GBMs progress within areas of irradiation. Recent studies in invertebrates have shown that STI571 (Gleevec; Novartis, East Hanover, NJ) enhances the cytotoxicity of ionizing radiation. In the present study, the effectiveness of STI571 in combination with radiation was studied in mouse models of GBM. Methods and Materials: Murine GL261 and human D54 GBM cell lines formed tumors in brains and hind limbs of C57BL6 and nude mice, respectively. GL261 and D54 cells were treated with 5 μmol/L of STI571 for 1 h and/or irradiated with 3 Gy. Protein was analyzed by Western immunoblots probed with antibodies to caspase 3, cleaved caspase 3, phospho-Akt, Akt, and platelet-derived growth factor receptor (PDGFR) α and β. Tumor volumes were assessed in mice bearing GL261 or D54 tumors treated with 21 Gy administered in seven fractionated doses. Histologic sections from STI571-treated mice were stained with phospho-Akt and phospho-PDGFR β antibodies. Kaplan-Meier survival curves were used to study the response of mice bearing intracranial implants of GL261. Results: STI571 penetrated the blood-brain barrier, which resulted in a reduction in phospho-PDGFR in GBM. STI571-induced apoptosis in GBM was significantly enhanced by irradiation. STI571 combined with irradiation induced caspase 3 cleavage in GBM cells. Glioblastoma multiforme response to therapy correlated with an increase in tumor growth delay and survival when STI571 was administered in conjunction with daily irradiation. Conclusion: These findings suggest that STI571 has the potential to augment radiotherapy and thereby improve median survival

  9. 12 CFR 571.83 - Disposal of consumer information.

    Science.gov (United States)

    2010-01-01

    ... REPORTING Duties of Users of Consumer Reports Regarding Address Discrepancies and Records Disposal § 571.83 Disposal of consumer information. (a) Scope. This section applies to savings associations whose deposits... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Disposal of consumer information. 571.83...

  10. 14 CFR 29.571 - Fatigue evaluation of structure.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fatigue evaluation of structure. 29.571... § 29.571 Fatigue evaluation of structure. (a) General. An evaluation of the strength of principal... (including tolerance to flaws). The structure must be shown by analysis supported by test evidence and, if...

  11. 49 CFR 571.5 - Matter incorporated by reference

    Science.gov (United States)

    2010-10-01

    .... Phone: 1-800-232-4636; Web: http://www.cdc.gov/nchs “Weight, Height, and Selected Body Dimensions of..., Pennsylvania 15096. Phone: 1-724-776-4841; Web: http://www.sae.org Society of Automotive Engineers (SAE... Accommodation” 571.3; 571.210 Society of Automotive Engineers (SAE) Recommended Practice J1100a, revised...

  12. 12 CFR 571.27 - Renewal of opt-out.

    Science.gov (United States)

    2010-01-01

    ... period. Each opt-out renewal must be effective for a period of at least five years as provided in § 571... (ii) As part of a joint renewal notice from two or more members of an affiliated group of companies... provided by multiple companies with the ABC name or multiple companies in the ABC group or family of...

  13. 49 CFR 571.212 - Standard No. 212; Windshield mounting.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 212; Windshield mounting. 571.212... Motor Vehicle Safety Standards § 571.212 Standard No. 212; Windshield mounting. S1. Scope. This standard..., under the conditions of S6, the windshield mounting of the vehicle shall retain not less than the...

  14. 32 CFR 57.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... Individualized Educational Programs (IEP). (4) Monitoring of DoD programs providing EIS, special education, and... INTERVENTION AND SPECIAL EDUCATION SERVICES TO ELIGIBLE DOD DEPENDENTS § 57.1 Purpose. This part: (a... with disabilities (birth through 2 years, inclusive) and their families, and special education and...

  15. 12 CFR 571.21 - Affiliate marketing opt-out and exceptions.

    Science.gov (United States)

    2010-01-01

    ... solicitation for marketing purposes to a consumer with whom you have a pre-existing business relationship; (2... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Affiliate marketing opt-out and exceptions. 571... CREDIT REPORTING Affiliate Marketing § 571.21 Affiliate marketing opt-out and exceptions. (a) Initial...

  16. 12 CFR 571.26 - Delivery of opt-out notices.

    Science.gov (United States)

    2010-01-01

    ... Affiliate Marketing § 571.26 Delivery of opt-out notices. (a) In general. The opt-out notice must be... the notice on the Internet Web site at which the consumer obtained a product or service electronically... on an Internet Web site without requiring the consumer to acknowledge receipt of the notice. ...

  17. 21 CFR 571.7 - Withdrawal of petition without prejudice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Withdrawal of petition without prejudice. 571.7... Withdrawal of petition without prejudice. (a) In some cases the Commissioner will notify the petitioner that... clarification or the obtaining of additional data. This withdrawal will be without prejudice to a future filing...

  18. Effect of STI-571 (imatinib mesylate) in combination with retinoic acid and γ-irradiation on viability of neuroblastoma cells

    International Nuclear Information System (INIS)

    Roessler, Jochen; Zambrzycka, Izabella; Lagodny, Jeanette; Kontny, Udo; Niemeyer, Charlotte Marie

    2006-01-01

    Neuroblastoma (NB) expresses the tyrosine kinase receptors c-Kit, PDGFR-α and -β-targets for STI-571.We investigated a possible combination therapy of STI-571 with retinoic acid (RA) and γ-irradiation on NB cell viability in vitro. Expression of tyrosine kinase receptors and their ligands was examined in 6 NB cell lines by RT-PCR and FACS. The effect on cell viability was determined by MTT assay. Cell viability of all 6 NB cell lines was significantly inhibited after treatment with 20 μM STI-571 for 72 h, two cell lines responding already to 10 μM. Cell lines responded irrespective of their mRNA status or cell surface expression of c-Kit, PDGFR-α and -β. Co-incubation with 9-cis RA sensitized cells to the inhibitory effects of STI-571. However, pre-treatment with 9-cis RA resulted in resistance of NB cell lines to STI-571 and γ-irradiation. Treatment of NB with STI-571 in combination with 9-cis RA might be a therapeutic strategy for patients in consolidation therapy who have completed γ-irradiation therapy

  19. 49 CFR 571.214 - Standard No. 214; Side impact protection.

    Science.gov (United States)

    2010-10-01

    ...) of 4,536 kilograms (kg) (10,000 pounds (lb)) or less, except for walk-in vans, or otherwise specified..., in part or in total. Raised roof is used as defined in paragraph S4 of 49 CFR 571.216. Walk-in van... in S6 (door crush resistance), S7 (moving deformable barrier test), and S9 (vehicle-to-pole test...

  20. 27 CFR 5.71 - Use of the term “organic.”

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of the term âorganic.â 5.71 Section 5.71 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF DISTILLED SPIRITS Use of the Term âOrganic.â...

  1. 25 CFR 571.12 - Audit standards.

    Science.gov (United States)

    2010-04-01

    ... shall conform to generally accepted accounting principles and the annual audit shall conform to... INVESTIGATIONS Audits § 571.12 Audit standards. (a) Each tribe shall prepare comparative financial statements covering all financial activities of each class II and class III gaming operation on the tribe's Indian...

  2. 49 CFR 571.221 - Standard No. 221, School bus body joint strength.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 221, School bus body joint strength. 571.221 Section 571.221 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR VEHICLE SAFETY STANDARDS Federal Motor Vehicle Safety Standard...

  3. 12 CFR 571.22 - Scope and duration of opt-out.

    Science.gov (United States)

    2010-01-01

    ... REPORTING Affiliate Marketing § 571.22 Scope and duration of opt-out. (a) Scope of opt-out—(1) In general... described in the notice to make solicitations to the consumer. (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship with you or your affiliate, an opt-out notice...

  4. 12 CFR 571.25 - Reasonable and simple methods of opting out.

    Science.gov (United States)

    2010-01-01

    ... CREDIT REPORTING Affiliate Marketing § 571.25 Reasonable and simple methods of opting out. (a) In general... out, such as a form that can be electronically mailed or processed at an Internet Web site, if the... (15 U.S.C. 6801 et seq.), the affiliate sharing opt-out under the Act, and the affiliate marketing opt...

  5. 25 CFR 571.14 - Relationship of financial statements to fee assessment reports.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Relationship of financial statements to fee assessment..., submitted under 25 CFR part 514, with its audited or reviewed financial statements for each location and... COMPLIANCE AND ENFORCEMENT PROVISIONS MONITORING AND INVESTIGATIONS Audits § 571.14 Relationship of financial...

  6. 12 CFR 571.1 - Purpose and scope.

    Science.gov (United States)

    2010-01-01

    ...) Purpose. The purpose of this part is to establish standards regarding consumer report information. In... information. This part also contains a number of measures you must take to combat consumer fraud and related..., 2009, § 571.1 was amended by adding a new paragraph (b)(5), effective July 1, 2010. For the convenience...

  7. Gastrointestinal stromal tumor: role of spiral CT in diagnosis and evaluation of treatment with STI571

    International Nuclear Information System (INIS)

    Hu Jiawang; Zhou Linjiang; Wei Jiangong

    2011-01-01

    Objective: To investigate the CT appearance of gastrointestinal stromal tumors (GISTs) after oral imatinib mesylate (STI571) treatment. Methods: CT scans of 58 cases of GISTs proven by histology and immunohistochemistry were retrospectively analyzed. Dynamic contrast-enhanced CT of 8 patients after STI571 treatment was also evaluated. Results: The tumors originated from the stomach (n=28), small intestine (n=12), duodenum (n=6), colon (n=5), rectum (n=4), mesentery (n=2), and esophagus (n=2). Small GISTs appeared as round or oval, endo- or exophytic masses with well-defined margins and homogeneous contrast enhancement. Large lesions were often irregular infiltrative exophytic masses with heterogeneous enhancement. Ulceration, fistulization and neovascularity can be seen within the larger tumors. CT scans of 5 patients with good treatment response showed rapid transition form a heterogeneously hyper-attenuating pattern to homogeneously hypo-attenuating pattern with resolution of the enhancing tumor nodules and decreased tumor neovascularity. In 3 poor responders, CT showed enlarging or new enhancing nodules within the treated hypo-attenuating tumor, new lesions or metastasis outside the primary tumor. Conclusion: CT can demonstrate changes resulting from treatment of GISTs. It is valuable for guiding and assessing treatment response to STI571. (authors)

  8. 14 CFR 23.571 - Metallic pressurized cabin structures.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Metallic pressurized cabin structures. 23... AIRCRAFT AIRWORTHINESS STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Structure Fatigue Evaluation § 23.571 Metallic pressurized cabin structures. For normal, utility, and acrobatic...

  9. 49 CFR 571.303 - Standard No. 303; Fuel system integrity of compressed natural gas vehicles.

    Science.gov (United States)

    2010-10-01

    ... compressed natural gas vehicles. 571.303 Section 571.303 Transportation Other Regulations Relating to... system integrity of compressed natural gas vehicles. S1. Scope. This standard specifies requirements for the integrity of motor vehicle fuel systems using compressed natural gas (CNG), including the CNG fuel...

  10. 49 CFR 571.120 - Tire selection and rims and motor home/recreation vehicle trailer load carrying capacity...

    Science.gov (United States)

    2010-10-01

    ... industry or manufacturer's designation for a rim by style or code. Weather side means the surface area of... CFR 1.50) [42 FR 7144, Feb. 7, 1977] Editorial Note: For Federal Register citations affecting § 571...

  11. 49 CFR 571.110 - Tire selection and rims and motor home/recreation vehicle trailer load carrying capacity...

    Science.gov (United States)

    2010-10-01

    ... of manufacturer's designation for a rim by style or code. Rim width means nominal distance between... Note: For Federal Register citations affecting § 571.111 see the List of CFR Sections Affected which...

  12. 12 CFR 571.28 - Effective date, compliance date, and prospective application.

    Science.gov (United States)

    2010-01-01

    ... THE TREASURY FAIR CREDIT REPORTING Affiliate Marketing § 571.28 Effective date, compliance date, and... receive from an affiliate to make solicitations to a consumer if you receive such information prior to...

  13. Endophytic colonization of plant roots by nitrogen-fixing bacteria

    International Nuclear Information System (INIS)

    Cocking, Edward C.

    2001-01-01

    Nitrogen-fixing bacteria are able to enter into roots from the rhizosphere, particularly at the base of emerging lateral roots, between epidermal cells and through root hairs. In the rhizosphere growing root hairs play an important role in symbiotic recognition in legume crops. Nodulated legumes in endosymbiosis with rhizobia are amongst the most prominent nitrogen-fixing systems in agriculture. The inoculation of non-legumes, especially cereals, with various non-rhizobial diazotrophic bacteria has been undertaken with the expectation that they would establish themselves intercellularly within the root system, fixing nitrogen endophytic ally and providing combined nitrogen for enhanced crop production. However, in most instances bacteria colonize only the surface of the roots and remain vulnerable to competition from other rhizosphere micro-organisms, even when the nitrogen-fixing bacteria are endophytic, benefits to the plant may result from better uptake of soil nutrients rather than from endophytic nitrogen fixation. Azorhizobium caulinodans is known to enter the root system of cereals, other nonlegume crops and Arabidopsis, by intercellular invasion between epidermal cells and to internally colonize the plant intercellularly, including the xylem. This raises the possibility that xylem colonization might provide a nonnodular niche for endosymbiotic nitrogen fixation in rice, wheat, maize, sorghum and other non-legume crops. A particularly interesting, naturally occurring, non-qodular xylem colonising endophytic diazotrophic interaction with evidence for endophytic nitrogen fixation is that of Gluconacetobacter diazotrophicus in sugarcane. Could this beneficial endophytic colonization of sugarcane by G. diazotrophicus be extended to other members of the Gramineae, including the major cereals, and to other major non-legume crops of the World? (author)

  14. EXTENDED NEUTRAL HYDROGEN IN THE ALIGNED SHELL GALAXIES Arp 230 AND MCG -5-7-1: FORMATION OF DISKS IN MERGING GALAXIES?

    Energy Technology Data Exchange (ETDEWEB)

    Schiminovich, David; Van Gorkom, J. H. [Department of Astronomy, Columbia University, New York, NY 10027 (United States); Van der Hulst, J. M. [Kapteyn Astronomical Institute, 9700-AV Groningen (Netherlands)

    2013-02-01

    As part of an ongoing study of the neutral hydrogen (H I) morphology and kinematics of 'shell' elliptical galaxies, we present Very Large Array observations of two shell galaxies with aligned shells, Arp 230 and MCG -5-7-1. Our data provide the first H I images of Arp 230 and deeper images of MCG -5-7-1 than previously reported. Optical images of Arp 230 reveal a bright, aligned, interleaved shell system, making it an ideal candidate for 'phase-wrapped' shell formation following a radial encounter with a smaller companion. The fainter, non-interleaved shells of MCG -5-7-1 do not clearly favor a particular formation scenario. The H I we detect in both galaxies extends to nearly the same projected distance as the optical shells. In Arp 230 this gas appears to be anti-correlated with the aligned shells, consistent with our expectations for phase-wrapped shells produced in a radial encounter. In MCG -5-7-1, we observe gas associated with the shells making a 'spatial wrapping' or looping scenario more plausible. Although the extended gas component in both galaxies is unevenly distributed, the gas kinematics are surprisingly regular, looking almost like complete disks in rotation. We use the H I kinematics and optical data to determine mass-to-light ratios M/L{sub B} of 2.4{sup +3.0}{sub -0.5} (at 13.5 kpc, 4.5 R{sub e} ) for Arp 230 and M/L{sub B} of 30 {+-} 7 (at 40 kpc, 7 R{sub e} ) in MCG -5-7-1. In both systems we find that this ratio changes as a function of radius, indicating the presence of a dark halo. By comparing orbital and precession timescales, we conclude that the potentials are slightly flattened. We infer a 5%-10% flattening for Arp 230 and less flattening in the case of MCG -5-7-1. Finally, we present images of the H I associated with the inner disk or (polar) ring of each galaxy and discuss possible explanations for their different present-day star formation rates. We detect total H I masses of 1.1 Multiplication-Sign 10

  15. In situ determination of the reduction levels of cytochromes b and c in growing bacteria : a case study with N2-fixing Azorhizobium caulinodans

    NARCIS (Netherlands)

    Pronk, A.F.; Boogerd, F C; Stoof, C.; Oltmann, L F; Stouthamer, A.H.; van Verseveld, H W

    1993-01-01

    The determination of the in situ reduction levels of cytochromes b and c in growing bacteria is achieved by coupling a chemostat with a dual wavelength spectrophotometer. Visible light absorption spectra of cytochromes present in bacterial cells actively growing in a chemostat at a specific growth

  16. 49 CFR 571.114 - Standard No. 114; Theft protection and rollaway prevention.

    Science.gov (United States)

    2010-10-01

    ... STANDARDS Federal Motor Vehicle Safety Standards § 571.114 Standard No. 114; Theft protection and rollaway... incidence of crashes resulting from theft and accidental rollaway of motor vehicles. S2. Purpose. The... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 114; Theft protection and rollaway...

  17. Chandra, NuSTAR and NICER Observations of MAXI J1535-571

    Science.gov (United States)

    Neilsen, Joseph; Cackett, Ed; Fabian, Andy; Gendreau, Keith C.; Miller, Jon M.; Pasham, Dheeraj; Remillard, Ron; Steiner, Jack; Uttley, Phil

    2018-01-01

    In September 2017, MAXI detected an outburst of a previously-unknown transient, MAXI J1535-571. Subsequent radio and X-ray monitoring indicated that the source is a strong black hole candidate. We began a series of monitoring observations with Chandra HETGS, NuSTAR, and NICER to track the evolution of the outburst. Together, these three observatories represent an incredible opportunity to study the geometry of the accretion flow (via continuum spectroscopy), its variation with accretion state (via spectral variability), and any associated outflows or mass ejections (via line spectroscopy). We will present our analysis of this bright outburst and discuss the physics of accretion and ejection in this new black hole candidate.

  18. 42 CFR 493.571 - Disclosure of accreditation, State and CMS validation inspection results.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Disclosure of accreditation, State and CMS... Program § 493.571 Disclosure of accreditation, State and CMS validation inspection results. (a) Accreditation organization inspection results. CMS may disclose accreditation organization inspection results to...

  19. 12 CFR 571.23 - Contents of opt-out notice; consolidated and equivalent notices.

    Science.gov (United States)

    2010-01-01

    ... TREASURY FAIR CREDIT REPORTING Affiliate Marketing § 571.23 Contents of opt-out notice; consolidated and... concise, and must accurately disclose: (i) The name of the affiliate(s) providing the notice. If the notice is provided jointly by multiple affiliates and each affiliate shares a common name, such as “ABC...

  20. 12 CFR Appendix J to Part 571 - Interagency Guidelines on Identity Theft Detection, Prevention, and Mitigation

    Science.gov (United States)

    2010-01-01

    ...; service provider arrangements; significant incidents involving identity theft and management's response... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Interagency Guidelines on Identity Theft...—Interagency Guidelines on Identity Theft Detection, Prevention, and Mitigation Section 571.90 of this part...

  1. 12 CFR Appendix E to Part 571 - Interagency Guidelines Concerning the Accuracy and Integrity of Information Furnished to Consumer...

    Science.gov (United States)

    2010-01-01

    ... the consumer reporting agency properly to identify the consumer. (l) Conducting a periodic evaluation... and Integrity of Information Furnished to Consumer Reporting Agencies E Appendix E to Part 571 Banks... Information Furnished to Consumer Reporting Agencies OTS encourages voluntary furnishing of information to...

  2. Future heat-waves, droughts and floods in 571 European cities

    Science.gov (United States)

    Guerreiro, Selma B.; Dawson, Richard J.; Kilsby, Chris; Lewis, Elizabeth; Ford, Alistair

    2018-03-01

    Cities are particularly vulnerable to climate risks due to their agglomeration of people, buildings and infrastructure. Differences in methodology, hazards considered, and climate models used limit the utility and comparability of climate studies on individual cities. Here we assess, for the first time, future changes in flood, heat-waves (HW), and drought impacts for all 571 European cities in the Urban Audit database using a consistent approach. To capture the full range of uncertainties in natural variability and climate models, we use all climate model runs from the Coupled Model Inter-comparison Project Phase 5 (CMIP5) for the RCP8.5 emissions scenario to calculate Low, Medium and High Impact scenarios, which correspond to the 10th, 50th and 90th percentiles of each hazard for each city. We find that HW days increase across all cities, but especially in southern Europe, whilst the greatest HW temperature increases are expected in central European cities. For the low impact scenario, drought conditions intensify in southern European cities while river flooding worsens in northern European cities. However, the high impact scenario projects that most European cities will see increases in both drought and river flood risks. Over 100 cities are particularly vulnerable to two or more climate impacts. Moreover, the magnitude of impacts exceeds those previously reported highlighting the substantial challenge cities face to manage future climate risks.

  3. Corrective Action Investigation Plan for Corrective Action Unit 571: Area 9 Yucca Flat Plutonium Dispersion Sites, Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, Bernadine; Matthews, Patrick

    2013-07-01

    CAU 571 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 571, which comprises the following corrective action sites (CASs): • 09-23-03, Atmospheric Test Site S-9F • 09-23-04, Atmospheric Test Site T9-C • 09-23-12, Atmospheric Test Site S-9E • 09-23-13, Atmospheric Test Site T-9D • 09-45-01, Windrows Crater These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report. The sites will be investigated based on the data quality objectives (DQOs) developed on March 6, 2013, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office (now the Nevada Field Office). The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 571. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with CAU 571 CASs are from nuclear testing activities. The DQO process resulted in an assumption that total effective dose (TED) within a default contamination boundary exceeds the final action level (FAL) and requires corrective action. The presence and nature of contamination outside the default

  4. Hepatic Warm Ischemia-Reperfusion-Induced Increase in Pulmonary Capillary Filtration Is Ameliorated by Administration of a Multidrug Resistance-Associated Protein 1 Inhibitor and Leukotriene D4 Antagonist (MK-571) Through Reducing Neutrophil Infiltration and Pulmonary Inflammation and Oxidative Stress in Rats.

    Science.gov (United States)

    Yeh, D Y-W; Yang, Y-C; Wang, J-J

    2015-05-01

    Hepatopulmonary syndrome (HPS) is the major complication subsequent to liver ischemia and reperfusion (I/R) injury after resection or transplantation of liver. Hallmarks of HPS include increases in pulmonary leukotrienes and neutrophil recruitment and infiltrating across capillaries. We aimed to investigate the protective efficacy of MK-571, a multidrug resistance-associated protein 1 inhibitor and leukotriene D4 agonist, against hepatic I/R injury-associated change in capillary filtration. Eighteen Sprague-Dawley male rats were evenly divided into a sham-operated group, a hepatic I/R group, and an MK-571-treated I/R group. MK-571 was administered intraperitoneally 15 min before hepatic ischemia and every 12 hours during reperfusion. Ischemia was conducted by occluding the hepatic artery and portal vein for 30 min, followed by removing the clamps and closing the incision. Forty-eight hours after hepatic ischemia, we assessed the pulmonary capillary filtration coefficient (Kfc) through the use of in vitro-isolated, perfused rat lung preparation. We also measured the lung wet-to-dry weight ratio (W/D) and protein concentration in broncho-alveolar lavage fluid (PCBAL). Lung inflammation and oxidative stress were evaluated by use of tissue tumor necrosis factor (TNF)-α and malondialdehyde levels and lavage differential macrophage and neutrophil cell count. Hepatic I/R injury markedly increased Kfc, W/D, PCBAL, tissue TNF-α level, and differential neutrophil cell count (P < .05). MK-571 treatment reduced neutrophil infiltration and lung inflammation and improved pulmonary capillary filtration, collectively suggesting lung protection. Treatment with MK-571 before and during hepatic ischemia and reperfusion protects lung against pulmonary capillary barrier function impairment through decreasing pulmonary lung inflammation and lavage neutrophils. Copyright © 2015 Elsevier Inc. All rights reserved.

  5. Alteration of radiation response by two tyrosine kinase inhibitors: STI571 (Glivec) and BIBW 2992

    International Nuclear Information System (INIS)

    Huguet, F.

    2010-01-01

    Concurrent chemo-radiation is one of the main weapon in the treatment of cancer. The targeted therapies may act on the mechanisms of tumor resistance to radiation and are therefore very promising in combination with radiotherapy. The STI571 (imatinib or Gleevec) inhibits specifically the Bcr-Abl tyrosine kinase. It leads to radiosensitization in K562 chronic myeloid leukemia cell line by alterations of the cell cycle. The BIBW2992 is a selective inhibitor of EGFR and HER2. The BIBW 2992 shows cytotoxic and radiosensitizing effects on pancreatic adenocarcinoma cells BxPC3 and Capan-2, regardless of KRAS status. The mechanism underlying this radiosensitization is not unequivocal, involving both changes in the cell cycle and induction of mitotic death. Our results show that the combination of an inhibitor of tyrosine kinase with ionizing radiation may lead to a radiosensitization in vitro with mechanisms depending on the type of cell line. (author)

  6. Discovery of LFF571: An Investigational Agent for Clostridium difficile Infection

    Energy Technology Data Exchange (ETDEWEB)

    LaMarche, Matthew J.; Leeds, Jennifer A.; Amaral, Adam; Brewer, Jason T.; Bushell, Simon M.; Deng, Gejing; Dewhurst, Janetta M.; Ding, Jian; Dzink-Fox, JoAnne; Gamber, Gabriel; Jain, Akash; Lee, Kwangho; Lee, Lac; Lister, Troy; McKenney, David; Mullin, Steve; Osborne, Colin; Palestrant, Deborah; Patane, Michael A.; Rann, Elin M.; Sachdeva, Meena; Shao, Jian; Tiamfook, Stacey; Trzasko, Anna; Whitehead, Lewis; Yifru, Aregahegn; Yu, Donghui; Yan, Wanlin; Zhu, Qingming (Novartis)

    2012-11-09

    Clostridium difficile (C. difficile) is a Gram positive, anaerobic bacterium that infects the lumen of the large intestine and produces toxins. This results in a range of syndromes from mild diarrhea to severe toxic megacolon and death. Alarmingly, the prevalence and severity of C. difficile infection are increasing; thus, associated morbidity and mortality rates are rising. 4-Aminothiazolyl analogues of the antibiotic natural product GE2270 A (1) were designed, synthesized, and optimized for the treatment of C. difficile infection. The medicinal chemistry effort focused on enhancing aqueous solubility relative to that of the natural product and previous development candidates (2, 3) and improving antibacterial activity. Structure-activity relationships, cocrystallographic interactions, pharmacokinetics, and efficacy in animal models of infection were characterized. These studies identified a series of dicarboxylic acid derivatives, which enhanced solubility/efficacy profile by several orders of magnitude compared to previously studied compounds and led to the selection of LFF571 (4) as an investigational new drug for treating C. difficile infection.

  7. Branched Lateral Tail Fiber Organization in T5-Like Bacteriophages DT57C and DT571/2 is Revealed by Genetic and Functional Analysis

    Directory of Open Access Journals (Sweden)

    Alla K. Golomidova

    2016-01-01

    Full Text Available The T5-like siphoviruses DT57C and DT571/2, isolated from horse feces, are very closely related to each other, and most of their structural proteins are also nearly identical to T5 phage. Their LTFs (L-shaped tail fibers, however, are composed of two proteins, LtfA and LtfB, instead of the single Ltf of bacteriophage T5. In silico and mutant analysis suggests a possible branched structure of DT57C and DT571/2 LTFs, where the LtfB protein is connected to the phage tail via the LtfA protein and with both proteins carrying receptor recognition domains. Such adhesin arrangement has not been previously recognized in siphoviruses. The LtfA proteins of our phages are found to recognize different host O-antigen types: E. coli O22-like for DT57C phage and E. coli O87 for DT571/2. LtfB proteins are identical in both phages and recognize another host receptor, most probably lipopolysaccharide (LPS of E. coli O81 type. In these two bacteriophages, LTF function is essential to penetrate the shield of the host’s O-antigens. We also demonstrate that LTF-mediated adsorption becomes superfluous when the non-specific cell protection by O-antigen is missing, allowing the phages to bind directly to their common secondary receptor, the outer membrane protein BtuB. The LTF independent adsorption was also demonstrated on an O22-like host mutant missing O-antigen O-acetylation, thus showing the biological value of this O-antigen modification for cell protection against phages.

  8. SEM analysis of ionizing radiation effects in an analog to digital converter /AD571/

    Science.gov (United States)

    Gauthier, M. K.; Perret, J.; Evans, K. C.

    1981-01-01

    The considered investigation is concerned with the study of the total-dose degradation mechanisms in an IIL analog to digital (A/D) converter. The A/D converter is a 10 digit device having nine separate functional units on the chip which encompass several hundred transistors and circuit elements. It was the objective of the described research to find the radiation sensitive elements by a systematic search of the devices on the LSI chip. The employed technique using a scanning electron microscope to determine the functional blocks of an integrated circuit which are sensitive to ionizing radiation and then progressively zeroing in on the soft components within those blocks, proved extremely successful on the AD571. Four functional blocks were found to be sensitive to radiation, including the Voltage Reference, DAC, IIL Clock, and IIL SAR.

  9. Cyber Security in Nuclear Power Plants - U.S. NRC Regulatory Guide 5.71

    International Nuclear Information System (INIS)

    Pogacic, Goran

    2014-01-01

    We have already made a big step into new millennia and with it there is no more dilemma about presence of computers and internet in our lives. Almost all modern facilities struggle with this new dimension of information flow and how to use it to their best interest. But there is also the other side of the coin- the security threat. For nuclear power plants this threat poses even greater risk. In addition to protecting their trade secrets, personal data or other common targets of cyber attacks, nuclear power plants need to protect their digital computers, communication systems and networks up to and including the design basis threat (DBT). As stated in U.S. Nuclear Regulatory Commission (NRC) Regulatory Commission Regulations, Title 10, Code of Federal Regulations (CFR), section 73.1, 'Purpose and Scope' this includes protection against acts of radiological sabotage and prevention of the theft or diversion of special nuclear material. The main purpose of this paper is to explore the NRC Regulatory Guide (RG) 5.71 and its guidance in implementing cyber security requirements stated in NRC 10 CFR, section 73.54, 'Protection of Digital Computer and Communication Systems and Networks'. In particular, this section requires protection of digital computers, communication systems and networks associated with the following categories of functions: · safety-related and important-to-safety functions, · security functions, · emergency preparedness functions, including offsite communication, and · support systems and equipment which, if compromised, would adversely impact safety, security, or emergency preparedness functions. This section requires protection of such systems and networks from those cyber attacks that would act to modify, destroy, or compromise the integrity or confidentiality of data or software; deny access to systems, services or data; and impact the operation of systems, networks, and equipment. This paper will also present some of

  10. Tolerância de rizóbios de diferentes procedências ao zinco, cobre e cádmio Tolerance of rhizobia genera from different origins to zinc, copper and cadmium

    Directory of Open Access Journals (Sweden)

    Alexandre Matsuda

    2002-03-01

    Full Text Available Sessenta estirpes/isolados dos gêneros Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium e Azorhizobium, procedentes de diferentes locais (Mata Atlântica, Amazônia, culturas agrícolas e experimentos com metais pesados e de espécies hospedeiras pertencentes às subfamílias Papilionoideae, Mimosoideae e Caesalpinoideae, foram avaliadas quanto à tolerância a Zn, Cu e Cd em meio YMA modificado pela adição de tampões biológicos (HEPES e MES e suplementados com Cu (0 a 60 mg L-1, Cd (0 a 60 mg L-1 e Zn (0 a 1.000 mg L-1. Mediante padrões de crescimento atribuídos às culturas nas diferentes concentrações dos metais, avaliaram-se as concentrações máximas toleradas e as doses tóxicas destes metais para redução de crescimento em 25% (DT25 e 50% (DT50. Não houve influência da procedência na concentração máxima de metal tolerada. A ordem de sensibilidade aos metais, considerando-se as concentrações máximas toleradas, foi Azorhizobium > Rhizobium = Mesorhizobium = Sinorhizobium > Bradyrhizobium. A DT25 e a DT50 foram úteis para diferenciarem estirpes/isolados de um mesmo gênero, que atingiram a mesma concentração máxima tolerada a Zn, Cu e Cd. A ordem de toxicidade dos metais estudados foi Cu > Cd > Zn.Sixty strains/isolates of the genera Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium and Azorhizobium, isolated from different hosts (legume subfamilies: Papilionoideae, Mimosoideae and Caesalpinoideae and location (Atlantic Forest, Amazon region, crop plantings and heavy metal experiments, were evaluated for Zn, Cu and Cd tolerance in YMA medium modified by the addition of biological buffers (HEPES and MES and supplemented with Cu (0 to 60 mg L-1, Cd (0 to 60 mg L-1, and Zn (0 to 1,000 mg L-1sulphates. Growth standards were applied to evaluate rhizobia cultures growth at different metal concentrations, allowing evaluation of highest tolerated concentrations of Zn, Cu, and Cd and the toxic doses

  11. Corrective Action Decision Document/Closure Report for Corrective Action Unit 571: Area 9 Yucca Flat Plutonium Dispersion Sites, Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick

    2014-08-01

    The purpose of this CADD/CR is to provide documentation and justification that no further corrective action is needed for the closure of CAU 571 based on the implementation of corrective actions. This includes a description of investigation activities, an evaluation of the data, and a description of corrective actions that were performed. The CAIP provides information relating to the scope and planning of the investigation. Therefore, that information will not be repeated in this document.

  12. Future changes in heat-waves, droughts and floods in 571 European cities

    Science.gov (United States)

    Guerreiro, Selma; Dawson, Richard; Kilsby, Chris; Lewis, Elizabeth; Ford, Alistair

    2017-04-01

    Future changes in heat-waves, droughts and floods were assessed for 571 European cities. We used all available climate model runs from the Coupled Model Intercomparison Project Phase 5 - CMIP5 - for their higher emission scenario (RCP8.5) and grouped the projections into Low, Mid and High impact scenarios. This resulted in impact projections outside the range of published literature, but enabled us to better understand uncertainties in future climate projections (both due to climate model errors but also the effects of natural variability) therefore providing the basis for broad scale risk analysis and thereafter identification of robust adaptation strategies. While heat-waves will worsen for every European city, changes in droughts and floods are spatially variable and climate model dependent. The largest increases in the number of heat-wave days are shown to be in southern Europe, but higher heat-wave maximum temperature increases are expected in the mid-latitudes. In the low impact scenario, drought conditions are expected to intensify only in southern Europe while river flooding in expected to worsen in the north. However, in the high impact scenario most European cities show increases in both drought conditions and river flooding. There is a very wide range of projections for future changes in Europe with disagreement between different studies, partly due to their methodological differences but potentially also due to the small number of climate model runs that limits the uncertainties due to natural variability and model errors that each study captures.

  13. Effect of pH on Thermoanaerobacterium thermosaccharolyticum DSM 571 growth, spore heat resistance and recovery.

    Science.gov (United States)

    Mtimet, Narjes; Guégan, Stéphanie; Durand, Lucile; Mathot, Anne-Gabrielle; Venaille, Laurent; Leguérinel, Ivan; Coroller, Louis; Couvert, Olivier

    2016-05-01

    Thermophilic spore-forming bacteria are potential contaminants in several industrial sectors involving high temperatures (40-65 °C) in the manufacturing process. Among those thermophilic spore-forming bacteria, Thermoanaerobacterium thermosaccharolyticum, called "the swelling canned food spoiler", has generated interest over the last decade in the food sector. The aim of this study was to investigate and to model pH effect on growth, heat resistance and recovery abilities after a heat-treatment of T. thermosaccharolyticum DSM 571. Growth and sporulation were conducted on reinforced clostridium media and liver broth respectively. The highest spore heat resistances and the greatest recovery ability after a heat-treatment were obtained at pH condition allowing maximal growth rate. Growth and sporulation boundaries were estimated, then models using growth limits as main parameters were extended to describe and quantify the effect of pH on recovery of injured spores after a heat-treatment. So, cardinal values were used as a single set of parameters to describe growth, sporulation and recovery abilities. Besides, this work suggests that T. thermosaccharolyticum preserve its ability for germination and outgrowth after a heat-treatment at a low pH where other high resistant spore-forming bacteria like Geobacillus stearothermophilus are unable to grow. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Facial markers in second- and third-trimester fetuses with trisomy 18 or 13, triploidy or Turner syndrome.

    Science.gov (United States)

    Kagan, K O; Sonek, J; Berg, X; Berg, C; Mallmann, M; Abele, H; Hoopmann, M; Geipel, A

    2015-07-01

    To examine the effectiveness of nasal bone (NB) evaluation (including NB length (NBL)), prenasal thickness (PT) measurement, the PT:NBL ratio and the prefrontal space ratio (PFSR) in the identification of fetuses with trisomy 18 or 13, triploidy or Turner syndrome. This was a retrospective study using stored midsagittal two-dimensional images of the facial profile of fetuses with trisomy 18 or 13, triploidy or Turner syndrome in the second and third trimesters. For images of acceptable quality, measurements were obtained of NBL (where NB was present), PT, the PT:NBL ratio and PFSR, and these measurements were compared with previously published normal ranges. The search of databases identified 189 fetuses that met the study criteria: 132 (69.8%) with trisomy 18, 40 (21.2%) with trisomy 13, 10 (5.3%) with triploidy and seven (3.7%) with Turner syndrome. The NB was either absent or its measurement was below the 5(th) centile in 67 (50.8%), 20 (50.0%), five (50.0%) and two (28.6%) of the fetuses with trisomy 18, trisomy 13, triploidy and Turner syndrome, respectively. The PT measurement was above the 95(th) centile in 24 (18.2%), six (15.0%), one (10.0%) and one (14.3%) of the affected fetuses, respectively. The PFSR was abnormal in 72 (54.5%), 29 (72.5%), seven (70%) and four (57.1%) of the cases and the PT:NBL ratio was above the 95(th) centile or the nasal bone was absent in 72 (54.5%), 20 (50.0%), six (60.0%) and four (57.1%) cases, respectively. Although each of the facial markers considered provides some useful information in screening for trisomy 18, trisomy 13, triploidy and Turner syndrome, the performance of none of the markers appears to be as good as that in screening for trisomy 21. Copyright © 2014 ISUOG. Published by John Wiley & Sons Ltd.

  15. Risk of Psychiatric Disorders Among Individuals With the 22q11.2 Deletion or Duplication

    DEFF Research Database (Denmark)

    Hoeffding, Louise K; Trabjerg, Betina B; Olsen, Line

    2017-01-01

    ) age at diagnosis of any psychiatric disorder was 12.5 (8.3) years for individuals with deletions and 6.1 (0.9) years for duplication carriers. A parental diagnosis of schizophrenia-but not of other psychiatric diagnoses-was associated with a 22q11.2 deletion, and parental psychiatric diagnoses other.......2 deletion or duplicationwas performed. A total of 3 768 943 individuals born in Denmark from 1955 to 2012 were followed up during the study period (total follow-up, 57.1 million person-years). Indicators of 22q11.2 deletion or duplication and cumulative incidenceswere estimated using a nested case...

  16. 12 CFR 571.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... similar organization. (e) Consumer means an individual. (f)-(h) [Reserved] (i) Common ownership or common corporate control means a relationship between two companies under which: (1) One company has, with respect... power to exercise, directly or indirectly, a controlling influence over the management or policies of a...

  17. 21 CFR 571.1 - Petitions.

    Science.gov (United States)

    2010-04-01

    ... method of manufacture and the analytical controls used during the various stages of manufacturing... is incomplete. (v) An assay method or other analytical method, unless it serves no regulatory or... food additive, articles used as components thereof, or of the food in which the additive is proposed to...

  18. Reflection Spectra of the Black Hole Binary Candidate MAXI J1535-571 in the Hard State Observed by NuSTAR

    Science.gov (United States)

    Xu, Yanjun; Harrison, Fiona A.; García, Javier A.; Fabian, Andrew C.; Fürst, Felix; Gandhi, Poshak; Grefenstette, Brian W.; Madsen, Kristin K.; Miller, Jon M.; Parker, Michael L.; Tomsick, John A.; Walton, Dominic J.

    2018-01-01

    We report on a Nuclear Spectroscopic Telescope Array (NuSTAR) observation of the recently discovered bright black hole candidate MAXI J1535-571. NuSTAR observed the source on MJD 58003 (five days after the outburst was reported). The spectrum is characteristic of a black hole binary in the hard state. We observe clear disk reflection features, including a broad Fe Kα line and a Compton hump peaking around 30 keV. Detailed spectral modeling reveals a narrow Fe Kα line complex centered around 6.5 keV on top of the strong relativistically broadened Fe Kα line. The narrow component is consistent with distant reflection from moderately ionized material. The spectral continuum is well described by a combination of cool thermal disk photons and a Comptonized plasma with the electron temperature {{kT}}{{e}}=19.7+/- 0.4 keV. An adequate fit can be achieved for the disk reflection features with a self-consistent relativistic reflection model that assumes a lamp-post geometry for the coronal illuminating source. The spectral fitting measures a black hole spin a> 0.84, inner disk radius {R}{in}lamp-post height h={7.2}-2.0+0.8 {r}{{g}} (statistical errors, 90% confidence), indicating no significant disk truncation and a compact corona. Although the distance and mass of this source are not currently known, this suggests the source was likely in the brighter phases of the hard state during this NuSTAR observation.

  19. 12 CFR 571.43 - Direct disputes.

    Science.gov (United States)

    2010-01-01

    ..., credit standing, credit capacity, character, general reputation, personal characteristics, or mode of... provided in paragraph (a)(1) of this section) such as name(s), date of birth, Social Security number... information; a police report; a fraud or identity theft affidavit; a court order; or account statements. (e...

  20. 7 CFR 57.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... for human consumption. Inspection means the application of such inspection methods and techniques as... who are actively engaged in the administration, application, and direction of the surveillance... part. Ultimate consumer means any household consumer, restaurant, institution, or any other party who...

  1. Risk factors for unfavourable postoperative outcome in patients with Crohn's disease undergoing right hemicolectomy or ileocaecal resection. An international audit by ESCP and S-ECCO

    DEFF Research Database (Denmark)

    2018-01-01

    and intra-operative risk factors on 30-day postoperative outcome in patients undergoing surgery for Crohn's disease. MethodThis was an international prospective snapshot audit including consecutive patients undergoing right hemicolectomy or ileocaecal resection. The study analysed a subset of patients who...... to produce odds ratios and 95% confidence intervals. ResultsIn all, 375 resections in 375 patients were included. The median age was 37 and 57.1% were women. In multivariate analyses, postoperative complications were associated with preoperative parenteral nutrition (OR 2.36, 95% CI 1.10-4.97), urgent...

  2. 12 CFR 571.30 - Obtaining or using medical information in connection with a determination of eligibility for credit.

    Science.gov (United States)

    2010-01-01

    ... current and that the consumer has no delinquencies in her repayment history. If the existing debt were... health, condition or history, type of treatment, or prognosis into account as part of any such... use information about: (A) The dollar amount, repayment terms, repayment history, and similar...

  3. Technical Cybersecurity Controls for Nuclear Facilities

    International Nuclear Information System (INIS)

    Oh, Jinseok; Ryou, Jaecheol; Kim, Youngmi; Jeong, Choonghei

    2014-01-01

    To strengthen cybersecurity for nuclear facilities, many countries take a regulatory approach. For example, US Government issued several regulations . Title 10, of the Code of Federal Regulations, Section 73.54, 'Protection of Digital Computer and Communication Systems and Networks (10 CFR 73.54) for cybersecurity requirements and Regulatory Guide 5.71 (RG. 5.71) for cybersecurity guidance and so on. In the case of Korea, Korean Government issued '8.22 Cybersecurity of I and C systems (KINS/RG-NO8.22). In particular, Reg. 5.71 provides a list of security controls to address the potential cyber risks to a nuclear facilities. Implementing and adopting security controls, we can improve the level of cybersecurity for nuclear facilities. RG 5.71 follows the recommendation of NIST SP 800-53. NIST standard provides security controls for IT systems. And NRC staff tailored the controls in NIST standards to unique environments of nuclear facilities. In this paper, we are going to analysis and compare NRC RG 5.71 and NIST SP800-53, in particular, for technical security controls. If RG 5.71 omits the specific security control that is included in SP800-53, we would review that omitting is adequate or not. If RG 5.71 includes the specific security control that is not included in SP800-53, we would also review the rationale. And we are going to some security controls to strengthen cybersecurity of nuclear facilities. In this paper, we compared and analyzed of two regulation in technical security controls. RG 5.71 that is based on NIST standard provides well-understood security controls for nuclear facility. But some omitting from NIST standard can threaten security state of nuclear facility

  4. Technical Cybersecurity Controls for Nuclear Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Jinseok; Ryou, Jaecheol [Chungnam National Univ., Daejeon (Korea, Republic of); Kim, Youngmi; Jeong, Choonghei [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2014-05-15

    To strengthen cybersecurity for nuclear facilities, many countries take a regulatory approach. For example, US Government issued several regulations . Title 10, of the Code of Federal Regulations, Section 73.54, 'Protection of Digital Computer and Communication Systems and Networks (10 CFR 73.54) for cybersecurity requirements and Regulatory Guide 5.71 (RG. 5.71) for cybersecurity guidance and so on. In the case of Korea, Korean Government issued '8.22 Cybersecurity of I and C systems (KINS/RG-NO8.22). In particular, Reg. 5.71 provides a list of security controls to address the potential cyber risks to a nuclear facilities. Implementing and adopting security controls, we can improve the level of cybersecurity for nuclear facilities. RG 5.71 follows the recommendation of NIST SP 800-53. NIST standard provides security controls for IT systems. And NRC staff tailored the controls in NIST standards to unique environments of nuclear facilities. In this paper, we are going to analysis and compare NRC RG 5.71 and NIST SP800-53, in particular, for technical security controls. If RG 5.71 omits the specific security control that is included in SP800-53, we would review that omitting is adequate or not. If RG 5.71 includes the specific security control that is not included in SP800-53, we would also review the rationale. And we are going to some security controls to strengthen cybersecurity of nuclear facilities. In this paper, we compared and analyzed of two regulation in technical security controls. RG 5.71 that is based on NIST standard provides well-understood security controls for nuclear facility. But some omitting from NIST standard can threaten security state of nuclear facility.

  5. Impact of phase I or phase II enzyme polymorphisms on lymphocyte DNA adducts in subjects exposed to urban air pollution and environmental tobacco smoke

    Czech Academy of Sciences Publication Activity Database

    Georgiadis, P.; Demopoulos, N. A.; Topinka, Jan; Stephanou, G.; Stoikidou, M.; Bekyrou, M.; Katsouyianni, K.; Šrám, Radim; Autrup, H.; Kyrtopoulos, S. A.

    2004-01-01

    Roč. 149, 1-3 (2004), s. 269-280 ISSN 0378-4274 Institutional research plan: CEZ:AV0Z5039906 Keywords : DNA adducts Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 2.571, year: 2004

  6. The Outcome of Postoperative Radiation Therapy for Patients with Stage II Pancreatic Cancer (T3 or N1 Disease)

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang Won; Chun, Misun; Kim, Myung Wook; Kim, Wook Hwan; Kang, Seok Yun; Kang, Seung Hee; Oh, Young Taek; Lee, Sunyoung; Yang, Juno [Ajou University School of Medicine, Suwon (Korea, Republic of)

    2007-12-15

    Purpose: To analyze retrospectively the outcome of postoperative radiation therapy with or without concurrent chemotherapy for curatively resected stage II pancreatic cancer with T3 or N1 disease. Materials and Methods: Between January 1996 and December 2005, twenty-eight patients completed adjuvant radiation therapy at Ajou University Hospital. The patients had either pathologic T3 stage or N1 stage. The radiation target volume encompassed the initial tumor bed identified preoperatively, resection margin area and celiac nodal area. In the case of N1 patients, the radiation field extended to the lower margin of the L3 vertebra for covering both para-aortic lymph nodes bearing area. The median total radiation dose was 50 Gy. Ten patients received concurrent chemotherapy. Results: Thirteen patients (46%) showed loco-regional recurrences. The celiac axis nodal area was the most frequent site (4 patients). Five patients showed both loco-regional recurrence and a distant metastasis. Patients with positive lymph nodes had a relatively high probability of a distant metastasis (57.1%). Patients that had a positive resection margin showed a relatively high local failure rate (57.1%). The median disease-free survival period of all patients was 6 months and the 1- and 2-year disease free survival rates were 27.4% and 8.2%, respectively. The median overall survival period was 9 months. The 2- and 3-year overall survival rates were 31.6% and 15.8%, respectively. Conclusion: The pancreatic cancer patients with stage II had a high risk of local failure and a high risk of a distant metastasis. We suggest the concurrent use of an effective radiation-sensitizing chemotherapeutic drug and adjuvant chemotherapy after postoperative radiation therapy for the treatment of patients with stage II pancreatic cancer.

  7. The Outcome of Postoperative Radiation Therapy for Patients with Stage II Pancreatic Cancer (T3 or N1 Disease)

    International Nuclear Information System (INIS)

    Kim, Sang Won; Chun, Misun; Kim, Myung Wook; Kim, Wook Hwan; Kang, Seok Yun; Kang, Seung Hee; Oh, Young Taek; Lee, Sunyoung; Yang, Juno

    2007-01-01

    Purpose: To analyze retrospectively the outcome of postoperative radiation therapy with or without concurrent chemotherapy for curatively resected stage II pancreatic cancer with T3 or N1 disease. Materials and Methods: Between January 1996 and December 2005, twenty-eight patients completed adjuvant radiation therapy at Ajou University Hospital. The patients had either pathologic T3 stage or N1 stage. The radiation target volume encompassed the initial tumor bed identified preoperatively, resection margin area and celiac nodal area. In the case of N1 patients, the radiation field extended to the lower margin of the L3 vertebra for covering both para-aortic lymph nodes bearing area. The median total radiation dose was 50 Gy. Ten patients received concurrent chemotherapy. Results: Thirteen patients (46%) showed loco-regional recurrences. The celiac axis nodal area was the most frequent site (4 patients). Five patients showed both loco-regional recurrence and a distant metastasis. Patients with positive lymph nodes had a relatively high probability of a distant metastasis (57.1%). Patients that had a positive resection margin showed a relatively high local failure rate (57.1%). The median disease-free survival period of all patients was 6 months and the 1- and 2-year disease free survival rates were 27.4% and 8.2%, respectively. The median overall survival period was 9 months. The 2- and 3-year overall survival rates were 31.6% and 15.8%, respectively. Conclusion: The pancreatic cancer patients with stage II had a high risk of local failure and a high risk of a distant metastasis. We suggest the concurrent use of an effective radiation-sensitizing chemotherapeutic drug and adjuvant chemotherapy after postoperative radiation therapy for the treatment of patients with stage II pancreatic cancer

  8. Development of Individual Equipment Requirements for the Afghan National Army Needs Improvement

    Science.gov (United States)

    2012-05-25

    Secur n Security F Communic t of the Isla ency Managemen ining Missio ion Comman nal Clothin operation I TACOM L Frequency eb site of th rts or...of information, including suggestions for reducing this burden, to Washington Headquarters Services, Directorate for Information Operations and...conta or fax (571 Deputy Ins by fax (571 of Inspecto General for F25-04 ity Forces orces Fund ations-Electr mic Republ t Command n-Afghanis d

  9. 28 CFR 571.72 - Additional designated offenses.

    Science.gov (United States)

    2010-07-01

    ... abuse, or child sexual abuse; (2) § 22-2012 (Sexual performances using minors—prohibited acts); (3) § 22... to commit first degree sexual abuse; (6) § 22-2704 (Abducting or enticing child from his or her home for purposes of prostitution; harboring such child); (7) § 22-4102 (First degree sexual abuse); (8...

  10. Analysis of Operational and Management Cybersecurity Controls for Nuclear Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Jin Seok; Ryou, Jae Cheol [Chungnam National University, Dajeon (Korea, Republic of)

    2014-08-15

    U.S. NRC developed this RG 5.71 by tailoring the baseline security controls described in NIST Special Publication 800-53 'Recommended Security Controls for Federal Information Systems and Organizations' to provide an acceptable method to comply with the 10 CFR 73.54. The purpose of this publication is to provide guidelines for selecting and specifying security controls for information systems. In this paper, we are going to analyze and compare the NRC RG 5.71 and the NIST SP800-53, in particular, for operational security controls and management security controls. If RG 5.71 omits the specific security control that is included in SP800-53, we would review that omitting is adequate or not. If RG 5.71 includes the specific security control that is not included in SP800-53, we would also review the rationale. And we are going to consider some security controls to strengthen cybersecurity of nuclear facilities.

  11. Analysis of Operational and Management Cybersecurity Controls for Nuclear Facilities

    International Nuclear Information System (INIS)

    Oh, Jin Seok; Ryou, Jae Cheol

    2014-01-01

    U.S. NRC developed this RG 5.71 by tailoring the baseline security controls described in NIST Special Publication 800-53 'Recommended Security Controls for Federal Information Systems and Organizations' to provide an acceptable method to comply with the 10 CFR 73.54. The purpose of this publication is to provide guidelines for selecting and specifying security controls for information systems. In this paper, we are going to analyze and compare the NRC RG 5.71 and the NIST SP800-53, in particular, for operational security controls and management security controls. If RG 5.71 omits the specific security control that is included in SP800-53, we would review that omitting is adequate or not. If RG 5.71 includes the specific security control that is not included in SP800-53, we would also review the rationale. And we are going to consider some security controls to strengthen cybersecurity of nuclear facilities

  12. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 7. Issue front cover thumbnail Issue back cover thumbnail. Volume 20, Issue 7. July 2015, pages 571-664. pp 571-571 Editorial. Editorial · Rajaram Nityananda · More Details Fulltext PDF. pp 572-573 Table of Contents. Table of Contents.

  13. Dicty_cDB: SLG376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 572Q) /CSM/SS/SSD5-C/SSD572Q.Seq.d/ 555 e-157 CHB571 (CHB571Q) /CSM/CH/CHB5-C/CHB571Q.Seq.d/ 494 e-139 CFD492 (CFD492...Q) /CSM/CF/CFD4-D/CFD492Q.Seq.d/ 474 e-133 own update 2003.10.30 Homology vs DNA Score E Sequences

  14. Aerobic or Resistance Exercise, or Both, in Dieting Obese Older Adults.

    Science.gov (United States)

    Villareal, Dennis T; Aguirre, Lina; Gurney, A Burke; Waters, Debra L; Sinacore, David R; Colombo, Elizabeth; Armamento-Villareal, Reina; Qualls, Clifford

    2017-05-18

    Obesity causes frailty in older adults; however, weight loss might accelerate age-related loss of muscle and bone mass and resultant sarcopenia and osteopenia. In this clinical trial involving 160 obese older adults, we evaluated the effectiveness of several exercise modes in reversing frailty and preventing reduction in muscle and bone mass induced by weight loss. Participants were randomly assigned to a weight-management program plus one of three exercise programs - aerobic training, resistance training, or combined aerobic and resistance training - or to a control group (no weight-management or exercise program). The primary outcome was the change in Physical Performance Test score from baseline to 6 months (scores range from 0 to 36 points; higher scores indicate better performance). Secondary outcomes included changes in other frailty measures, body composition, bone mineral density, and physical functions. A total of 141 participants completed the study. The Physical Performance Test score increased more in the combination group than in the aerobic and resistance groups (27.9 to 33.4 points [21% increase] vs. 29.3 to 33.2 points [14% increase] and 28.8 to 32.7 points [14% increase], respectively; P=0.01 and P=0.02 after Bonferroni correction); the scores increased more in all exercise groups than in the control group (Pexercise groups but did not change significantly in the control group. Lean mass decreased less in the combination and resistance groups than in the aerobic group (56.5 to 54.8 kg [3% decrease] and 58.1 to 57.1 kg [2% decrease], respectively, vs. 55.0 to 52.3 kg [5% decrease]), as did bone mineral density at the total hip (grams per square centimeter; 1.010 to 0.996 [1% decrease] and 1.047 to 1.041 [0.5% decrease], respectively, vs. 1.018 to 0.991 [3% decrease]) (PExercise-related adverse events included musculoskeletal injuries. Of the methods tested, weight loss plus combined aerobic and resistance exercise was the most effective in improving

  15. 12 CFR 571.32 - Sharing medical information with affiliates.

    Science.gov (United States)

    2010-01-01

    ... based on the payment transactions of the consumer for medical products or services; or (3) An aggregate list of identified consumers based on payment transactions for medical products or services. (c... activities described in section 18B of the model Privacy of Consumer Financial and Health Information...

  16. 12 CFR 571.24 - Reasonable opportunity to opt out.

    Science.gov (United States)

    2010-01-01

    ... completing a form that requires consumers to write a “yes” or “no” to indicate their opt-out preference or... eligibility information about a consumer that you receive from an affiliate to make a solicitation to the consumer about your products or services, unless the consumer is provided a reasonable opportunity to opt...

  17. Functional analysis of P-glycoprotein and multidrug resistance associated protein related multidrug resistance in AML-blasts.

    Science.gov (United States)

    Brügger, D; Herbart, H; Gekeler, V; Seitz, G; Liu, C; Klingebiel, T; Orlikowsky, T; Einsele, H; Denzlinger, C; Bader, P; Niethammer, D; Beck, J F

    1999-05-01

    Despite the high effectiveness of various P-glycoprotein (P-gp) modulating substances in vitro their clinical value e.g. for combination treatment of acute myelogenous leukemias (AML) remains still unclear. This might be explainable by recent findings that other factors than P-gp (e.g. the multidrug resistance associated protein (MRP)) may also be involved in clinical occurring drug resistance. To study P-gp and MRP mediated MDR in AML blasts from patients with relapses at the functional level we measured rhodamine 123 (RHO) efflux in combination with a P-gp specific (SDZ PSC 833) or a MRP specific (MK571) modulator, respectively. Furthermore, direct antineoplastic drug action was monitored by determination of damaged cell fraction of a blast population using flow cytometry. We generally found strongly modulated RHO efflux by SDZ PSC 833 but slight RHO-efflux modulation by MK571 in blasts from relapsed states of AML expressing MDR1 or MRP mRNA at various levels. We could not demonstrate, though, significant PSC 833 or MK571 mediated modulation of the cytotoxic effects of etoposide. The results point to the possibility that combination of etoposide and a modulator might not improve responses to chemotherapy by targeting P-gp or MRP exclusively.

  18. Multidrug-resistance-associated protein plays a protective role in menadione-induced oxidative stress in endothelial cells.

    Science.gov (United States)

    Takahashi, Kyohei; Shibata, Tomohito; Oba, Tatsuya; Ishikawa, Tetsuya; Yoshikawa, Masahito; Tatsunami, Ryosuke; Takahashi, Kazuhiko; Tampo, Yoshiko

    2009-02-13

    Menadione, a redox-cycling quinone known to cause oxidative stress, binds to reduced glutathione (GSH) to form glutathione S-conjugate. Glutathione S-conjugates efflux is often mediated by multidrug-resistance-associated protein (MRP). We investigated the effect of a transporter inhibitor, MK571 (3-[[3-[2-(7-chloroquinolin-2-yl)vinyl]phenyl]-(2-dimethylcarbamoylethylsulfanyl)methylsulfanyl] propionic acid), on menadione-induced oxidative stress in bovine aortic endothelial cells (BAECs). BAECs were treated with menadione and MK571, and cell viability was measured. Modulation of intracellular GSH levels was performed with buthionine sulfoximine and GSH ethyl ester treatments. Intracellular superoxide was estimated by dihydroethidium oxidation using fluorescence microscopy or flow cytometry. Expression of MRP was determined by flow cytometry using phycoerythrin-conjugated anti-MRP monoclonal antibody. Intracellular GSH depletion by buthionine sulfoximine promoted the loss of viability of BAECs exposed to menadione. Exogenous GSH, which does not permeate the cell membrane, or GSH ethyl ester protected BAECs against the loss of viability induced by menadione. The results suggest that GSH binds to menadione outside the cells as well as inside. Pretreatment of BAECs with MK571 dramatically increased intracellular levels of superoxide generated from menadione, indicating that menadione may accumulate in the intracellular milieu. Finally, we found that MK571 aggravated menadione-induced toxicity in BAECs and that MRP levels were increased in menadione-treated cells. We conclude that MRP plays a vital role in protecting BAECs against menadione-induced oxidative stress, presumably due to its ability to transport glutathione S-conjugate.

  19. 75 FR 52779 - Notice of Information Collection

    Science.gov (United States)

    2010-08-27

    ... and aerospace-related science, technology, engineering, and mathematics (STEM) workforce. NASA intends... Public: Business Individuals or households. Estimated Number of Respondents: 15,571 (15,251 survey; 320...

  20. 49 CFR 509.2 - Display.

    Science.gov (United States)

    2010-10-01

    ...-0039 Part 566 2127-0043 Consolidated owners' manual requirements for vehicles and equipment (§§ 571.126... Theft Prevention Standard and Labeling Requirements (parts 541, 565, 567 and § 571.115) 2127-0510...

  1. Oral cavity evaluation and dental chart registration of coati (Nasua nasua) in captivity.

    Science.gov (United States)

    Freitas, Elisângela P; Rahal, Sheila C; Teixeira, Carlos R; Teixeira, Rodrigo H F; Mendes, Guilherme M; Gioso, Marco A

    2008-06-01

    The aims of this study were to develop a dental evaluate any oral cavity disease, develop gypsum models of the dental arches, and to register the occlusions found in coatis (Nasua nasua) in captivity Formulation of the dental chart was assisted by intraoral radiographs from the head of an adult coati cadaver of the same species with the following dental formula.: I 3/3, C 1/1, P 4/3, M 2/2. Seven live coatis of the Nasua nasua species were evaluated. Five of the seven coatis presented with various dental abnormalities as follows: dental plaque (71.4 0%), gingivitis (71.4 %), periodontitis (57.1 %), dental stain (42.9 %), dental abrasion (57.1 %), dental fracture (57.1 %), pulp exposure (42.9 %), malocclusion (57.1 %) and supernumerary teeth (14.2 %).

  2. 49 CFR 571.101 - Standard No. 101; Controls and displays.

    Science.gov (United States)

    2010-10-01

    ... accessibility, visibility and recognition of motor vehicle controls, telltales and indicators, and to facilitate.... Identifier means a symbol, word, or words used to identify a control, telltale, or indicator. Multi-function... listed in column 1 of Table 1 or Table 2 must be identified by the symbol specified for it in column 2 or...

  3. Pharmacotherapy for the treatment of aggression in pediatric and adolescent patients with autism spectrum disorder comorbid with attention-deficit hyperactivity disorder: A questionnaire survey of 571 psychiatrists.

    Science.gov (United States)

    Yamamuro, Kazuhiko; Tsujii, Noa; Ota, Toyosaku; Kishimoto, Toshifumi; Iida, Junzo

    2017-08-01

    Both attention-deficit hyperactivity disorder (ADHD) and autism spectrum disorder (ASD) are frequently accompanied by serious aggression that requires psychiatric treatment. However, little is known about the experiences psychiatrists have had using pharmacotherapy to treat aggression in patients who have both ASD and ADHD (ASD/ADHD). The purpose of this study was to examine the experiences of Japanese child and adolescent psychiatrists in prescribing medication for aggression in patients with ASD/ADHD. A prospective questionnaire was mailed to 2001 psychiatrists affiliated with the Japanese Society for Child and Adolescent Psychiatry. Multivariate logistic regression analysis was used to identify factors predicting the outcome of pharmacotherapeutic treatment of aggression in pediatric and adolescent patients with ASD/ADHD. Of 2001 psychiatrists, 571 (28.5%) completed the full questionnaire (final sample). Of these, 488 (85.4%) prescribed psychotropic medication in treating pediatric and adolescent patients with ASD/ADHD, 299 (61.3%) of them doing so to treat aggression. Prescribers' duration of practice (odds ratio, 1.055; P = 0.038) and patient symptoms of residual impulsivity (odds ratio, 2.479; P = 0.039) increased the odds of prescribing psychotropic medications to treat aggression in these patients. The respondents reported a similar effect for patients with ADHD/ASD compared with those with ADHD only in treating aggression. Japanese psychiatrists tended to prescribe psychotropic medication for aggression in pediatric and adolescent patients with ASD/ADHD. Future studies examining aggression in pediatric and adolescent patients with ASD/ADHD should aim to accumulate evidence for the use of psychotropic medications, which could help clinicians make better decisions. © 2017 The Authors. Psychiatry and Clinical Neurosciences © 2017 Japanese Society of Psychiatry and Neurology.

  4. 78 FR 72064 - Request for Comments on Methods for Studying the Diversity of Patent Applicants

    Science.gov (United States)

    2013-12-02

    ..., Expert Advisor, Office of Chief Economist, United States Patent and Trademark Office, Mail Stop External..., Office of Chief Economist, by telephone at (571) 272-6900, or by email at [email protected

  5. Minimal differences in prevalence and spectrum of organic disease at upper gastrointestinal endoscopy between selected secondary care patients with symptoms of gastro-oesophageal reflux or dyspepsia.

    Science.gov (United States)

    Irvine, Andrew J; Pinto-Sanchez, Maria Ines; Bercik, Premysl; Moayyedi, Paul; Ford, Alexander C

    2017-04-01

    Gastro-oesophageal reflux and dyspepsia are felt to be separate upper gastrointestinal (GI) conditions. We aimed to measure the degree of overlap between them, and assess whether endoscopic findings differed. Demographic, symptom, upper GI endoscopy and histology data were collected from consecutive adults in secondary care. Patients were categorised according to whether they reported gastro-oesophageal reflux alone, dyspepsia alone or both, and patient demographics and endoscopic findings were compared. Of 1167 patients, 97 (8.3%) had gastro-oesophageal reflux alone, 571 (48.9%) dyspepsia alone, and 499 (42.8%) overlap. Patients with overlap symptoms were more likely to smoke, compared with those with gastro-oesophageal reflux alone, or dyspepsia alone (p = .009), but there were no other differences. Patients with gastro-oesophageal reflux alone or overlap had a higher prevalence of erosive oesophagitis (18.6% and 15.4% respectively, p Gastro-oesophageal reflux and dyspepsia symptoms commonly overlap. There were minimal differences in demographics or spectrum of underlying organic disease between various symptom groups, suggesting that restrictive classifications according to predominant symptom may not be clinically useful.

  6. 75 FR 1830 - Final Regulatory Guide: Issuance, Availability

    Science.gov (United States)

    2010-01-13

    ... (RG) 5.71, ``Cyber Security Programs for Nuclear Facilities.'' FOR FURTHER INFORMATION CONTACT: Karl J... review of applications for permits and licenses. RG 5.71, ``Cyber Security Programs for Nuclear... Nuclear Regulatory Research concerning cyber security program development and the collective body of...

  7. 49 CFR 571.204 - Standard No. 204; Steering control rearward displacement.

    Science.gov (United States)

    2010-10-01

    ... September 1, 1991. When a passenger car or a truck, bus, or multipurpose passenger vehicle with a gross... manufactured on or after September 1, 1991. When a passenger car or a truck, bus or multipurpose passenger... the steering control into the passenger compartment to reduce the likelihood of chest, neck, or head...

  8. 49 CFR 571.224 - Standard No. 224; Rear impact protection.

    Science.gov (United States)

    2010-10-01

    ... supporting frame structure of a motor vehicle. Horizontal member means the structural member of the guard... vehicle's cargo doors, tailgate, or other permanent structures are positioned as they normally are when... equipment that, while the vehicle is in transit, resides in or moves through any portion of the space...

  9. 49 CFR 571.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ...) Other definitions. As used in this chapter— Act means the National Traffic and Motor Vehicle Safety Act... means the nominal design dimension of the widest part of the vehicle, exclusive of signal lamps, marker... Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION...

  10. 28 CFR 571.41 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... United States, the U.S. Pardon Attorney will forward the original of the signed and sealed warrant of... Director, Bureau of Prisons. The Warden shall deliver the original warrant to the affected inmate, and obtain a signed receipt for return to the U.S. Pardon Attorney. The Warden shall take such action as is...

  11. 49 CFR 571.121 - Standard No. 121; Air brake systems.

    Science.gov (United States)

    2010-10-01

    ... off-road harvesting sites and to a processing plant or storage location, as evidenced by skeletal... and transfer of goods by, or between various modes of transport, such as highway, rail, sea and air... supply line coupling. S5.6.6Accumulation of actuation energy. Each parking brake system shall meet the...

  12. 49 CFR 571.111 - Standard No. 111; Rearview mirrors.

    Science.gov (United States)

    2010-10-01

    ... angle to provide a view of a level road surface extending to the horizon beginning at a point not... driver a view of a level road surface extending to the horizon from a line, perpendicular to a... event of electrical failure, or achieve such reflectance level automatically in the event of electrical...

  13. Switching to Aflibercept in Diabetic Macular Edema Not Responding to Ranibizumab and/or Intravitreal Dexamethasone Implant

    Directory of Open Access Journals (Sweden)

    Antoine Herbaut

    2017-01-01

    Full Text Available Purpose. To assess short-term functional and anatomical outcomes of refractory diabetic macular edema (DME following a switch from ranibizumab or dexamethasone to aflibercept. Methods. We included retrospectively eyes with persistent DME after at least 3 ranibizumab and/or one dexamethasone implant intravitreal injections (IVI. The primary endpoint was the mean change in visual acuity (VA at month 6 (M6 after switching. Results. Twenty-five eyes were included. Before switching to aflibercept, 23 eyes received a median of 9.5 ranibizumab, and among them, 6 eyes received one dexamethasone implant after ranibizumab and 2 eyes received only one dexamethasone implant. Baseline VA, before any IVI, was 52.9 ± 16.5 letters, and preswitch VA was 57.1 ± 19.6 letters. The mean VA gain was +8 letters (p=0.01 between preswitch and M6. The mean central retinal thickness was 470.8 ± 129.9 μm before the switch and 303.3 ± 59.1 μm at M6 (p=0.001. Conclusion. Switching to aflibercept in refractory DME results in significant functional and anatomical improvement. The study was approved by the France Macula Federation ethical committee (FMF 2017-138.

  14. Cross-cultural examination of the five-factor model of drinking motives in Spanish and Canadian undergraduates

    NARCIS (Netherlands)

    Mezquita, L.; Stewart, S.H.; Kuntsche, E.N.; Grant, V.V.

    2016-01-01

    This study aims to test the cross-cultural suitability of Modified Drinking Motives Questionnaire-Revised (M DMQ-R) (Grant, Stewart, O'Connor, Blackwell, & Conrod, 2007). The sample included 571 Spanish and 571 Canadian undergraduates between the ages of 18 and 22 (65.8% women). The confirmatory

  15. 49 CFR 585.34 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... their statutory meaning. (b) Bus, gross vehicle weight rating or GVWR, multipurpose passenger vehicle, passenger car, and truck are used as defined in § 571.3 of this chapter. (c) Production year means the 12...

  16. Fasitibant chloride, a kinin B2 receptor antagonist, and dexamethasone interact to inhibit carrageenan-induced inflammatory arthritis in rats

    Science.gov (United States)

    Valenti, Claudio; Giuliani, Sandro; Cialdai, Cecilia; Tramontana, Manuela; Maggi, Carlo Alberto

    2012-01-01

    BACKGROUND AND PURPOSE Bradykinin, through the kinin B2 receptor, is involved in inflammatory processes related to arthropathies. B2 receptor antagonists inhibited carrageenan-induced arthritis in rats in synergy with anti-inflammatory steroids. The mechanism(s) underlying this drug interaction was investigated. EXPERIMENTAL APPROACH Drugs inhibiting inflammatory mediators released by carrageenan were injected, alone or in combination, into the knee joint of pentobarbital anaesthetized rats 30 min before intra-articular administration of carrageenan. Their effects on the carrageenan-induced inflammatory responses (joint pain, oedema and neutrophil recruitment) and release of inflammatory mediators (prostaglandins, IL-1β, IL-6 and the chemokine GRO/CINC-1), were assessed after 6 h. KEY RESULTS The combination of fasitibant chloride (MEN16132) and dexamethasone was more effective than each drug administered alone in inhibiting knee joint inflammation and release of inflammatory mediators. Fasitibant chloride, MK571, atenolol, des-Arg9-[Leu8]-bradykinin (B2 receptor, leukotriene, catecholamine and B1 receptor antagonists, respectively) and dexketoprofen (COX inhibitor), reduced joint pain and, except for the latter, also diminished joint oedema. A combination of drugs inhibiting joint pain (fasitibant chloride, des-Arg9-[Leu8]-bradykinin, dexketoprofen, MK571 and atenolol) and oedema (fasitibant chloride, des-Arg9-[Leu8]-bradykinin, MK571 and atenolol) abolished the respective inflammatory response, producing inhibition comparable with that achieved with the combination of fasitibant chloride and dexamethasone. MK571 alone was able to block neutrophil recruitment. CONCLUSIONS AND IMPLICATIONS Bradykinin-mediated inflammatory responses to intra-articular carrageenan were not controlled by steroids, which were not capable of preventing bradykinin effects either by direct activation of the B2 receptor, or through the indirect effects mediated by release of eicosanoids

  17. 77 FR 67655 - Agency Information Collection Activities; Proposed Collection; Comment Request; Food Additive...

    Science.gov (United States)

    2012-11-13

    ... collection of information. Sec. 571.1(c) Moderate Category: For a food additive petition without complex... burden of 3,000 hours. Sec. 571.1(c) Complex Category: For a food additive petition with complex.... Sec. 570.17 Moderate Category: For an investigational food additive file without complex chemistry...

  18. 77 FR 54836 - Federal Motor Vehicle Safety Standards

    Science.gov (United States)

    2012-09-06

    ... DEPARTMENT OF TRANSPORTATION National Highway Traffic Safety Administration 49 CFR Part 571 Federal Motor Vehicle Safety Standards CFR Correction 0 In Title 49 of the Code of Federal Regulations... read as follows: Sec. 571.119 Standard No. 119; New pneumatic tires for motor vehicles with a GVWR of...

  19. 75 FR 2867 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

    Science.gov (United States)

    2010-01-19

    ... costs associated with this collection of information. 571.1(c) moderate category: For food additive... an annual basis, resulting in a burden of 3,000 hours. 571.1(c) complex category: For a food additive... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2009-N-0465...

  20. 76 FR 65061 - Manual for Courts-Martial; Proposed Evidence Amendments

    Science.gov (United States)

    2011-10-19

    ... the evidence, with the false information set aside, that the remaining information presented to the..., including any personal identifiers or contact information. FOR FURTHER INFORMATION CONTACT: Lieutenant...-2200, (571) 256-8136, e-mail [email protected] . SUPPLEMENTARY INFORMATION: The proposed...

  1. Psittacine birds (Aves : Psittaciformes) as new hosts of Baruscapillaria obsignata (Nematoda : Capillariidae)

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil

    2005-01-01

    Roč. 74, č. 4 (2005), s. 571-574 ISSN 0001-7213 R&D Projects: GA ČR(CZ) GA524/03/0061 Institutional research plan: CEZ:AV0Z60930519 Keywords : Psittacine birds * capillariids * Czech Republic Subject RIV: EG - Zoology Impact factor: 0.353, year: 2005 http://vfu-www.vfu.cz/acta-vet/vol74/74-571.pdf

  2. Effects of partial crystallinity and quenched-in defects on corrosion of ...

    Indian Academy of Sciences (India)

    Rapid solidification by planar flow casting has been found to have introduced deficiencies, viz. partial crystallinity, air pockets and compositional difference in the ribbons of rapidly solidified Ti42.9-Cu57.1 alloy. In order to investigate the effects of these deficiencies on the corrosion of rapidly solidified Ti42.9-Cu57.1 alloy ...

  3. Occurrence of multiple mental health or substance use outcomes among bisexuals: a respondent-driven sampling study

    Directory of Open Access Journals (Sweden)

    Greta R. Bauer

    2016-06-01

    Full Text Available Abstract Background Bisexual populations have higher prevalence of depression, anxiety, suicidality and substance use than heterosexuals, and often than gay men or lesbians. The co-occurrence of multiple outcomes has rarely been studied. Methods Data were collected from 405 bisexuals using respondent-driven sampling. Weighted analyses were conducted for 387 with outcome data. Multiple outcomes were defined as 3 or more of: depression, anxiety, suicide ideation, problematic alcohol use, or polysubstance use. Results Among bisexuals, 19.0 % had multiple outcomes. We did not find variation in raw frequency of multiple outcomes across sociodemographic variables (e.g. gender, age. After adjustment, gender and sexual orientation identity were associated, with transgender women and those identifying as bisexual only more likely to have multiple outcomes. Social equity factors had a strong impact in both crude and adjusted analysis: controlling for other factors, high mental health/substance use burden was associated with greater discrimination (prevalence risk ratio (PRR = 5.71; 95 % CI: 2.08, 15.63 and lower education (PRR = 2.41; 95 % CI: 1.06, 5.49, while higher income-to-needs ratio was protective (PRR = 0.44; 0.20, 1.00. Conclusions Mental health and substance use outcomes with high prevalence among bisexuals frequently co-occurred. We find some support for the theory that these multiple outcomes represent a syndemic, defined as co-occurring and mutually reinforcing adverse outcomes driven by social inequity.

  4. 34 CFR 5.71 - Protection of personal privacy and proprietary information.

    Science.gov (United States)

    2010-07-01

    ... other information of a private and personal nature. (b) Information having a commercial or financial... individuals who have access to such information, (3) the type and degree of risk of financial injury to be... use of nondiscloseable records or information from such records for authorized program purposes...

  5. Infections Increase Risk of Arterial and Venous Thromboses in Danish Patients with Systemic Lupus Erythematosus

    DEFF Research Database (Denmark)

    Baronaite Hansen, Renata; Jacobsen, Søren

    2014-01-01

    OBJECTIVE: Infections and thromboses are known complications of systemic lupus erythematosus (SLE). We investigated if infectious episodes in patients with SLE were followed by an increased risk of thrombotic events. METHODS: A cohort of 571 patients with prevalent or incident SLE was followed...

  6. 49 CFR 571.116 - Standard No. 116; Motor vehicle brake fluids.

    Science.gov (United States)

    2010-10-01

    ... stock or natural rubber (NR). Chipping means a condition in which small pieces are missing from the... average decrease in hardness of seven of the eight cups tested (six wheel cylinder and one master cylinder... short piece of natural rubber, EPDM, SBR, or butyl tubing. (c) Place 60 ±1 ml. of brake fluid and the...

  7. 49 CFR 571.401 - Standard No. 401; Interior trunk release.

    Science.gov (United States)

    2010-10-01

    .... Requirements. S4.1 Each passenger car with a trunk compartment must have an automatic or manual release... possible for a person trapped inside the trunk compartment of a passenger car to escape from the compartment. S2. Application. This standard applies to passenger cars that have a trunk compartment. This...

  8. 49 CFR 571.301 - Standard No. 301; Fuel system integrity.

    Science.gov (United States)

    2010-10-01

    .... Fuel spillage means the fall, flow, or run of fuel from the vehicle but does not include wetness... driven fuel pump that normally runs when the vehicle's electrical system is activated, it is operating at... equipped with P205/75R15 pneumatic tires inflated to 200 kPa ±21 kPa. S8Phase-In schedule. S8.1Rear impact...

  9. Scan Manifestations and Blood Clearance Rates in Typhoid Liver

    International Nuclear Information System (INIS)

    Bahk, Yong Whee; Ahn, Jae Sung; Kim, Soon Hi

    1970-01-01

    Fourteen patients with typhoid fever studied by scanning and clearance-rate measurements of subcritical dose colloidal radiogold ( 198 Au). Mild to moderate enlargement of the liver and spleen was noted in 78.6 and 64.3 percent of patients, respectively; and splenic and spinal bone-marrow uptake was seen in 78.6 and 57.1 percent of cases, respectively. Typically, these scan changes occurred concomitantly (57.1%) and are considered to represent increased phagocytic activity of the RE cells which is characteristic of typhoid fever. The half clearance-time was significantly shortened during the first 10-day period of the illness indicating an increase in the hepatic blood in the early phase of typhoid infection. Hepatomegaly, splenomegaly and extrahepatic uptakes along with an accelerated (or less a normal) clearance time are characteristic of typhoid fever.

  10. CT of the infants and children with mental and/or physical handicaps

    International Nuclear Information System (INIS)

    Okada, Junichiro; Takeuchi, Kazuo

    1980-01-01

    Computed tomography (CT) was performed on 47 children and adolescents with mental and/or physical handicaps. Of these series, 22 cases of morphological change were noted. Another 25 cases showed no overt CT abnormality. These 47 cases were divided into three groups in the following manner. Group 1, with no CT abnormality; Group 2, with ventricular dilatation and/or cerebral atrophy, and Group 3, with a major morphological anomaly of the brain. Group 1 (25 cases) showed a marked dissociation between the CT findings and the IQ. EEG showed normal findings in two cases, diffuse abnormality in 5 cases, and focal abnormality in 9 cases. This group alone included 8 cases of athetosis. Group 2 (14 cases). Seven cases of EEG showed diffuse abnormality in 3 cases and focal abnormality in 4 cases. So-called cerebral palsy was noted in 11 cases. Group 3 (8 cases). This group included cases of hemihydranencephaly, porencephaly, agenesis of the corpus callosum, and arachnoid cyst. The mean and standard deviations of the IQ's in the groups are 57.1 +- 21.6, 65.2 +- 20.5, and 72.0 +- 8.0. That is, an inverted correlation between the CT abnormality and the IQ was noted. CT is a noninvasive study and a reasonable method of investigation for mentally handicapped children. DeMyer gave three categories of cerebral malformation: cytogenetic malformations, organogenetic disorders, and histogenetic disorders. On the other hand, EEG aimed at evaluating cerebral function and CT undertaken for morphological evaluation reveal no intimate correlation with one another. Rather, these two procedures each have their one value for the evaluation of the function and the structure of the brain. Mentally and/or physically handicapped patients without any overt cerebral anomaly have been found to be as follows: Murobushi, 12.29%; Malamud, 34%; Gross, 15.8%; Benda, 15%, and Hamada, 45.4%. (author)

  11. Publications | Page 571 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 5701 - 5710 of 6371 ... Opportunities and challenges of ICT for youth development in Ghana : policy and programme implications (restricted access) · Diarrhea and women's practices for handling water in the town of Bebnine, Lebanon (restricted access) · Smoking, poverty, ill-health and health care utilization in China ...

  12. PRODUTIVIDADE DE CULTIVARES DE UVAS PARA SUCO SOBRE DIFERENTES PORTA-ENXERTOS IAC EM MOCOCA-SP YIELD OF JUICE GRAPE CULTIVARS GRAFTED ON SOME IAC ROOTSTOCKS

    Directory of Open Access Journals (Sweden)

    MAURILO MONTEIRO TERRA

    2001-08-01

    Full Text Available Estimou-se o potencial de produção de uvas das cultivares copa Concord, Isabel e Seibel 2, recomendadas para produção de suco, enxertadas sobre os porta-enxertos IAC 313 'Tropical', 'IAC 571-6', IAC 572 'Jales', e IAC 766 'Campinas', num experimento conduzido, durante seis anos, na Estação Experimental de Mococa (21º28'S, 47º01'W do Instituto Agronômico de Campinas. Para a variedade Concord, as maiores produções médias foram obtidas quando se utilizaram os porta-enxertos 'IAC 313', 'IAC 571-6' e 'IAC 572', totalizando 3,86kg/planta, 3,81kg/planta e 3,65kg/planta, respectivamente; para 'Isabel', quando se empregaram os porta-enxertos 'IAC 572', 'IAC 571-6' e 'IAC 313', somando 3,85kg/planta, 3,63kg/planta e 3,26kg/planta; para o cv. Seibel 2, quando se fez uso dos porta-enxertos 'IAC 313', 'IAC 572' e 'IAC 571-6', auferiram-se 2,61kg/planta, 2,40kg/planta e 2,10kg/planta; por outro lado, para as três variedades, o porta-enxerto de pior performance foi o 'IAC 766'. Quanto ao vigor, representado pela massa dos ramos podados ao longo dos anos, os melhores porta-enxertos para 'Concord' foram 'IAC 572' e 'IAC 313'; para 'Isabel': 'IAC 766' e 'IAC 313'; e para 'Seibel 2': 'IAC 766' e 'IAC 572'.The yield potential of juice grape cultivars, namely Concord, Isabel and Seibel 2, grafted on 'IAC 313', 'IAC 571-6', 'IAC 572' and 'IAC 766' rootstocks was studied in an experiment conducted for six years at Mococa Experimental Station (21º28'S, 47º01'W. Regarding Concord cultivar, the greatest mean yields were achieved when grafted on 'IAC 313', 'IAC 571-6' and 'IAC 572'rootstocks, respectively 3.86kg/plant, 3.81 kg/plant and 3.65 kg/plant. 'Isabel' gave the largest grape productions when grafted on 'IAC 572' (3.85kg/plant, 'IAC 571-6' (3.63kg/plant and 'IAC 313' (3.26kg/plant. The best grape yields of 'Seibel-2' were obtained when it was grafted on 'IAC 313', 'IAC 572' and 'IAC 571-6', being respectively 2.61kg/plant, 2.40 kg/plant and 2.10 kg

  13. Stent type used does not impact complication rate or placement time but can decrease treatment cost for benign and malignant esophageal lesions

    Institute of Scientific and Technical Information of China (English)

    Camille; McGaw[1; Ahmad; Alkaddour[2; Kenneth; J; Vega[3; Juan; Carlos; Munoz[1

    2016-01-01

    AIM: To evaluate if differences exist between selfexpanding esophageal metal stents (SEMS) and selfexpanding esophageal plastic stents (SEPS) when used for benign or malignant esophageal disorders with regard to safety, efficacy, clinical outcomes, placement ease and cost.METHODS: A retrospective analysis was performed to evaluate outcome in patients having SEPS/SEMS placed for malignant or benign esophageal conditions from January 2005 to April 2012. Inclusion criteria was completed SEMS/SEPS placement. Outcomes assessed included technical success of and time required for stent placement, procedure-related complications, need for repeat intervention, hospital stay, mortality and costs.RESULTS: Forty-three patients underwent stent placement for either benign/malignant esophageal disease during the study period. Thirty patients had SEMS (25 male, mean age 59.6 years old) and 13 patients had SEPS (10 male, mean age 61.7 years old). Placement outcome as well as complication rate (SEPS 23.1%, SEMS 25.2%) and in-hospital mortality (SEPS 7.7%, SEMS 6.7%) after placement did not differ between stent types. Migration was the most frequent complication reported occurring equally between types (SEPS 66.7%, SEMS 57.1%). SEPS was less costly than SEMS, decreasing institutional cost by $255/stent. CONCLUSION: SEPS and SEMS have similar outcomes when used for benign or malignant esophageal conditions. However, SEPS use results in decreased costs without impacting care.

  14. Stent type used does not impact complication rate or placement time but can decrease treatment cost for benign and malignant esophageal lesions

    Institute of Scientific and Technical Information of China (English)

    Camille McGaw; Ahmad Alkaddour; Kenneth J Vega; Juan Carlos Munoz

    2016-01-01

    AIM: To evaluate if differences exist between selfexpanding esophageal metal stents(SEMS) and selfexpanding esophageal plastic stents(SEPS) when used for benign or malignant esophageal disorders with regard to safety, efficacy, clinical outcomes, placement ease and cost.METHODS: A retrospective analysis was performed to evaluate outcome in patients having SEPS/SEMS placed for malignant or benign esophageal conditions from January 2005 to April 2012. Inclusion criteria was completed SEMS/SEPS placement. Outcomes assessed included technical success of and time required for stent placement, procedure-related complications, need for repeat intervention, hospital stay, mortality and costs.RESULTS: Forty-three patients underwent stent placement for either benign/malignant esophagealdisease during the study period. Thirty patients had SEMS(25 male, mean age 59.6 years old) and 13 patients had SEPS(10 male, mean age 61.7 years old). Placement outcome as well as complication rate(SEPS 23.1%, SEMS 25.2%) and in-hospital mortality(SEPS 7.7%, SEMS 6.7%) after placement did not differ between stent types. Migration was the most frequent complication reported occurring equally between types(SEPS 66.7%, SEMS 57.1%). SEPS was less costly than SEMS, decreasing institutional cost by $255/stent.CONCLUSION: SEPS and SEMS have similar outcomes when used for benign or malignant esophageal conditions. However, SEPS use results in decreased costs without impacting care.

  15. Scan Manifestations and Blood Clearance Rates in Typhoid Liver

    Energy Technology Data Exchange (ETDEWEB)

    Bahk, Yong Whee; Ahn, Jae Sung; Kim, Soon Hi [St. Mary' s Hospital, Catholic Medical College, Seoul (Korea, Republic of)

    1970-09-15

    Fourteen patients with typhoid fever studied by scanning and clearance-rate measurements of subcritical dose colloidal radiogold ({sup 198}Au). Mild to moderate enlargement of the liver and spleen was noted in 78.6 and 64.3 percent of patients, respectively; and splenic and spinal bone-marrow uptake was seen in 78.6 and 57.1 percent of cases, respectively. Typically, these scan changes occurred concomitantly (57.1%) and are considered to represent increased phagocytic activity of the RE cells which is characteristic of typhoid fever. The half clearance-time was significantly shortened during the first 10-day period of the illness indicating an increase in the hepatic blood in the early phase of typhoid infection. Hepatomegaly, splenomegaly and extrahepatic uptakes along with an accelerated (or less a normal) clearance time are characteristic of typhoid fever.

  16.  Risk of discontinuation of nevirapine due to toxicities in antiretroviral naive and experienced HIV-infected patients with high and low CD4 counts

    DEFF Research Database (Denmark)

    Mocroft, A; Staszewski, S; Weber, R

    2007-01-01

    AND METHODS: 1,571 EuroSIDA patients started NVPc after 1/1/1999, with CD4+ T-cell counts and viral load measured in the 6 months before starting treatment, and were stratified into four groups based on CD4+ T-cell counts at initiation of NVPc (high [H], > 400/mm3 or > 250/mm3 for male or female, respectively...

  17. 76 FR 571 - National Institute of Nursing Research; Notice of Meeting

    Science.gov (United States)

    2011-01-05

    ... Research. The meeting will be open to the public as indicated below, with attendance limited to space... disclose confidential trade secrets or commercial property such as patentable material, and personal...: Discussion of Program Policies and Issues. Place: National Institutes of Health, Building 31, 31 Center Drive...

  18. 49 CFR 571.123 - Standard No. 123; Motorcycle controls and displays.

    Science.gov (United States)

    2010-10-01

    ... handgrip. If a motorcycle with an automatic clutch other than a scooter is equipped with a supplemental rear brake control, the control shall be located on the left handlebar. If a scooter with an automatic... equipped with self-proportioning or antilock braking devices utilizing a single control for front and rear...

  19. Whole Genome Amplification of Day 3 or Day 5 Human Embryos Biopsies Provides a Suitable DNA Template for PCR-Based Techniques for Genotyping, a Complement of Preimplantation Genetic Testing

    Directory of Open Access Journals (Sweden)

    Elizabeth Schaeffer

    2017-01-01

    Full Text Available Our objective was to determine if whole genome amplification (WGA provides suitable DNA for qPCR-based genotyping for human embryos. Single blastomeres (Day 3 or trophoblastic cells (Day 5 were isolated from 342 embryos for WGA. Comparative Genomic Hybridization determined embryo sex as well as Trisomy 18 or Trisomy 21. To determine the embryo’s sex, qPCR melting curve analysis for SRY and DYS14 was used. Logistic regression indicated a 4.4%, 57.1%, or 98.8% probability of a male embryo when neither gene, SRY only, or both genes were detected, respectively (accuracy = 94.1%, kappa = 0.882, and p<0.001. Fluorescent Capillary Electrophoresis for the amelogenin genes (AMEL was also used to determine sex. AMELY peak’s height was higher and this peak’s presence was highly predictive of male embryos (AUC = 0.93, accuracy = 81.7%, kappa = 0.974, and p<0.001. Trisomy 18 and Trisomy 21 were determined using the threshold cycle difference for RPL17 and TTC3, respectively, which were significantly lower in the corresponding embryos. The Ct difference for TTC3 specifically determined Trisomy 21 (AUC = 0.89 and RPL17 for Trisomy 18 (AUC = 0.94. Here, WGA provides adequate DNA for PCR-based techniques for preimplantation genotyping.

  20. Radio and x-ray observations of compact sources in or near supernova remnants

    International Nuclear Information System (INIS)

    Seaquist, E.R.; Gilmore, W.S.

    1982-01-01

    We present VLA multifrequency radio observations of six compact radio sources from the list of nine objects proposed by Ryle et al. [Nature 276, 571 (1978)] as a new class of radio star, possibly the stellar remnants of supernovae. We also present the results of a search for x-ray emission from four of these objects with the Einstein observatory. The radio observations provide information on spectra, polarization, time variability, angular structure, and positions for these sources. The bearing of these new data on the nature of the sources is discussed. One particularly interesting result is that the polarization and angular-size measurements are combined in an astrophysical argument to conclude that one of the sources (2013+370) is extragalactic. No x-ray emission was detected from any of the four objects observed, but an extended x-ray source was found coincident with the supernova remnant G 33.6+0.1 near 1849+005. Our measurements provide no compelling arguments to consider any of the six objects studied as radio stars

  1. 49 CFR 571.210 - Standard No. 210; Seat belt assembly anchorages.

    Science.gov (United States)

    2010-10-01

    ... bolt holes or the centroid of any other means of attachment to the structure specified in 4.1.3.1... are either: (a) For designated seating positions that are common to the same occupant seat and that... common to the same occupant seat, but that face in the same direction, if the vertical centerline of the...

  2. Optimal Structures for Multimedia Instruction.

    Science.gov (United States)

    1984-01-27

    Adair 73] and [Carroll 80] studying the semiotic system of film, and (Barthes 571 studying cultural systems, such as the meaning of steak in French ... cuisine . 3.2.1 Saussure and Peirce Most work in semiotics derives from either Saussure or Peirce. A major difference in their approach [Eco 79] is that

  3. Communication between Thiamin Cofactors in the Escherichia coli Pyruvate Dehydrogenase Complex E1 Component Active Centers EVIDENCE FOR A DIRECT PATHWAY BETWEEN THE 4′-AMINOPYRIMIDINE N1′ ATOMS

    Energy Technology Data Exchange (ETDEWEB)

    Nemeria, Natalia S; Arjunan, Palaniappa; Chandrasekhar, Krishnamoorthy; Mossad, Madouna; Tittmann, Kai; Furey, William; Jordan, Frank [Pitt; (Goettingen); (VA); (Rutgers)

    2010-11-03

    Kinetic, spectroscopic, and structural analysis tested the hypothesis that a chain of residues connecting the 4{prime}-aminopyrimidine N1{prime} atoms of thiamin diphosphates (ThDPs) in the two active centers of the Escherichia coli pyruvate dehydrogenase complex E1 component provides a signal transduction pathway. Substitution of the three acidic residues (Glu{sup 571}, Glu{sup 235}, and Glu{sup 237}) and Arg{sup 606} resulted in impaired binding of the second ThDP, once the first active center was filled, suggesting a pathway for communication between the two ThDPs. (1) Steady-state kinetic and fluorescence quenching studies revealed that upon E571A, E235A, E237A, and R606A substitutions, ThDP binding in the second active center was affected. (2) Analysis of the kinetics of thiazolium C2 hydrogen/deuterium exchange of enzyme-bound ThDP suggests half-of-the-sites reactivity for the E1 component, with fast (activated site) and slow exchanging sites (dormant site). The E235A and E571A variants gave no evidence for the slow exchanging site, indicating that only one of two active sites is filled with ThDP. (3) Titration of the E235A and E237A variants with methyl acetylphosphonate monitored by circular dichroism suggested that only half of the active sites were filled with a covalent predecarboxylation intermediate analog. (4) Crystal structures of E235A and E571A in complex with ThDP revealed the structural basis for the spectroscopic and kinetic observations and showed that either substitution affects cofactor binding, despite the fact that Glu{sup 235} makes no direct contact with the cofactor. The role of the conserved Glu{sup 571} residue in both catalysis and cofactor orientation is revealed by the combined results for the first time.

  4. [Prevalence of inapropriate LDL cholesterol levels in patients with coronary disease and/or type 2 diabetes].

    Science.gov (United States)

    Pérez de Isla, L; Saltijeral Cerezo, A; Vitale, G; González Timón, B; Torres Do Rego, A; Alvarez-Sala Walther, L A

    2012-11-01

    Clinical practice guidelines recommend achieving concentrations of LDL cholesterol less than 100 mg/dl (and in some cases less than 70 mg/dl) in patients with coronary artery disease and/or diabetes mellitus type 2 (DM2). We have examined the compliance with these objectives in patients treated in Spain with these conditions. Cross-sectional epidemiological study. Data were obtained during the visit of the study or, in their absence, based on data contained in the medical record by 874 doctors of the 17 autonomous communities in Spain. Demographic information, risk factors, cardiovascular and prescribed treatments were collected. In the final analysis 6.988 (62.7% male) patients were included. 2586 (37%) had coronary disease, 2654 (38%) DM2 and 1748 (25%) both conditions. 65% had metabolic syndrome. Vascular risk factors median number was 4. 57% and 86% showed a concentration of LDL cholesterol >100 and >70 mg/dl respectively. The proportion patients with LDL concentration >100 mg/dl was 4% greater in the DM2 (62.4%) than in coronary patients (57.1%; p0.0001). Concentration of triglycerides >150 mg/dl was higher in patients with DM2 (50.5%) than in coronary patients (43.5%; p0.0001). The proportion of patients with LDL>70 mg/dl was similar in the coronary group and in the DM2 Group (88.4% and 87.0%, respectively). More than half of patients with coronary heart disease (57.5%) or DM2 (55.7%) showed inadequate levels of HDL (women). More than a half of patients with diabetes mellitus and/or coronary artery disease enrolled in the CODIMET study do not achieve the recommended LDL cholesterol target for high cardiovascular risk patients. Copyright © 2012 Elsevier España, S.L. All rights reserved.

  5. A malignant omental extra-gastrointestinal stromal tumor on a young man: a case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Almaroof Babatunde

    2008-05-01

    Full Text Available Abstract Background Gastrointestinal stromal tumors (GIST are uncommon intra-abdominal tumors. These tumors tend to present with higher frequency in the stomach and small bowel. In fewer than 5% of cases, they originate primarily from the mesentery, omentum, or peritoneum. Furthermore, these extra-gastrointestinal tumors (EGIST tend to be more common in patients greater than 50 years of age. Rarely do EGIST tumors present in those younger than 40 years of age. Case presentation We report a case of a large EGIST in a 27-year-old male. An abdominal pelvic computerized tomography imaging demonstrated an intra-abdominal mass of 22 cm, without invasion of adjacent viscera or liver lesions. This mass was resected en bloc with its fused omentum and an adherent portion of sigmoid colon. Pathology results demonstrated a malignant gastrointestinal stromal tumor with positive CD117 (c-kit staining, and negative margins of resection, and no continuity of tumor with the sigmoid colon. Due to the malignant and aggressive nature of this patient's tumor, he was started on STI-571 as adjuvant chemotherapy. Conclusion Stromal tumors of an extra-gastrointestinal origin are rare. Of the reported omental and mesenteric EGISTs in four published series, a total of 99 tumors were studied. Of the 99 patients in these series only 8 were under 40 years of age, none were younger than 30 years old; and only 5 were younger than 35 years old. Our patient's age is at the lower end of the age spectrum for the reported EGISTs. Young patients who present with an extra-gastrointestinal stromal tumor (EGIST, who have complete resection with negative margins, have a good prognosis. There is little data to support the role of STI-571 in adjuvant or neoadjuvant therapy after curative resection. Given the lack of data, the use of STI-571 must be individualized.

  6. The Role of Interest in Students' Writing Fluency and the Quality of the Product.

    Science.gov (United States)

    Lewis, Dorothy P.

    A study was conducted to examine the effects of students' interests on their writing. A group of 571 high school seniors, fluent and nonfluent in writing, completed a questionnaire dealing with aspects of writing interest, such as subject, form, or voice. Tape recorded interviews addressing the same aspects were conducted with 11 fluent seniors…

  7. Duplex-assisted carotid artery stenting without administration of contrast medium for patients with chronic kidney disease or allergic reaction.

    Science.gov (United States)

    Mizowaki, Takashi; Fujita, Atsushi; Imahori, Taichiro; Uyama, Atsushi; Inoue, Satoshi; Kohta, Masaaki; Hamaguchi, Hirotoshi; Sasayama, Takashi; Hosoda, Kohkichi; Kohmura, Eiji

    2016-07-01

    We aimed to investigate the safety and feasibility of duplex-assisted carotid artery stenting (CAS) without administration of contrast medium for the prevention of adverse reactions. Fifteen patients (9 % of all CASs) with severe carotid stenosis (≥70 %) associated with chronic kidney disease (CKD) (stage ≥3) or allergy to contrast medium underwent duplex-assisted CAS without administration of contrast medium over 4 years. The procedural success rate and perioperative complication rates were compared between the duplex-assisted CAS (n = 15) and conventional CAS (n = 153) groups. The technical success rate was 100 % in both groups. Combined stroke or death rates during the post-procedural period did not differ significantly between the duplex-assisted CAS group (0/15, 0 %) and conventional CAS group (4/153, 2.6 %). None of the 14 patients with CKD in the duplex-assisted CAS group experienced further deterioration of renal function. The mean surface radiation dose of participants in the duplex-assisted CAS group (n = 13, 312 ± 131 mGy) was significantly lower than that of the conventional CAS group (n = 31, 1036 ± 571 mGy) (p duplex-assisted CAS group (156 ± 39.7 min) and the conventional CAS group (156 ± 37.4 min). Duplex-assisted CAS without administration of contrast medium could be an alternative option in selected patients deemed to be at high risk for renal failure from nephrotoxic contrast medium or who have an allergy to contrast medium.

  8. Small intestinal efflux mediated by MRP2 and BCRP shifts sulfasalazine intestinal permeability from high to low, enabling its colonic targeting.

    Science.gov (United States)

    Dahan, Arik; Amidon, Gordon L

    2009-08-01

    Sulfasalazine is characterized by low intestinal absorption, which essentially enables its colonic targeting and therapeutic action. The mechanisms behind this low absorption have not yet been elucidated. The purpose of this study was to investigate the role of efflux transporters in the intestinal absorption of sulfasalazine as a potential mechanism for its low small-intestinal absorption and colonic targeting following oral administration. The effects of P-glycoprotein (P-gp), multidrug resistance-associated protein 2 (MRP2), and breast cancer resistance protein (BCRP) inhibitors on sulfasalazine bidirectional permeability were studied across Caco-2 cell monolayers, including dose-response analysis. Sulfasalazine in vivo permeability was then investigated in the rat jejunum by single-pass perfusion, in the presence vs. absence of inhibitors. Sulfasalazine exhibited 19-fold higher basolateral-to-apical (BL-AP) than apical-to-basolateral (AP-BL) Caco-2 permeability, indicative of net mucosal secretion. MRP2 inhibitors (MK-571 and indomethacin) and BCRP inhibitors [fumitremorgin C (FTC) and pantoprazole] significantly increased AP-BL and decreased BL-AP sulfasalazine Caco-2 transport in a concentration-dependent manner. No effect was observed with the P-gp inhibitors verapamil and quinidine. The IC50 values of the specific MRP2 and BCRP inhibitors MK-571 and FTC on sulfasalazine secretion were 21.5 and 2.0 microM, respectively. Simultaneous inhibition of MRP2 and BCRP completely abolished sulfasalazine Caco-2 efflux. Without inhibitors, sulfasalazine displayed low (vs. metoprolol) in vivo intestinal permeability in the rat model. MK-571 or FTC significantly increased sulfasalazine permeability, bringing it to the low-high permeability boundary. With both MK-571 and FTC present, sulfasalazine displayed high permeability. In conclusion, efflux transport mediated by MRP2 and BCRP, but not P-gp, shifts sulfasalazine permeability from high to low, thereby enabling its

  9. GAMBARAN SANITASI RUMAH SAKIT DI DKI JAKARTA

    Directory of Open Access Journals (Sweden)

    D. Anwar Musadad

    2012-09-01

    Full Text Available The objectives of this study is to get information on hospital sanitation. Tlie study was carried out in 7 Government Hospitals in Jakarta. The results show that 57.1% of the water samples did not meet the bacteriological standards and 4 hospitals (57.1% have mixed containers for medical and non medical wastes. Majority of the hospitals surveyed (85.7% disposed their infectious sewage to the septic tank, then released it into the river. Four hospitals (57.1% did not have sufficient washbasins. Bacteriological concentration in patient-care rooms were relatively high (2-49 colonies per 5 minutes collection. It can be concluded that the hospital sanitation is not in a good condition. It is suggested that the hospitals should improve their sewage treatment and add simple water supply treatment, washbasins and incinerators. It is also necessary to improve the ventilation and lighting system in the wards and undertake routine water quality control.

  10. 78 FR 75902 - Approval and Promulgation of Air Quality Implementation Plans; Pennsylvania; Philadelphia County...

    Science.gov (United States)

    2013-12-13

    ... to EPA. See NRDC v. EPA, 571 F.3d 1245 (D.C. Cir. 2009). Since the Philadelphia County 2006 SIP... Call constitutes RACT for EGU sources in Philadelphia County. Thus, AMS needs to perform a NO X RACT... 52.2020(d)(1)) continue to represent adequately RACT for the 1997 8-hour ozone NAAQS; or (2) perform...

  11. Diversity: Then Is Now. Commentary on Carter, J. R. (1978) Multicultural Graduate Library Education. (Journal of Education for Librarianship, 18(4), 295-314)

    Science.gov (United States)

    Roy, Lorienne

    2015-01-01

    Robbins Carter's portrait of the librarian workforce is still true. According to the latest American Library Association (ALA) demographics, the profile of today's librarian is that of a white (87.1 percent) woman (80.7 percent) of middle age (57.1 percent, age 45 or older) (ALA, 2013). Despite these data, support for increased diversity is…

  12. [Prevalence of hyperlipidemia and possible risk factors in rural Chinese adults: cohort study of health population in Yuhuan rural].

    Science.gov (United States)

    Su, Meifang; Fu, Chaowei; Li, Songtao; Ying, Xuhua; He, Na; Jiang, Qingwu

    2013-09-01

    To examine the prevalence of hyperlipidemia and its related factors in adults in rural Yuhuan, China. A cross-sectional study was carried out as a baseline study of Rural Yuhuan Health Population Cohort in all communities in Yuhuan County, Zhejiang Province, China. A total of 118,571 subjects aged 35 years old or above participated in this study. The trained health/medical workers collected the general information, health conditions and so on by the face-to-face interview. Totally, 5 ml blood samples were taken. Hyperlipidemia was defined as blood triglyceride > or = 1.70 mmol/L and/or total cholesterols > or = 5.18 mmol/L. SPSS 16.0 was used for statistical analysis. Data of the fifth China population census 2000 was used as the standard population. Among 118,571 eligible subjects, the averages of blood triglyceride and total cholesterols were (1.71 +/- 14.42) mmol/L and (5.48 +/- 40.25 ) mmol/L, respectively, and there was a statistical difference in gender on blood triglyceride (t = 4.163, P education levels, smoking, alcohol consumption and body mass index were significantly related to hyperlipidemia. Hyperlipidemia, especial hypercholesterolemia, was common in adults aged 35 years old or above living in rural China.

  13. 49 CFR 571.403 - Standard No. 403; Platform lift systems for motor vehicles.

    Science.gov (United States)

    2010-10-01

    ... the mobility aid or passenger rests while being raised or lowered. Platform lift means a level change... from ASTM International, 100 Barr Harbor Drive, PO Box C700, West Conshohocken, PA 19428-2959. S5.6... lifts suitable for installation on buses, school buses, and MPVs other than motor homes with a GVWR...

  14. Comparison of maternal and fetal outcomes among Asian Indian pregnant women with or without gestational diabetes mellitus: A situational analysis study (WINGS-3).

    Science.gov (United States)

    Mahalakshmi, Manni Mohanraj; Bhavadharini, Balaji; Maheswari, Kumar; Kalaiyarasi, Gunasekaran; Anjana, Ranjit Mohan; Ranjit, Unnikrishnan; Mohan, Viswanathan; Joseph, Kurian; Rekha, Kurian; Nallaperumal, Sivagnanam; Malanda, Belma; Kayal, Arivudainambi; Belton, Anne; Uma, Ram

    2016-01-01

    To compare the existing maternal and fetal outcomes in Asian Indian women with or without gestational diabetes mellitus (GDM) before the development of the Women in India with GDM Strategy (WINGS) GDM model of care (MOC). Records of pregnant women were extracted retrospectively from three maternity centers in Chennai. GDM was diagnosed using the International Association for Pregnancy Study Groups criteria or the Carpenter and Coustan criteria. Demographic details, obstetric history, antenatal follow-up, treatment for GDM, and outcomes of delivery were collected from the electronic medical records. Of the 3642 records analyzed, 799 (21.9%) had GDM, of whom 456 (57.1%) were treated with insulin and medical nutrition therapy (MNT), 339 (42.4%) with MNT alone, and 4 (0.5%) with metformin. Women with GDM were older than those without (28.5 ± 4.5 vs. 27.1 ± 4.5 years; P women with GDM. In women with GDM treated with insulin and MNT, emergency cesarean section (16.2% vs. 36.6%; P women. Treatment with insulin was associated with a significantly lower risk of complications. However, in countries with limited access to insulin and other medicines may lead to poor follow-up and management of GDM. Data from this retrospective study will form the basis for the development of the WINGS GDM MOC, which will address these gaps in GDM care in low-resource settings.

  15. Anti-α-galactosidase A antibody response to agalsidase beta treatment

    DEFF Research Database (Denmark)

    Wilcox, William R; Linthorst, Gabor E; Germain, Dominique P

    2012-01-01

    Agalsidase beta, a form of recombinant human α-galactosidase A (αGAL), is approved for use as enzyme replacement therapy (ERT) for Fabry disease. An immunogenic response against a therapeutic protein could potentially impact its efficacy or safety. The development of anti-αGAL IgG antibodies...... was evaluated in 571 men and 251 women from the Fabry Registry who were treated with agalsidase beta. Most men developed antibodies (416 of 571, 73%), whereas most women did not (31 of 251, 12%). Women were also significantly more likely to tolerize than men; whereas 18 of 31 women tolerized (58%, 95%CI: 52......%-64%), only 47 of 416 men tolerized during the observation period (11%, 95% CI: 8%-15%). Patients who eventually tolerized had lower median peak anti-αGAL IgG antibody titers than patients who remained seropositive at their most recent assessment (400 versus 3200 in men, 200 versus 400 in women, respectively...

  16. Operation Iraqi Freedom 06-08: Iraq. Operation Enduring Freedom 8: Afghanistan

    Science.gov (United States)

    2008-02-14

    Optimizing Theater Assets 15.6.3 Addressing Reported Short 15.6.4 Leadership and R 15.6.5 Sleep Managemen 15.6.6 Results Related t 15.6.7 NCOs and...36.4% 32.0% 0.02 Continuous operations . 38.8% 33.3% 000 Long deployment length. 57.1% 57.1% 0.99 6.2.2 Top Concerns in MHA T V While the...IT0 and are experienced using AHLTA- T . As noted above, as the operational theater matures in Iraq, there is a clear push to use EMR reporting

  17. 12 CFR 571.90 - Duties regarding the detection, prevention, and mitigation of identity theft.

    Science.gov (United States)

    2010-01-01

    ... section and appendix J, the following definitions apply: (1) Account means a continuing relationship... board of directors, a designated employee at the level of senior management. (3) Covered account means... institution or creditor offers or maintains for which there is a reasonably foreseeable risk to customers or...

  18. 49 CFR 571.105 - Standard No. 105; Hydraulic and electric brake systems.

    Science.gov (United States)

    2010-10-01

    ... brake actuating forces in response to signals from one or more sensed wheels. Initial brake temperature means the average temperature of the service brakes on the hottest axle of the vehicle 0.2 mi before any... procedures and in the sequence set forth in S7. Each school bus with a GVWR greater than 10,000 pounds must...

  19. Overexpression of cyclic adenosine monophosphate effluent protein MRP4 induces an altered response to β-adrenergic stimulation in the senescent rat heart.

    Science.gov (United States)

    Carillion, Aude; Feldman, Sarah; Jiang, Cheng; Atassi, Fabrice; Na, Na; Mougenot, Nathalie; Besse, Sophie; Hulot, Jean-Sébastien; Riou, Bruno; Amour, Julien

    2015-02-01

    In the senescent heart, the positive inotropic response to β-adrenoceptor stimulation is reduced, partly by dysregulation of β1- and β3-adrenoceptors. The multidrug resistance protein 4 (MRP4) takes part in the control of intracellular cyclic adenosine monophosphate concentration by controlling its efflux but the role of MRP4 in the β-adrenergic dysfunction of the senescent heart remains unknown. The β-adrenergic responses to isoproterenol were investigated in vivo (stress echocardiography) and in vitro (isolated cardiomyocyte by Ionoptix with sarcomere shortening and calcium transient) in young (3 months old) and senescent (24 months old) rats pretreated or not with MK571, a specific MRP4 inhibitor. MRP4 was quantified in left ventricular homogenates by Western blotting. Data are mean ± SD expressed as percent of baseline value. The positive inotropic effect of isoproterenol was reduced in senescent rats in vivo (left ventricular shortening fraction 120 ± 16% vs. 158 ± 20%, P < 0.001, n = 16 rats) and in vitro (sarcomere shortening 129 ± 37% vs. 148 ± 35%, P = 0.004, n = 41 or 43 cells) as compared to young rats. MRP4 expression increased 3.6-fold in senescent compared to young rat myocardium (P = 0.012, n = 8 rats per group). In senescent rats, inhibition of MRP4 by MK571 restored the positive inotropic effect of isoproterenol in vivo (143 ± 11%, n = 8 rats). In vitro in senescent cardiomyocytes pretreated with MK571, both sarcomere shortening (161 ± 45% vs. 129 ± 37%, P = 0.007, n = 41 cells per group) and calcium transient amplitude (132 ± 25% vs. 113 ± 27%, P = 0.007) increased significantly. MRP4 overexpression contributes to the reduction of the positive inotropic response to β-adrenoceptor stimulation in the senescent heart.

  20. School Enrollment in the United States: 2011. Population Characteristics. P20-571

    Science.gov (United States)

    Davis, Jessica; Bauman, Kurt

    2013-01-01

    In the United States in 2011, more than one in four people were going to school. This included many types of people--children going to nursery school and elementary school, young adults attending high school and college, and adults taking classes to obtain a degree or diploma. What is known about these people--their age and sex, where they live,…

  1. Factors affecting the quality of cardiopulmonary resuscitation in inpatient units: perception of nurses

    Directory of Open Access Journals (Sweden)

    Clairton Marcos Citolino Filho

    2015-12-01

    Full Text Available Abstract OBJECTIVE To identify, in the perception of nurses, the factors that affect the quality of cardiopulmonary resuscitation (CPR in adult inpatient units, and investigate the influence of both work shifts and professional experience length of time in the perception of these factors. METHOD A descriptive, exploratory study conducted at a hospital specialized in cardiology and pneumology with the application of a questionnaire to 49 nurses working in inpatient units. RESULTS The majority of nurses reported that the high number of professionals in the scenario (75.5%, the lack of harmony (77.6% or stress of any member of staff (67.3%, lack of material and/or equipment failure (57.1%, lack of familiarity with the emergency trolleys (98.0% and presence of family members at the beginning of the cardiopulmonary arrest assistance (57.1% are factors that adversely affect the quality of care provided during CPR. Professional experience length of time and the shift of nurses did not influence the perception of these factors. CONCLUSION The identification of factors that affect the quality of CPR in the perception of nurses serves as parameter to implement improvements and training of the staff working in inpatient units.

  2. Differential regulation of the human progesterone receptor gene through an estrogen response element half site and Sp1 sites.

    Science.gov (United States)

    Petz, Larry N; Ziegler, Yvonne S; Schultz, Jennifer R; Kim, Hwajin; Kemper, J Kim; Nardulli, Ann M

    2004-02-01

    The progesterone receptor (PR) gene is regulated by estrogen in normal reproductive tissues and in MCF-7 human breast cancer cells. Although it is generally thought that estrogen responsiveness is mediated by interaction of the ligand-occupied estrogen receptor (ER) with estrogen response elements (EREs) in target genes, the human progesterone receptor (PR) gene lacks a palindromic ERE. Promoter A of the PR gene does, however, contain an ERE half site upstream of two adjacent Sp1 sites from +571 to +595, the +571 ERE/Sp1 site. We have examined the individual contributions of the ERE half site and the two Sp1 sites in regulating estrogen responsiveness. Transient transfection assays demonstrated that both Sp1 sites were critical for estrogen-mediated activation of the PR gene. Interestingly, rather than decreasing transcription, mutations in the ERE half site increased transcription substantially suggesting that this site plays a role in limiting transcription. Chromatin immunoprecipitation assays demonstrated that Sp1 was associated with the +571 ERE/Sp1 site in the endogenous PR gene in the absence and in the presence of estrogen, but that ERalpha was only associated with this region of the PR gene after MCF-7 cells had been treated with estrogen. Our studies provide evidence that effective regulation of transcription through the +571 ERE/Sp1 site requires the binding of ERalpha and Sp1 to their respective cis elements and the appropriate interaction of ERalpha and Sp1 with other coregulatory proteins and transcription factors.

  3. Chronic degenerative diseases in elderly: physiotherapeutic data - doi:10.5020/18061230.2011.p221

    Directory of Open Access Journals (Sweden)

    Lais Keylla Felipe

    2012-01-01

    Full Text Available Objective: To assess the most frequent chronic diseases in the elderly population of a private clinic of Physiotherapy. Methods: We assessed medical records of clients who received treatment at a Physiotherapy clinic in the period 2005 to 2008, looking for chronic diseases as diagnosis and/or related to them. Of these, we selected those which contained birth date and/or aged sixty-five years or above. An instrument like a check list, developed by the researchers, identified: quantity, gender, medical diagnosis and comorbidities. For quantification of variables we applied simple percentage calculation. Results: In the study period, there were four hundred fifty-eight records, of which forty-nine corresponded to the survey’s inclusion criteria. The majority 59.2% (n=29 referred to the year 2008; 26.6% (n=13 being males and 73.4% (n=36 females. The most commonly found diagnosis comprised osteoarthritis 57.1% (n=28, fracture and/or history of fractures 24.4% (n=12 and other diagnosis 48.9% (n=24. Associated chronic diseases included diabetes mellitus 18.3% (n=9 and systemic hypertension 57.1% (n=23. Conclusion: Chronic degenerative diseases in elderly have received increasing attention from health professionals; osteoarthritis being the most common diagnosis in this study, followed by fracture and/or history of fractures. The comorbidities represented a greater negative impact in the quality of life of elderly.

  4. ESTUDIO DESCRIPTIVO DE SÍNDROME INMOVILIDAD PACIENTE GERIÁTRICO

    OpenAIRE

    Román l; Ovejero RA

    2014-01-01

    Objective: To determine epidemiological characteristics, incidence, prevalence and complications of immobility syndrome in older adults and medical strategies to prevent or treat this syndrome. Materials and methods: A sample of 50 hospitalized patients (mean age 81 years) were studied between March and June 2013. Reasons for hospitalization , origin, time of immobility, and nutritional parameters were considered. Results: Among older adults admitted to hospital environment 57.1 % wer...

  5. Earth building materials in pre-historic domestic architectures on the south of Portugal

    OpenAIRE

    Bruno, Patrícia; Faria, Paulina

    2008-01-01

    HERITAGE 2008 - World Heritage and Sustainable Development. Barcelos: Green Lines Institute for Sustainable Development, Vol. 2, p. 571-579 Pre-historic architectures reveal a profound knowledge of building materials and their selection and application. Depending on each geographical context or functional needs, pre-historic man developed and applied different building techniques. Archaeological vestiges from several pre-historic settlements of southwest Iberia has shown that s...

  6. Chiral auxiliary-mediated enantioenrichment of (+-)-ibuprofen, under Steglich conditions, with secondary alcohols derived from (R)-carvone

    Energy Technology Data Exchange (ETDEWEB)

    Amongero, Marcela; Visnovezky, Damian; Kaufman, Teodoro S., E-mail: kaufman@iquir-conicet.gov.a [Instituto de Quimica Rosario (IQUIR, CONICET-UNR) (Argentina); Universidad Nacional de Rosario (Argentina)

    2010-07-01

    The synthesis of a series of chiral secondary alcohols derived from (R)-carvone, and the stereochemical outcome of their reaction with (+-)-ibuprofen, is reported. The racemic drug was transformed into the corresponding diastereomeric esters mediated by DCC/DMAP, affording up to 5.7:1 diastereomeric ratios of the esters derived from either (S)- or (R)-ibuprofen, depending on the type of chiral auxiliary employed. (author)

  7. Environment assessment: allocation of petroleum feedstock, Algonquin SNG Inc. , Freetown SNG Plant, Bristol County, MA. [Effects of 100, 78, 49% allocations

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    The proposed administrative action to deny, grant or modify the Algonquin SNG, Inc. (Algonquin) petition for an adjusted allocation of naphtha feedstock may significantly affect the ehuman environment. The volume of feedstock requested is 4,425,571 barrels per year of naphtha to be used in Algonquin's Freetown, MA synthetic natural gas (SNG) plant. Environmental impacts of 100, 78, and 49% allocations were evaluated.

  8. Chiral auxiliary-mediated enantioenrichment of (+-)-ibuprofen, under Steglich conditions, with secondary alcohols derived from (R)-carvone

    International Nuclear Information System (INIS)

    Amongero, Marcela; Visnovezky, Damian; Kaufman, Teodoro S.

    2010-01-01

    The synthesis of a series of chiral secondary alcohols derived from (R)-carvone, and the stereochemical outcome of their reaction with (±)-ibuprofen, is reported. The racemic drug was transformed into the corresponding diastereomeric esters mediated by DCC/DMAP, affording up to 5.7:1 diastereomeric ratios of the esters derived from either (S)- or (R)-ibuprofen, depending on the type of chiral auxiliary employed. (author)

  9. Expediting Tax Deposits Can Increase the Government’s Interest Earnings.

    Science.gov (United States)

    1983-11-21

    the FTD system. These deposits included such tax receipts as withheld personal income tax, corporate income tax , and social security, excise...Greater than or 159,500 2,733 4.2 571,000 222,000 equal to $25,000 Total $1,279,000 Corporate Income Tax Payments Projected Sampling Average Number...than or 130,600 2,215 2.7 292,000 80,000 equal to $25,000 Total $779,000 Corporate Income Tax Payments Projected Sampling Average Number Average

  10. 49 CFR 571.304 - Standard No. 304; Compressed natural gas fuel container integrity.

    Science.gov (United States)

    2010-10-01

    ... closely fitted surfaces of the joint by capillary attraction. Burst pressure means the highest internal... every 36 months or 36,000 miles, whichever comes first, for damage and deterioration. (h) The statement...

  11. 49 CFR 571.109 - Standard No. 109; New pneumatic and certain specialty tires.

    Science.gov (United States)

    2010-10-01

    ... sidewall rubber. Chunking means the breaking away of pieces of the tread or sidewall. Cord means the... that specified in (a). (d) Caliper the section width and overall width at six points approximately...

  12. 49 CFR 571.139 - Standard No. 139; New pneumatic radial tires for light vehicles.

    Science.gov (United States)

    2010-10-01

    ... breaking away of pieces of the tread or sidewall. Cord means the strands forming the plies in the tire... with a 12-inch or smaller rim diameter, each tire shall have not less than six treadwear indicators... mountain, there must be a six-sided snowflake having a minimum height of one-half the tallest peak...

  13. Curative or pre-emptive adenovirus-specific T cell transfer from matched unrelated or third party haploidentical donors after HSCT, including UCB transplantations: a successful phase I/II multicenter clinical trial

    Directory of Open Access Journals (Sweden)

    Chongsheng Qian

    2017-05-01

    Full Text Available Abstract Background Allogeneic hematopoietic stem cell transplantation (HSCT, the most widely used potentially curable cellular immunotherapeutic approach in the treatment of hematological malignancies, is limited by life-threatening complications: graft versus host disease (GVHD and infections especially viral infections refractory to antiviral drugs. Adoptive transfer of virus-specific T cells is becoming an alternative treatment for infections following HSCT. We report here the results of a phase I/II multicenter study which includes a series of adenovirus-specific T cell (ADV-VST infusion either from the HSCT donor or from a third party haploidentical donor for patients transplanted with umbilical cord blood (UCB. Methods Fourteen patients were eligible and 11 patients received infusions of ADV-VST generated by interferon (IFN-γ-based immunomagnetic isolation from a leukapheresis from their original donor (42.9% or a third party haploidentical donor (57.1%. One patient resolved ADV infection before infusion, and ADV-VST could not reach release or infusion criteria for two patients. Two patients received cellular immunotherapy alone without antiviral drugs as a pre-emptive treatment. Results One patient with adenovirus infection and ten with adenovirus disease were infused with ADV-VST (mean 5.83 ± 8.23 × 103 CD3+IFN-γ+ cells/kg up to 9 months after transplantation. The 11 patients showed in vivo expansion of specific T cells up to 60 days post-infusion, associated with adenovirus load clearance in ten of the patients (91%. Neither de novo GVHD nor side effects were observed during the first month post-infusion, but GVHD reactivations occurred in three patients, irrespective of the type of leukapheresis donor. For two of these patients, GVHD reactivation was controlled by immunosuppressive treatment. Four patients died during follow-up, one due to refractory ADV disease. Conclusions Adoptive transfer of rapidly isolated ADV

  14. Multiple efflux pumps are involved in the transepithelial transport of colchicine: combined effect of p-glycoprotein and multidrug resistance-associated protein 2 leads to decreased intestinal absorption throughout the entire small intestine.

    Science.gov (United States)

    Dahan, Arik; Sabit, Hairat; Amidon, Gordon L

    2009-10-01

    The purpose of this study was to thoroughly characterize the efflux transporters involved in the intestinal permeability of the oral microtubule polymerization inhibitor colchicine and to evaluate the role of these transporters in limiting its oral absorption. The effects of P-glycoprotein (P-gp), multidrug resistance-associated protein 2 (MRP2), and breast cancer resistance protein (BCRP) inhibitors on colchicine bidirectional permeability were studied across Caco-2 cell monolayers, inhibiting one versus multiple transporters simultaneously. Colchicine permeability was then investigated in different regions of the rat small intestine by in situ single-pass perfusion. Correlation with the P-gp/MRP2 expression level throughout different intestinal segments was investigated by immunoblotting. P-gp inhibitors [N-(4-[2-(1,2,3,4-tetrahydro-6,7-dimethoxy-2-isoquinolinyl)ethyl]-phenyl)-9,10-dihydro-5-methoxy-9-oxo-4-acridine carboxamide (GF120918), verapamil, and quinidine], and MRP2 inhibitors [3-[[3-[2-(7-chloroquinolin-2-yl)vinyl]phenyl]-(2-dimethylcarbamoylethylsulfanyl)methylsulfanyl] propionic acid (MK571), indomethacin, and p-aminohippuric acid (p-AH)] significantly increased apical (AP)-basolateral (BL) and decreased BL-AP Caco-2 transport in a concentration-dependent manner. No effect was obtained by the BCRP inhibitors fumitremorgin C (FTC) and pantoprazole. P-gp/MRP2 inhibitors combinations greatly reduced colchicine mucosal secretion, including complete abolishment of efflux (GF120918/MK571). Colchicine displayed low (versus metoprolol) and constant permeability along the rat small-intestine. GF120918 significantly increased colchicine permeability in the ileum with no effect in the jejunum, whereas MK571 augmented jejunal permeability without changing the ileal transport. The GF120918/MK571 combination caused an effect similar to that of MK571 alone in the jejunum and to that of GF120918 alone in the ileum. P-gp expression followed a gradient increasing from

  15. Role of signal dose preoperative antibiotic in acute nonperforated appendicitics

    International Nuclear Information System (INIS)

    Malik, S.A.; Rasheed, M.; Abbasi, A.S.; Iqbal, R.A.; Mian, M.A.

    2013-01-01

    Objective: To determine the efficacy of a single dose of preoperative antibiotic in preventing post operative infective complications in patients undergoing appendicectomy for non perforated acute appendicitis. Study Design: Randomized controlled trials. Place and Duration of Study: Surgical unit I and II, department of General Surgery, Combined Military Hospital (CMH) Lahore from 1st June to 31st October 2010. Patients and Methods: Seventy patients with acute appendicitis scheduled for appendicectomy were included in the study and randomly divided into two groups of 35 each using random numbers table. Group A received single dose preoperative antibiotic and group B received three-dose regimens of cefuroxime. Postoperative infective complications were the primary endpoint. Results: The rate of postoperative wound infection was not statistically insignificantly different among the groups; (8.57%) group A and (5.71%) group B at 1st post operative week and (5.71%) group A and (5.71%) group B at 2nd post operative week. None of the patients from either group showed any signs of intra abdominal abscess formation. Conclusion: Single dose of preoperative antibiotics is adequate for prevention of postoperative infective complications in patients with non-perforated appendicitis undergoing open appendicectomy. (author)

  16. Kaon project accelerates drive to raise $571 million

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    The proposed addition of a Kaon factory to the TRIUMF Meson Facility in Vancouver is receiving promises of financial backing from Canada's provinces, the U.S., Germany, Japan, and the global scientific community

  17. Börsiindeks Talse kerkis eelmisel aastal 57,1%

    Index Scriptorium Estoniae

    2005-01-01

    Tallinna börsi indeks Talse tõusis 2004. aastaga 448,82 punktini, börsiettevõtete turuväärtus kasvas 4,59 mld euroni, edukalt käivitus Tallinnas, Riias ja Helsingis kasutusele võetud kauplemissüsteem SAXESS, kasvas piiriüleste väärtpaberitehingute hulk

  18. The treatment of facial atopic dermatitis in children who are intolerant of, or dependent on, topical corticosteroids: a randomized, controlled clinical trial.

    Science.gov (United States)

    Hoeger, P H; Lee, K-H; Jautova, J; Wohlrab, J; Guettner, A; Mizutani, G; Hultsch, T

    2009-02-01

    Atopic dermatitis (AD) is most prevalent in areas of reduced skin barrier reserve, like face and neck, especially in children. Treatment with topical corticosteroids (TCS) is limited due to heightened risk of treatment-associated side-effects, thus necessitating alternative AD therapies. The primary study objective was to determine the efficacy of pimecrolimus cream 1% in children with mild-moderate facial AD dependent on/intolerant of TCS. Secondary objectives included effects on overall Eczema Area and Severity Index (EASI), head/neck EASI, pruritus severity and time to clearance of facial AD. A multicentre, double-blind (DB) study of < or = 6 weeks, followed by a 6-week, open-label (OL) phase was conducted. Two hundred patients (aged 2-11 years) were randomized 1:1 to pimecrolimus cream 1% (n = 99) or vehicle (n = 101) twice daily until clearance of facial AD or for a maximum of 6 weeks (DB phase). Sixteen patients receiving vehicle were allowed to switch to the OL phase at day 22. Significantly more pimecrolimus-treated vs. vehicle-treated patients were cleared/almost cleared of facial AD (Investigators' Global Assessment 0/1): 74.5% vs. 51.0%, P < 0.001 (day 43) [57.1% vs. 36.0%, P = 0.004 (day 22)]. Median time to clearance was 22.0 vs. 43.0 days (pimecrolimus vs. vehicle, respectively). Statistically significant differences for pimecrolimus vs. vehicle were also seen on head/neck EASI, overall EASI, and head/neck pruritus scores. Adverse events were mainly mild-moderate, occurring with similar frequency in both treatment groups. In children with facial dermatitis intolerant of/dependent on TCS, pimecrolimus cream 1% effectively controls eczema and pruritus and is well tolerated.

  19. 12 CFR Appendix C to Part 571 - Model Forms for Opt-Out Notices

    Science.gov (United States)

    2010-01-01

    ... includes your [income], your [account history with us], and your [credit score]. • Your choice to limit... [income], your [account history with us], and your [credit score]. • Your choice has expired or is about.... Rearranging the order of the references to “your income,” “your account history,” and “your credit score.” 2...

  20. A novel bacteriocin-like substance (BLIS) from a pathogenic strain of Vibrio harveyi.

    Science.gov (United States)

    Prasad, Sathish; Morris, Peter C; Hansen, Rasmus; Meaden, Philip G; Austin, Brian

    2005-09-01

    Inter-strain and inter-species inhibition mediated by a bacteriocin-like inhibitory substance (BLIS) from a pathogenic Vibrio harveyi strain VIB 571 was demonstrated against four isolates of the same species, and one culture each of a Vibrio sp., Vibrio fischeri, Vibrio gazogenes and Vibrio parahaemolyticus. The crude BLIS, which was obtained by ammonium-sulphate precipitation of the cell-free supernatant of a 72 h broth culture of strain VIB 571, was inactivated by lipase, proteinase K, pepsin, trypsin, pronase E, SDS and incubation at > or =60 degrees C for 10 min. The activity was stable between pH 2-11 for at least 5 h. Anion-exchange chromatography, gel filtration, SDS-PAGE and two-dimensional gel electrophoresis revealed the presence of a single major peak, comprising a protein with a pI of approximately 5.4 and a molecular mass of approximately 32 kDa. The N-terminal amino acid sequence of the protein comprised Asp-Glu-Tyr-Ile-Ser-X-Asn-Lys-X-Ser-Ser-Ala-Asp-Ile (with X representing cysteine or modified amino acid residues). A similarity search based on the matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) generated peptide masses and the N-terminal sequence did not yield any significant matches.

  1. PBSCT is associated with poorer survival and increased chronic GvHD than BMT in Japanese paediatric patients with acute leukaemia and an HLA-matched sibling donor.

    Science.gov (United States)

    Shinzato, Aki; Tabuchi, Ken; Atsuta, Yoshiko; Inoue, Masami; Inagaki, Jiro; Yabe, Hiromasa; Koh, Katsuyoshi; Kato, Koji; Ohta, Hideaki; Kigasawa, Hisato; Kitoh, Toshiyuki; Ogawa, Atsushi; Takahashi, Yoshiyuki; Sasahara, Yoji; Kato, Shun-Ichi; Adachi, Souichi

    2013-09-01

    Peripheral blood stem cells (PBSC) may be used as an alternative to bone marrow (BM) for allogeneic transplantation. Since peripheral blood stem cell bank from unrelated volunteer donor has been started in Japan, use of PBSC allografts may be increased. Therefore we surveyed the outcomes of Japanese leukemia children after PBSC and BM transplantation. This retrospective study compared the outcomes of 661 children (0-18 years) with acute lymphoblastic leukaemia (ALL) or acute myeloid leukaemia (AML) who received their first allogeneic peripheral blood stem cell transplantation (PBSCT; n = 90) or bone marrow transplantation (BMT; n = 571) from HLA-matched siblings between January 1996 and December 2007. Neutrophil recovery was faster after PBSCT than after BMT (ALL: P vs. 9.9%, P = 0.0066; AML: 41.6% vs. 11.1%, P vs. 57.1%, P = 0.0257). The 5-year overall survival (OS) was lower after PBSCT than after BMT for ALL (42.4% vs. 63.7%, P = 0.0032) and AML (49.8% vs. 71.8%, P = 0.0163). Multivariate analysis revealed the use of PBSC was a significant risk factor for DFS and OS. PBSCT and BMT did not differ in relapse rate, acute GvHD for ALL and AML, or in DFS for AML. PBSC allografts in Japanese children engraft faster but are associated with poorer survival and increased chronic GvHD. Copyright © 2013 Wiley Periodicals, Inc.

  2. Fatty acids, phenols content, and antioxidant activity in Ibervillea sonorae callus cultures

    OpenAIRE

    Estrada-Zúñiga, M.E.; Arano-Varela, H.; Buendía-González, L.; Orozco-Villafuerte, J.

    2012-01-01

    Ibervillea sonorae callus cultures were established in order to produce fatty acids (lauric, myristic, pentadecanoic, palmitic and stearic acids) and phenolic compounds. Highest callus induction (100%) was obtained in treatments containing 2.32 or 4.65 μM Kinetin (KIN) with 2.26 or 6.80 μM 2,4-Dichlorophenoxyacetic acid (2,4-D). Highest fatty acids (FA) production (48.57 mg g-1), highest total phenol content (TPC; 57.1 mg gallic acid equivalents [GAE] g-1) and highest antioxidant activity (EC...

  3. Ethnicity, maternal risk, and birth weight among Hispanics in Massachusetts, 1987-89.

    OpenAIRE

    Cohen, B B; Friedman, D J; Mahan, C M; Lederman, R; Munoz, D

    1993-01-01

    National data reveal that low birth weight and infant mortality rates among Hispanics are, in general, between the rates for whites and those for blacks. The question remains, do differences in low birth weight reflect distributions of known risk factors, or do ethnic differences persist after simultaneously adjusting for intervening variables? In this study, Massachusetts birth certificate data for 206,973 white non-Hispanic infants and 19,571 Hispanic infants are used to examine differences...

  4. Systematic review of the published data on the worldwide prevalence of John Cunningham virus in patients with multiple sclerosis and neuromyelitis optica.

    Science.gov (United States)

    Paz, Sonia Patricia Castedo; Branco, Luciana; Pereira, Marina Alves de Camargo; Spessotto, Caroline; Fragoso, Yara Dadalti

    2018-01-01

    John Cunningham virus (JCV) is a polyoma virus that infects humans, mainly in childhood or adolescence, and presents no symptomatic manifestations. JCV can cause progressive multifocal leukoencephalopathy (PML) in immunosuppressed individuals, including those undergoing treatment for multiple sclerosis (MS) and neuromyelitis optica (NMO). PML is a severe and potentially fatal disease of the brain. The prevalence of JCV antibodies in human serum has been reported to be between 50.0 and 90.0%. The aim of the present study was to review worldwide data on populations of patients with MS and NMO in order to establish the rates of JCV seropositivity in these individuals. The present review followed the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses) guidelines and used the following search terms: "JCV" OR "JC virus" AND "multiple sclerosis" OR "MS" OR "NMO" OR "neuromyelitis optica" AND "prevalence." These terms were searched for both in smaller and in larger clusters of words. The databases searched included PubMed, MEDLINE, SciELO, LILACS, Google Scholar, and Embase. After the initial selection, 18 papers were included in the review. These articles reported the prevalence of JCV antibodies in the serum of patients with MS or NMO living in 26 countries. The systematic review identified data on 29,319 patients with MS/NMO and found that 57.1% of them (16,730 individuals) were seropositive for the anti-JCV antibody (range, 40.0 to 69.0%). The median worldwide prevalence of JCV among adults with MS or NMO was found to be 57.1%.

  5. 49 CFR 571.129 - Standard No. 129; New non-pneumatic tires for passenger cars.

    Science.gov (United States)

    2010-10-01

    ... means the breaking away of pieces of the carcass or tread. Cracking means any parting within the carcass... some circumference of the tire, these measurements shall be taken at least six points around the tire...

  6. 49 CFR 571.222 - Standard No. 222; School bus passenger seating and crash protection.

    Science.gov (United States)

    2010-10-01

    ... (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR... school bus occupants against structures within the vehicle during crashes and sudden driving maneuvers... removable without tools or to flip up must have a self-latching mechanism that is activated when a 22-kg (48...

  7. VAT COLLECTION TO COLLECTION: ADVANTAGES AND DISADVANTAGES

    Directory of Open Access Journals (Sweden)

    ROXANA ISPAS

    2012-10-01

    Full Text Available This paper presents the major changes in the payment system of value added tax (VAT. Through the Government Ordinance no. 15/2012 amending and supplementing Law no. 571/2003 regarding the Fiscal Code, there was introduced, with effect from 01.01.2013, the payment of the value added tax (VAT on cashing the whole or partial counter value of the supply of goods or provision of services. There are detailed the most important data on the topic, but also information about the risks and benefits resulting from the new legal provisions.

  8. Excessive Exercise Habits in Marathoners as Novel Indicators of Masked Hypertension

    OpenAIRE

    Kim, Young-Joo; Park, Yongbum; Kang, Duk-Ho; Kim, Chul-Hyun

    2017-01-01

    Background. Excessive exercise such as marathon running increases the risk of cardiovascular events that may be related to myocardial infarction and sudden death. We aimed to investigate that the exercise characteristics can be used as a novel indicator of masked hypertension. Methods. A total of 571 middle-aged recreational male marathoners were assigned to a high blood pressure group (HBPG; n = 214) or a normal blood pressure group (NBPG; n = 357). A graded exercise test was used to examine...

  9. Drug: D10235 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 571] ... Same as: E00338 ... Rutaceae (rue family) Citrus unshiu, Citrus reticulata immature fruit and fruit peel; Standards for non-pharmacopoeial crude drugs ... PubChem: 163312266 ...

  10. 76 FR 13986 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); Public Meetings

    Science.gov (United States)

    2011-03-15

    ..., SC 29405. FOR FURTHER INFORMATION CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place Drive, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; e-mail: kari.fenske@safmc.net...

  11. Cross-cultural examination of the five-factor model of drinking motives in Spanish and Canadian undergraduates.

    Science.gov (United States)

    Mezquita, Laura; Stewart, Sherry H; Kuntsche, Emmanuel; Grant, Valerie V

    2016-06-14

    This study aims to test the cross-cultural suitability of Modified Drinking Motives Questionnaire-Revised (M DMQ-R) (Grant, Stewart, O'Connor, Blackwell, & Conrod, 2007). The sample included 571 Spanish and 571 Canadian undergraduates between the ages of 18 and 22 (65.8% women). The confirmatory factor analysis demonstrated factorial invariance between samples. The regression analysis showed that social, enhancement and low conformity motives were related to drinking frequency and drinking quantity in the total sample. No moderation effect of country on predicting alcohol consumption was found. The results suggest that M DMQ-R is a suitable instrument for comparing drinking motives across Spanish and Canadian undergraduates, and that motives-focused prevention and treatment programmes developed in one country could be generalised to another.

  12. Population Pharmacokinetic Analysis of Cefiderocol, a Parenteral Siderophore Cephalosporin, in Healthy Subjects, Subjects with Various Degrees of Renal Function, and Patients with Complicated Urinary Tract Infection or Acute Uncomplicated Pyelonephritis.

    Science.gov (United States)

    Kawaguchi, Nao; Katsube, Takayuki; Echols, Roger; Wajima, Toshihiro

    2018-02-01

    Cefiderocol, a novel parenteral siderophore cephalosporin, exhibits potent efficacy against most Gram-negative bacteria, including carbapenem-resistant strains. The aim of this study was to perform a population pharmacokinetic (PK) analysis based on plasma cefiderocol concentrations in healthy subjects, subjects with various degrees of renal function, and patients with complicated urinary tract infection (cUTI) or acute uncomplicated pyelonephritis (AUP) caused by Gram-negative pathogens and to calculate the fraction of the time during the dosing interval where the free drug concentration in plasma exceeds the MIC ( fT MIC ). Population PK models were developed with three renal function markers, body surface area-adjusted estimated glomerular filtration rate (eGFR), absolute eGFR, and creatinine clearance, on the basis of 2,571 plasma concentrations from 91 subjects without infection and 238 patients with infection. The population PK models with each renal function marker adequately described the plasma cefiderocol concentrations. Clear relationships of total clearance (CL) to all renal function markers were observed. Body weight and disease status (with or without infection) were also significant covariates. The CL in patients with infection was 26% higher than that in subjects without infection. The fT MIC values were more than 75% in all patients (and were 100% in most patients), suggesting that a sufficient exposure to cefiderocol was provided by the tested dose regimens (2 g every 8 h as the standard dose regimen) for the treatment of cUTI or AUP caused by Gram-negative pathogens. Copyright © 2018 Kawaguchi et al.

  13. Meediavabaduse reguleerimine - allikakaitse ja vastulause õigus : [teadusmagistritöö] / Kristjan Ots ; Tartu Ülikool, sotsiaalteaduskond ; juhendaja: Halliki Harro-Loit

    Index Scriptorium Estoniae

    Ots, Kristjan, 1976-

    2009-01-01

    Sisaldab ka varem ilmunud artikleid: Ajakirjandusvabadus ja allikakaitse. Juridica, 2005, nr. 8, lk. 571-583 ; Üksikisiku seisund meedia suhtes ning vastulause esitamise õigus. Juridica, 2008, nr. 2, lk. 102-118

  14. All projects related to | Page 571 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Program: Climate Change. Total Funding: CA$ 1,306,013.00. Managing Risk, Reducing Vulnerability and Enhancing Productivity under a Changing Climate. Project. The countries of the Greater Horn of Africa are particularly vulnerable to drought, exacerbated by widespread poverty and dependence on rainfed agriculture.

  15. 49 CFR 571.125 - Standard No. 125; Warning devices.

    Science.gov (United States)

    2010-10-01

    ... TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR VEHICLE SAFETY STANDARDS Federal... in motor vehicles and used to warn approaching traffic of the presence of a stopped vehicle, except... the driver activate the vehicular hazard warning signal lamps before leaving the vehicle to erect the...

  16. 49 CFR 571.207 - Standard No. 207; Seating systems.

    Science.gov (United States)

    2010-10-01

    ... standard establishes requirements for seats, their attachment assemblies, and their installation to....2. General performance requirements. When tested in accordance with S5, each occupant seat shall... than a school bus; a passenger seat on a school bus with a GVWR greater than 4,536 kilograms (10,000...

  17. 49 CFR 571.106 - Standard No. 106; Brake hoses.

    Science.gov (United States)

    2010-10-01

    ... movable head at 800 rpm. S6.4Tensile strength test. Utilize a tension testing machine conforming to the... Verification of Testing Machines,” and provided with a recording device to measure the force applied. This... and attached to the pressure cycling machine. (c) A burst test apparatus to conduct testing specified...

  18. 49 CFR 571.218 - Standard No. 218; Motorcycle helmets.

    Science.gov (United States)

    2010-10-01

    ...), and exhibit no resonant frequencies below 2,000 Hz. S7.1.6 The monorail drop test system is used for... assembly weight for the monorail system is the drop assembly weight minus the combined weight of the test... axes of the test headform assembly on a monorail drop test equipment are oriented as follows: From the...

  19. Systematic review of the published data on the worldwide prevalence of John Cunningham virus in patients with multiple sclerosis and neuromyelitis optica

    Directory of Open Access Journals (Sweden)

    Sonia Patricia Castedo Paz

    2018-01-01

    Full Text Available OBJECTIVES John Cunningham virus (JCV is a polyoma virus that infects humans, mainly in childhood or adolescence, and presents no symptomatic manifestations. JCV can cause progressive multifocal leukoencephalopathy (PML in immunosuppressed individuals, including those undergoing treatment for multiple sclerosis (MS and neuromyelitis optica (NMO. PML is a severe and potentially fatal disease of the brain. The prevalence of JCV antibodies in human serum has been reported to be between 50.0 and 90.0%. The aim of the present study was to review worldwide data on populations of patients with MS and NMO in order to establish the rates of JCV seropositivity in these individuals. METHODS The present review followed the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses guidelines and used the following search terms: “JCV” OR “JC virus” AND “multiple sclerosis” OR “MS” OR “NMO” OR “neuromyelitis optica” AND “prevalence.” These terms were searched for both in smaller and in larger clusters of words. The databases searched included PubMed, MEDLINE, SciELO, LILACS, Google Scholar, and Embase. RESULTS After the initial selection, 18 papers were included in the review. These articles reported the prevalence of JCV antibodies in the serum of patients with MS or NMO living in 26 countries. The systematic review identified data on 29,319 patients with MS/NMO and found that 57.1% of them (16,730 individuals were seropositive for the anti-JCV antibody (range, 40.0 to 69.0%. CONCLUSIONS The median worldwide prevalence of JCV among adults with MS or NMO was found to be 57.1%.

  20. Algae

    Czech Academy of Sciences Publication Activity Database

    Raven, John A.; Giordano, Mario

    2014-01-01

    Roč. 24, č. 13 (2014), s. 590-595 ISSN 0960-9822 Institutional support: RVO:61388971 Keywords : algae * life cycle * evolution Subject RIV: EE - Microbiology, Virology Impact factor: 9.571, year: 2014

  1. 75 FR 23600 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-05-04

    ... feet +571 upstream of the confluence with Millers Creek. Dale Hollow Lake (Wolf River) At the... upstream of the confluence with Spring Creek. Lake Cumberland Just upstream of the Wolf +760 Unincorporated...

  2. The relation of Cx43 and NMDA to visceral sensitization in rats with irritable bowel syndrome

    Directory of Open Access Journals (Sweden)

    Jing-yu ZHANG

    2016-01-01

    Full Text Available Objective  To study the relationship between connexin 43 (Cx43 and N-methyl-D-aspartate (NMDA receptors and visceral sensitization in the rats with irritable bowel syndrome (IBS. Methods  Thirty rats were gavaged with Triehinella spiralis to reproduce the IBS model. These rats were randomly divided into IBS group, IBS+colon distension group, and IBS+STI-571+colon distension group, and other groups of normal rats were randomized into normal group and normal+colon distension group, with 10 rats in each group. Immunofluorescent double staining were used to observe the expressions of intestine Cx43 and sacral NMDA re ceptors of rats in all the groups. Results  The Cx43 and sacral NMDA expressions in the normal group, normal+colon distension group and IBS group showed no significant changes (P>0.05, however, Cx43 and sacral NMDA expressions were significantly higher in IBS rats with colon distension as compared with those in normal group, normal+colon distension group, and IBS group (P<0.05, while they were significantly lower in the IBS+STI-571+colon distension group after STI-571 intervention (P<0.05. Conclusion  Cx43 and sacral NMDA may be the most important factor of visceral sensitization in IBS rats. DOI: 10.11855/j.issn.0577-7402.2015.12.02

  3. Patient Factors But Not the Use of Novel Anticoagulants or Warfarin Are Associated With Internal Jugular Vein Access-Site Hematoma After Right Heart Catheterization.

    Science.gov (United States)

    Dasa, Osama; Shafiq, Qaiser; Ruzieh, Mohammed; Alhazmi, Luai; Al-Dabbas, Maen; Ammari, Zaid; Khouri, Samer; Moukarbel, George

    2017-12-01

    Right heart catheterization (RHC) is routinely performed to assess hemodynamics. Generally, anticoagulants are held prior to the procedure. At our center, anticoagulants are continued and ultrasound guidance is always used for internal jugular vein access. A micropuncture access kit is used to place a 5 or 6 Fr sheath using the modified Seldinger technique. Manual compression is applied for 10-15 min and the patient is observed for at least 2 hours after the procedure. In a retrospective analysis, we investigated the risk of bleeding complications associated with RHC via the internal jugular vein in patients with and without full anticoagulation. Our catheterization laboratory database was searched for adult patients who underwent RHC by a single operator between January 2012 and December 2015. A total of 571 patients were included in the analysis. Baseline characteristics, labs, relevant invasive hemodynamics, co-morbid conditions, and incidence of access-site hematoma are presented. Multivariable binary logistic regression was performed using IBM SPSS v. 23.0 software. Statistically significant associations with access-site hematoma were observed with body mass index (P=.02; 95% confidence interval [CI], 1.0-1.1), right atrial pressure (P=.03; 95% CI, 0.7-0.9), and dialysis dependence (P.99). The incidence of internal jugular vein access-site hematoma is small when using careful access techniques for RHC even with the continued use of novel oral anticoagulants and warfarin. Patient characteristics and co-morbid conditions are related to bleeding complications.

  4. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 571 - 580 of 8492 ... Tech goodies versus tech power : power analysis as a tool for ICTD research and project design; learning clinic from IT for Change. Published date. January 1, 2009. Studies.

  5. Effects of dietary L-arginine on orthodontic tooth movement in rats

    African Journals Online (AJOL)

    Yomi

    2012-01-03

    Jan 3, 2012 ... differentiation of the cells in the periodontal ligament. (PDL) during .... disease, Lippincott Williams & Wilkins, Philadelphia, pp. 571-582. ... periodontium to orthodontic forces in adolescent and adult subject. Br. J. Orthod.

  6. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 571 - 580 of 8491 ... Tech goodies versus tech power : power analysis as a tool for ICTD research and project design; learning clinic from IT for Change. Published date. January 1, 2009. Studies.

  7. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

    Science.gov (United States)

    2010-10-01

    ... piece of window glazing and each surrounding window frame when tested in accordance with the procedure... of the rear emergency door or doors shall be 45 inches high, 22 inches wide, and six inches deep. S5...

  8. AtRH57, a DEAD-box RNA helicase, is involved in feedback inhibition of glucose-mediated abscisic acid accumulation during seedling development and additively affects pre-ribosomal RNA processing with high glucose.

    Science.gov (United States)

    Hsu, Yi-Feng; Chen, Yun-Chu; Hsiao, Yu-Chun; Wang, Bing-Jyun; Lin, Shih-Yun; Cheng, Wan-Hsing; Jauh, Guang-Yuh; Harada, John J; Wang, Co-Shine

    2014-01-01

    The Arabidopsis thaliana T-DNA insertion mutant rh57-1 exhibited hypersensitivity to glucose (Glc) and abscisic acid (ABA). The other two rh57 mutants also showed Glc hypersensitivity similar to rh57-1, strongly suggesting that the Glc-hypersensitive feature of these mutants results from mutation of AtRH57. rh57-1 and rh57-3 displayed severely impaired seedling growth when grown in Glc concentrations higher than 3%. The gene, AtRH57 (At3g09720), was expressed in all Arabidopsis organs and its transcript was significantly induced by ABA, high Glc and salt. The new AtRH57 belongs to class II DEAD-box RNA helicase gene family. Transient expression of AtRH57-EGFP (enhanced green fluorescent protein) in onion cells indicated that AtRH57 was localized in the nucleus and nucleolus. Purified AtRH57-His protein was shown to unwind double-stranded RNA independent of ATP in vitro. The ABA biosynthesis inhibitor fluridone profoundly redeemed seedling growth arrest mediated by sugar. rh57-1 showed increased ABA levels when exposed to high Glc. Quantitative real time polymerase chain reaction analysis showed that AtRH57 acts in a signaling network downstream of HXK1. A feedback inhibition of ABA accumulation mediated by AtRH57 exists within the sugar-mediated ABA signaling. AtRH57 mutation and high Glc conditions additively caused a severe defect in small ribosomal subunit formation. The accumulation of abnormal pre-rRNA and resistance to protein synthesis-related antibiotics were observed in rh57 mutants and in the wild-type Col-0 under high Glc conditions. These results suggested that AtRH57 plays an important role in rRNA biogenesis in Arabidopsis and participates in response to sugar involving Glc- and ABA signaling during germination and seedling growth. © 2013 The Authors The Plant Journal © 2013 John Wiley & Sons Ltd.

  9. Ready for OR or not? Human reader supplements Eyesi scoring in cataract surgical skills assessment

    Directory of Open Access Journals (Sweden)

    Selvander M

    2013-10-01

    Full Text Available Madeleine Selvander,1,2 Peter Åsman11Department of Clinical Sciences, Malmö: Ophthalmology, Lund University, Malmö, Sweden; 2Practicum Clinical Skills Centre, Skåne University Hospital, Malmö, SwedenPurpose: To compare the internal computer-based scoring with human-based video scoring of cataract modules in the Eyesi virtual reality intraocular surgical simulator, a comparative case series was conducted at the Department of Clinical Sciences – Ophthalmology, Lund University, Skåne University Hospital, Malmö, Sweden.Methods: Seven cataract surgeons and 17 medical students performed one video-recorded trial with each of the capsulorhexis, hydromaneuvers, and phacoemulsification divide-and-conquer modules. For each module, the simulator calculated an overall score for the performance ranging from 0 to 100. Two experienced masked cataract surgeons analyzed each video using the Objective Structured Assessment of Cataract Surgical Skill (OSACSS for individual models and modified Objective Structured Assessment of Surgical Skills (OSATS for all three modules together. The average of the two assessors' scores for each tool was used as the video-based performance score. The ability to discriminate surgeons from naive individuals using the simulator score and the video score, respectively, was compared using receiver operating characteristic (ROC curves.Results: The ROC areas for simulator score did not differ from 0.5 (random for hydromaneuvers and phacoemulsification modules, yielding unacceptably poor discrimination. OSACSS video scores all showed good ROC areas significantly different from 0.5. The OSACSS video score was also superior compared to the simulator score for the phacoemulsification procedure: ROC area 0.945 vs 0.664 for simulator score (P = 0.010. Corresponding values for capsulorhexis were 0.887 vs 0.761 (P = 0.056 and for hydromaneuvers 0.817 vs 0.571 (P = 0.052 for the video scores and simulator scores, respectively.The ROC

  10. The FLUKA code: developments and challenges for high energy and medicalapplications

    Czech Academy of Sciences Publication Activity Database

    Böhlen, T.T.; Cerutti, F.; Chin, M.P.W.; Fasso, Alberto; Ferrari, A.; Ortega, P.G.; Mairani, A.; Sala, P.R.; Smirnov, G.; Vlachoudis, V.

    2014-01-01

    Roč. 120, Jul (2014), s. 211-214 ISSN 0090-3752 Institutional support: RVO:68378271 Keywords : FLUKA * radioprotection * beams * ions Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 4.571, year: 2014

  11. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 571 - 580 of 8491 ... Tech goodies versus tech power : power analysis as a tool for ICTD research and project design; learning clinic from IT for Change. Published date. January 1, 2009. Studies ...

  12. An investigation of suitable bag materials for the collection and storage of breath samples containing hydrogen cyanide

    Czech Academy of Sciences Publication Activity Database

    Gilchrist, F. J.; Razavi, C.; Webb, A. K.; Jones, A.M.; Španěl, Patrik; Smith, D.; Lenney, W.

    2012-01-01

    Roč. 6, č. 3 (2012), 036004 ISSN 1752-7155 Institutional support: RVO:61388955 Keywords : tube mass spectrometry * cystic fibrosis * pseudomonas aeruginosa Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.571, year: 2012

  13. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 1804 ... Understanding Women's Experiences in Artisanal and Small Scale ... and consumption in many South Asian countries, such as India, remains low. ... The region has poorly developed distribution and retail networks.

  14. Blastocyst development in single medium with or without renewal on day 3: a prospective cohort study on sibling donor oocytes in a time-lapse incubator.

    Science.gov (United States)

    Costa-Borges, Nuno; Bellés, Marta; Meseguer, Marcos; Galliano, Daniela; Ballesteros, Agustin; Calderón, Gloria

    2016-03-01

    To evaluate the efficiency of using a continuous (one-step) protocol with a single medium for the culture of human embryos in a time-lapse incubator (TLI). Prospective cohort study on sibling donor oocytes. University-affiliated in vitro fertilization (IVF) center. Embryos from 59 patients. Culture in a TLI in a single medium with or without renewal of the medium on day-3. Embryo morphology and morphokinetic parameters, clinical pregnancy, take-home baby rate, and perinatal outcomes. The blastocyst rates (68.3 vs. 66.8%) and the proportion of good-quality blastocysts (transferred plus frozen) obtained with the two-step (80.0%) protocol were statistically significantly similar to those obtained in the one-step protocol (72.2%). Similarly, morphokinetic events from early cleavage until late blastocyst stages were statistically significantly equivalent between both groups. No differences were found either in clinical pregnancy rates when comparing pure transfers performed with embryos selected from the two-step (75.0%), one-step (70.0%, respectively), and mixed (57.1%) groups. A total of 55 out of 91 embryos transferred implanted successfully (60.4%), resulting in a total of 37 newborns with a comparable birth weight mean among groups. Our findings support the idea that in a TLI with a controlled air purification system, human embryos can be successfully cultured continuously from day 0 onward in single medium with no need to renew it on day-3. This strategy does not affect embryo morphokinetics or development to term and offers more stable culture conditions for embryos as well as practical advantages and reduced costs for the IVF laboratory. Copyright © 2016 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.

  15. Injection of deuterated water into the pulmonary/alveolar circulation; measurement of HDO in exhaled breath and implications to breath analysis

    Czech Academy of Sciences Publication Activity Database

    Tan, B. K.; Davies, S. J.; Španěl, Patrik; Smith, D.

    2012-01-01

    Roč. 6, č. 3 (2012), 036005 ISSN 1752-7155 Institutional support: RVO:61388955 Keywords : total body water * afterglow mass spectrometry * deuterium abundance Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.571, year: 2012

  16. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 1119 ... ADAPTIVE CAPACITY AGRICULTURAL POLICY Food security ... Growing business of growing in the city : IDRC supports urban ... Studies suggest that Sudan is facing significant threats in terms of food security, ...

  17. The application of differential scanning calorimetry and ice nucleation spectrometry to ecophysiological studies of algae

    Czech Academy of Sciences Publication Activity Database

    Worland, M. R.; Lukešová, Alena

    2001-01-01

    Roč. 123, - (2001), s. 571-583 ISSN 1438-9134 Institutional research plan: CEZ:AV0Z6066911 Keywords : Antarctic * cold tolerance * terrestrial algae Subject RIV: EH - Ecology, Behaviour Impact factor: 0.488, year: 2000

  18. Changes in oxidative enzyme activity during interspecific mycelial interactions involving the white-rot fungus Trametes versicolor

    Czech Academy of Sciences Publication Activity Database

    Hiscox, J.; Baldrian, Petr; Rogers, H. J.; Boddy, L.

    2010-01-01

    Roč. 47, č. 6 (2010), s. 562-571 ISSN 1087-1845 Institutional research plan: CEZ:AV0Z50200510 Keywords : Interactions * Basidiomycetes * Trametes Subject RIV: EE - Microbiology, Virology Impact factor: 3.333, year: 2010

  19. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 875 ... The World Health Organization's Global Burden of Disease study predicts that non-communicable diseases linked to obesity will create the greatest ... Empowering Health Care Decision-makers to Achieve Regional ...

  20. Hemochromatosis

    Science.gov (United States)

    ... care provider sends the liver sample to a pathology lab where the pathologist—a doctor who specializes ... Journal of Pediatrics. 2009;155(4):566–571. March 2014 Share This content is provided as a ...

  1. Discovering MicroRNAs and Their Targets in Plants

    Czech Academy of Sciences Publication Activity Database

    Mishra, Ajay Kumar; Duraisamy, Ganesh Selvaraj; Matoušek, Jaroslav

    2015-01-01

    Roč. 34, č. 6 (2015), s. 553-571 ISSN 0735-2689 Institutional support: RVO:60077344 Keywords : computational methods * degradome * high-throughput approaches Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.810, year: 2015

  2. International Law Studies. The War in Iraq: A Legal Analysis. Violume 86

    Science.gov (United States)

    2010-01-01

    ment in the Security Council debates concerning Iraq on a "strict constructionist " approach to thejus ad bellum. That is, the strict limits on the use...discrimination solely on the ground of race, colour, sex, language, religion or social origin. 73. DlNSTEIN, supra note 41, at 72. 74. Thomas Buergenthal, To...Bacteriological Methods ofWarfare, June 17, 1925, 26 U.S.T. 571, T.I.A.S. 8061, reprinted in DOCUMENTS ON THE LAWS OF WAR, supra, at 158 (Iraq made statements

  3. CW laser properties of Nd:GdYAG, Nd:LuYAG, and Nd:GdLuAG mixed crystals

    Science.gov (United States)

    Di, J. Q.; Xu, X. D.; Li, D. Z.; Zhou, D. H.; Wu, F.; Zhao, Z. W.; Xu, J.; Tang, D. Y.

    2011-10-01

    Three mixed crystals, Nd:GdYAG, Nd:LuYAG, and Nd:GdLuAG, were grown by Czochralski method. We report the continuous-wave (CW) Nd:GdYAG, Nd:LuYAG, and Nd:GdLuAG laser operation under laser diode pumping. The maximum output powers are 4.11, 5.31, and 7.47 W, with slope efficiency of 73.0, 55.3, and 57.1%, respectively. With replacing Lu3+ or Y3+ ions with large Gd3+ ions, the pump efficiency increases.

  4. Safety and efficacy of adapalene gel 0.1% in acne vulgaris: Results of a post-marketing surveillance study

    Directory of Open Access Journals (Sweden)

    Percy S

    2003-07-01

    Full Text Available Introduction: Adapalene is a novel retinoid indicated for the topical treatment of acne vulgaris. The drug was introduced in India in 2001. Aims: A post-marketing surveillance study was conducted to assess the safety and efficacy of adapalene gel 0.1% when used as monotherapy or in combination with other anti-acne agents in Indian patients of acne vulgaris. Material and Methods: A 12-week, multicentre, open-label, non-comparative study involving 571 patients from 21 centers across India was conducted between January and September of 2002. Concomitant prescription of other anti-acne drugs was permitted, if needed. Results: Of the 571 patients, 441 completed the treatment as per protocol. At the end of therapy, 96.3% of patients showed an improvement in their acne from baseline, with greater than 75% improvement seen in two-thirds of patients. Adverse events were reported in 24% of the patients, none of which were serious. The tolerability of therapy was rated as excellent/good in 81% of patients by physicians and in 78% by the patients. Conclusion: Adapalene gel 0.1% is a safe and effective topical agent in the treatment of mild to moderate acne vulgaris in Indian patients. It may be safely combined with other topical and oral anti-acne agents.

  5. Hospitalized Patients' Perceptions of Resident Fatigue, Duty Hours, and Continuity of Care.

    Science.gov (United States)

    Drolet, Brian C; Hyman, Charles H; Ghaderi, Kimeya F; Rodriguez-Srednicki, Joshua; Thompson, Jordan M; Fischer, Staci A

    2014-12-01

    Physicians' perceptions of duty hour regulations have been closely examined, yet patient opinions have been largely unstudied to date. We studied patient perceptions of residency duty hours, fatigue, and continuity of care following implementation of the Accreditation Council for Graduate Medical Education 2011 Common Program Requirements. A cross-sectional survey was administered between June and August 2013 to inpatients at a large academic medical center and an affiliated community hospital. Adult inpatients on teaching medical and surgical services were eligible for inclusion in the study. Survey response rate was 71.3% (513 of 720). Most respondents (57.1%, 293 of 513) believed residents should not be assigned to shifts longer than 12 hours, and nearly half (49.7%, 255 of 513) wanted to be notified if a resident caring for them had worked longer than 12 hours. Most patients (63.2%, 324 of 513) believed medical errors commonly occurred because of fatigue, and fewer (37.4%, 192 of 513; odds ratio, 0.56; P care. Given the choice between a familiar physician who "may be tired from a long shift" or a "fresh" physician who had received sign-out, more patients chose the fresh but unfamiliar physician (57.1% [293 of 513] versus 42.7% [219 of 513], P care.

  6. Maternal and Perinatal Outcomes among Eclamptic Patients ...

    African Journals Online (AJOL)

    , pulmonary oedema (10.5%), maternal stroke (8.8%), HELLP syndrome (50.9%), and Disseminated Intravascular Coagulopathy (3.5%). Perinatal deaths were caused by prematurity (42.9%) and birth asphyxia (57.1%). Forty-eight babies had ...

  7. Foreign bank entry, bank efficiency and market power in Central and Eastern European Countries

    Czech Academy of Sciences Publication Activity Database

    Poghosyan, T.; Poghosyan, Arsen

    2010-01-01

    Roč. 18, č. 3 (2010), s. 571-598 ISSN 0967-0750 Institutional research plan: CEZ:MSM0021620846 Keywords : foreign bank entry * bank efficiency * market power Subject RIV: AH - Economics Impact factor: 0.536, year: 2010

  8. Prevalence of musculoskeletal pain and factors associated with ...

    African Journals Online (AJOL)

    EPHA USER33

    with kyphosis among pedestrian back-loading women in Bench-Maji zone. Methods: The study was ... prevalence of work related musculoskeletal disorder was 57.1%. ..... local government to empower women and search for other source of ...

  9. Quality Assurance of the Cross-sections Measured on p+Li/C Source

    Czech Academy of Sciences Publication Activity Database

    Majerle, Mitja; Bém, Pavel; Novák, Jan; Šimečková, Eva; Štefánik, Milan; Simakov, S.; Fischer, U.

    2014-01-01

    Roč. 119, MAY (2014), s. 425-428 ISSN 0090-3752 Institutional support: RVO:61389005 Keywords : cross section * neutron beam * irradiation Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 4.571, year: 2014

  10. Investigation into the effects of using two or four acupuncture needles with bidirectional rotation on experimentally-induced contact heat pain in healthy subjects.

    Science.gov (United States)

    Paley, Carole A; Johnson, Mark I

    2015-02-01

    There is growing evidence from experimental studies that the acupuncture dose or technique influences the speed of onset of hypoalgesia. The aim of this study was to investigate the effects of acupuncture using two or four needles on experimental contact thermal pain in healthy volunteers. Forty two participants were randomised into three groups: four-needle group (LI4, LI11, LI10, TE5), two-needle group (verum at LI4, LI11 and mock at LI10, TE5) and mock acupuncture group (LI4, LI11, LI10, TE5). Each participant rated pain intensity (visual analogue scale, VAS) to a series of noxious stimuli administered to the forearm 2°C above the heat pain threshold during needling and immediately after removal of the needles. Experimentally-induced heat pain intensity (VAS) during and after the intervention was lower than pre-intervention but there were no statistically significant differences in this change between groups. There were no statistically significant differences between groups in the time taken for pain intensity to decrease by 33% from pre-intervention. However, a 33% decrease in pain intensity within 3 min of needle insertion was observed for 13 participants (92.9%) in the four-needle group compared with 66.7% of participants in the two-needle group and 57.1% in the mock acupuncture group. There was less variance in VAS in the four-needle group, suggesting more consistency in hypoalgesic response when using more needles. There is tentative evidence that four needles may be superior to two needles in generating rapid onset hypoalgesia. The findings suggest that further investigation is warranted. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  11. Publications | Page 58 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 6381 ... Through books, articles, research publications, and studies, we aim to ... Home · Resources ... Climate change will affect water availability in Chile, Colombia, and Bolivia, in the three basins this project is studying.

  12. H-theorems from macroscopic autonomous equations

    Czech Academy of Sciences Publication Activity Database

    De Roeck, W.; Maes, C.; Netočný, Karel

    2006-01-01

    Roč. 123, č. 3 (2006), s. 571-583 ISSN 0022-4715 Institutional research plan: CEZ:AV0Z10100520 Keywords : H-theorem, entropy * irreversible equations Subject RIV: BE - Theoretical Physics Impact factor: 1.437, year: 2006

  13. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 588 ... Home; Food, Environment, and Health .... It is difficult to assess the degree of enforcement of tobacco laws. ... curtains and water container covers for dengue vector control in Colombia : a cluster randomised trial.

  14. Decomposition patterns, nutrient availability, species identities and vegetation changes in central-European summit bogs

    Czech Academy of Sciences Publication Activity Database

    Jiroušek, M.; Tůma, I.; Záhora, J.; Holub, Petr; Kintrová, K.; Hájek, M.

    2015-01-01

    Roč. 20, č. 5 (2015), s. 571-586 ISSN 1239-6095 Institutional support: RVO:67179843 Keywords : atmospheric nitrogen deposition * boreal peatlands * nutritional constraints * litter decomposition Subject RIV: EH - Ecology, Behaviour Impact factor: 1.476, year: 2015

  15. The Role of Habits in Massive Multiplayer Online Role-Playing Game Usage: Predicting Excessive and Problematic Gaming Through Players' Sensitivity to Situational Cues

    Czech Academy of Sciences Publication Activity Database

    Lukavská, K.; Hrabec, O.; Chrz, Vladimír

    2016-01-01

    Roč. 19, č. 4 (2016), s. 277-282 ISSN 2152-2715 Institutional support: RVO:68081740 Keywords : Self-regulation * Internet Use * Addiction * Personality * Adolescents * Engagement * Behavior * Context Subject RIV: AN - Psychology Impact factor: 2.571, year: 2016

  16. Zizula hylax (Fabricius, 1775) new butterfly species for Socotra (Lepidoptera: Lycaenidae)

    Czech Academy of Sciences Publication Activity Database

    Fric, Zdeněk; Hula, V.

    2013-01-01

    Roč. 41, č. 164 (2013), s. 571-575 ISSN 0300-5267 Grant - others:MŠMT(CZ) INGO LA 10036 Institutional support: RVO:60077344 Keywords : Zizula hylax Subject RIV: EG - Zoology Impact factor: 0.304, year: 2013

  17. The Role of Habits in Massive Multiplayer Online Role-Playing Game Usage: Predicting Excessive and Problematic Gaming Through Players' Sensitivity to Situational Cues

    Czech Academy of Sciences Publication Activity Database

    Lukavská, K.; Hrabec, O.; Chrz, Vladimír

    2016-01-01

    Roč. 19, č. 4 (2016), s. 277-282 ISSN 2152-2715 Institutional support: RVO:68081740 Keywords : Self - regulation * Internet Use * Addiction * Personality * Adolescents * Engagement * Behavior * Context Subject RIV: AN - Psychology Impact factor: 2.571, year: 2016

  18. AUTHOR INDEX

    Indian Academy of Sciences (India)

    microscopic techniques for imaging cell ... Q-switched Yb-doped photonic crystal fibre laser ... Classical simulations of heavy-ion fusion .... functionalized graphene ... Li Hui-Jia see Hu Ke. 571. Lin Huini. Finite-time synchronization of a class of.

  19. Nurses’ Knowledge About Fecal Intestinal Ostomies’s Care: A Cross-Sectional Study

    Directory of Open Access Journals (Sweden)

    Maryam Bagheri

    2016-12-01

    Full Text Available Background Investigation of various aspects of care in ostomy patients is of clinical importance, as the level of knowledge and skills of nurses directly influences the quality of patient education and satisfaction with received care. Objectives The purpose of this study was to determine knowledge of nurses in general surgery wards regarding fecal intestinal ostomies. Methods This cross-sectional study was performed during year 2015 at teaching hospitals (Ghaem, Imam Reza and Omid hospitals affiliated to Mashhad University of Medical Sciences, Iran. We used census for sampling, and the study population included all nurses, who were working in intestinal ostomy surgery wards. Inclusion criteria were having an undergraduate degree in nursing and at least one-year work experience at the surgical ward. Data collection tools were a demographic information questionnaire and a researcher-made survey of “assessment of knowledge of nurses in ostomy care”. Data were analyzed using SPSS software version 11.5. Results Overall, 83.9% of participants were female and mean work experience at the surgical ward was 4.23 (SD = 3.73. More than half of the nurses gave incorrect answers to questions related to the use of powders and sprays associated with skin itching and sensitivity (64.3%, and how to care for ostomy with a rod (66.1%. Nurses also showed low and very low levels of knowledge on symptoms and control of obstruction (57.1%, change duration in the size of ostomy (66%, sexual intercourse (57.1%, colostomy complications (51.8% and ileostomy (57.1% and authorized or unauthorized activities (50% as well as how to perform bowel irrigation (75%. Conclusions According to the results of this study, the knowledge of nurses was not enough to provide primary care for ostomy; thus due to the importance of adequate knowledge and because of needs assessments, it is recommended for nursing managers to conduct retraining courses and other educational approaches for

  20. The combinatorial PP1-binding consensus Motif (R/Kx( (0,1V/IxFxx(R/Kx(R/K is a new apoptotic signature.

    Directory of Open Access Journals (Sweden)

    Angélique N Godet

    Full Text Available BACKGROUND: Previous studies established that PP1 is a target for Bcl-2 proteins and an important regulator of apoptosis. The two distinct functional PP1 consensus docking motifs, R/Kx((0,1V/IxF and FxxR/KxR/K, involved in PP1 binding and cell death were previously characterized in the BH1 and BH3 domains of some Bcl-2 proteins. PRINCIPAL FINDINGS: In this study, we demonstrate that DPT-AIF(1, a peptide containing the AIF(562-571 sequence located in a c-terminal domain of AIF, is a new PP1 interacting and cell penetrating molecule. We also showed that DPT-AIF(1 provoked apoptosis in several human cell lines. Furthermore, DPT-APAF(1 a bi-partite cell penetrating peptide containing APAF-1(122-131, a non penetrating sequence from APAF-1 protein, linked to our previously described DPT-sh1 peptide shuttle, is also a PP1-interacting death molecule. Both AIF(562-571 and APAF-1(122-131 sequences contain a common R/Kx((0,1V/IxFxxR/KxR/K motif, shared by several proteins involved in control of cell survival pathways. This motif combines the two distinct PP1c consensus docking motifs initially identified in some Bcl-2 proteins. Interestingly DPT-AIF(2 and DPT-APAF(2 that carry a F to A mutation within this combinatorial motif, no longer exhibited any PP1c binding or apoptotic effects. Moreover the F to A mutation in DPT-AIF(2 also suppressed cell penetration. CONCLUSION: These results indicate that the combinatorial PP1c docking motif R/Kx((0,1V/IxFxxR/KxR/K, deduced from AIF(562-571 and APAF-1(122-131 sequences, is a new PP1c-dependent Apoptotic Signature. This motif is also a new tool for drug design that could be used to characterize potential anti-tumour molecules.

  1. Effects of Whey Protein Alone or as Part of a Multi-ingredient Formulation on Strength, Fat-Free Mass, or Lean Body Mass in Resistance-Trained Individuals: A Meta-analysis.

    Science.gov (United States)

    Naclerio, Fernando; Larumbe-Zabala, Eneko

    2016-01-01

    with small extra gains in fat-free mass or lean body mass, resulting in an effect size of g = 0.301, 95% confidence interval (CI) 0.032-0.571. Subgroup analyses showed less clear positive trends resulting in small to moderate effect size g = 0.217 (95% CI -0.113 to 0.547) and g = 0.468 (95% CI 0.003-0.934) in favor of whey and multi-ingredient, respectively. Additionally, a positive overall extra effect was also observed to maximize lower (g = 0.316, 95% CI 0.045-0.588) and upper body maximal strength (g = 0.458, 95% CI 0.161-0.755). Subgroup analyses showed smaller superiority to maximize strength gains with respect to the contrast groups for lower body (whey protein: g = 0.343, 95% CI -0.016 to 0.702, multi-ingredient: g = 0.281, 95% CI -0.135 to 0.697) while in the upper body, multi-ingredient (g = 0.612, 95% CI 0.157-1.068) seemed to produce more clear effects than whey protein alone (g = 0.343, 95% CI -0.048 to 0.735). Studies involving interventions of more than 6 weeks on resistance-training individuals are scarce and account for a small number of participants. Furthermore, no studies with an intervention longer than 12 weeks have been found. The variation regarding the supplementation protocol, namely the different doses criteria or timing of ingestion also add some concerns to the studies comparison. Whey protein alone or as a part of a multi-ingredient appears to maximize lean body mass or fat-free mass gain, as well as upper and lower body strength improvement with respect to the ingestion of an iso-energetic equivalent carbohydrate or non-whey protein supplement in resistance-training individuals. This enhancement effect seems to be more evident when whey proteins are consumed within a multi-ingredient containing creatine.

  2. Bodipy-FL-Verapamil: A Fluorescent Probe for the Study of Multidrug Resistance Proteins

    Directory of Open Access Journals (Sweden)

    Anna Rosati

    2004-01-01

    Full Text Available Most of the substances used as fluorescent probes to study drug transport and the effect of efflux blockers in multidrug resistant cells have many drawbacks, such as toxicity, unspecific background, accumulation in mitochondria. New fluorescent compounds, among which Bodipy‐FL‐verapamil (BV, have been therefore proposed as more useful tools. The uptake of BV has been evaluated by cytofluorimetry and fluorescence microscopy using cell lines that overexpress P‐glycoprotein (P388/ADR and LLC‐PK1/ADR or MRP (multidrug resistance‐related protein (PANC‐1 and clinical specimens from patients. The effect of specific inhibitors for P‐glycoprotein (verapamil and vinblastine or MRP (MK571 and probenecid has been also studied. BV intracellular concentrations were significantly lower in the two P‐glycoprotein overexpressing cell lines in comparison with the parental lines. In addition, verapamil and vinblastine increased the intracellular concentrations of the dye; MK571 and probenecid, two MRP inhibitors, increased BV levels in PANC‐1 cells, that express this protein. These findings were confirmed in clinical specimens from patients. Fluorescence microscopy revealed a faint fluorescence emission in P‐glycoprotein or MRP expressing cell lines; however, treatment with specific inhibitors significantly increased the fluorescence. BV is a useful tool for studying multidrug resistance proteins with different techniques such as cytofluorimetry and fluorescence microscopy, but does not discriminate between P‐glycoprotein and MRP. In comparison with other classic fluorescent probes, the assay with this dye is extremely rapid, simple, not toxic for cells, devoid of fluorescent background, and can be useful in the clinical settings.

  3. Synthesis and photoluminescence properties of Sm3+-doped CaWO4 nanoparticles

    International Nuclear Information System (INIS)

    Xiao Qi; Zhou Qitao; Li Ming

    2010-01-01

    The Sm 3+ -doped CaWO 4 nanoparticles were synthesized by hydrothermal method. The room temperature photoluminescence (PL) spectra of Sm 3+ -doped CaWO 4 nanoparticles doped with different Sm 3+ concentrations under 405 nm excitation have been investigated. The PL spectra showed four strong emission peaks at 460, 571, 609, and 653 nm. The first emission peak at 460 nm could be due to a structural defect of the lattice, an oxygen-deficient WO 3 complex. The other three emissions at 571, 609, and 653 nm were due to the f-f forbidden transitions of the 4f electrons of Sm 3+ , corresponding to 4 G 5/2 → 6 H 5/2 (571 nm), 6 H 7/2 (609 nm), and 6 H 9/2 (653 nm), respectively. In addition, the optimum Sm 3+ concentration in CaWO 4 nanoparticles for optical emission was determined to be 1.0%. The Sm 3+4 G 5/2 → 6 H 7/2 (609 nm) emission intensity of Sm 3+ -doped CaWO 4 nanoparticles significantly increased with the increase of Sm 3+ concentration, and showed a maximum when Sm 3+ doping content was 1.0%. If Sm 3+ concentration continued to increase, namely more than 1.0%, the Sm 3+4 G 5/2 → 6 H 7/2 emission intensity would decrease. The present materials might be a promising phosphor for white-light LED applications.

  4. Seiklusfilme maalt ja merelt / Lauri Saaber

    Index Scriptorium Estoniae

    Saaber, Lauri

    2001-01-01

    Sõjafilm "U-571" : stsenarist ja režissöör Jonathan Mostow : Ameerika Ühendriigid 2000 ja mängufilm "Ülemine piir" ("Vertical Limit") : režissöör Martin Campbell : Ameerika Ühendriigid 2000

  5. Earth's dimension specified by geoidal geopotential

    Czech Academy of Sciences Publication Activity Database

    Burša, Milan; Groten, E.; Kenyon, S.; Kouba, J.; Raděj, K.; Vatra, V.; Vojtíšková, M.

    2002-01-01

    Roč. 46, č. 1 (2002), s. 1-8 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z1003909 Keywords : TOPEX/POSEIDON satellite * analyse Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.571, year: 2002

  6. Gas phase chemistry studies of transactinoid elements and the relativistic effects

    Czech Academy of Sciences Publication Activity Database

    Zvára, Ivo

    1999-01-01

    Roč. 49, č. 2 (1999), s. 563-571 ISSN 0011-4626 Institutional research plan: CEZ:AV0Z1048901 Keywords : transactinoid * relativistic effects * chemical properties Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.328, year: 1999

  7. A further assessment of Blanchard's typology of homosexual versus non-homosexual or autogynephilic gender dysphoria.

    Science.gov (United States)

    Nuttbrock, Larry; Bockting, Walter; Mason, Mona; Hwahng, Sel; Rosenblum, Andrew; Macri, Monica; Becker, Jeffrey

    2011-04-01

    In a series of important but now highly controversial articles, Blanchard examined associations of sexual orientation and transvestic fetishism among male-to-female (MTF) transgender persons in Toronto, Canada. Transvestic fetishism was rare among the homosexuals but prevalent among the non-homosexuals. Subtypes of non-homosexual MTFs (heterosexual, bisexual, and asexual) were consistently high with regard to transvestic fetishism. Non-linear associations of a continuous measurement of sexual attraction to women (gynephilia) and transvestic fetishism were interpreted in terms of an etiological hypothesis in which transvestic fetishism interferes with the early development of heterosexuality. Blanchard concluded that homosexual versus non-homosexual sexual orientation is a dominant and etiologically significant axis for evaluating and understanding this population. We further assessed these findings among 571 MTFs from the New York City metropolitan area. Using the Life Chart Interview, multiple measurements of transvestic fetishism were obtained and classified as lifetime, lifecourse persistent, adolescent limited, and adult onset. Large (but not deterministic) differences in lifetime, lifecourse persistent, and adolescent limited transvestic fetishism were found between the homosexuals and non-homosexuals. Contrary to Blanchard, differences in transvestic fetishism were observed across subtypes of the non-homosexuals, and linear (not curvilinear) associations were found along a continuous measurement of gynephilia and transvestic fetishism. Age and ethnicity, in addition to sexual orientation, were found to be statistically significant predictors of transvestic fetishism. The clinical, etiological, and sociopolitical implications of these findings are discussed.

  8. AUTHOR INDEX

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    lem: The case of dimension 3. 71. Hinz Andreas ... Ichinose Takashi. On the norm convergence of the self- ... Mirakjan operators on weighted spaces. 571 ... Kesavan S. On the limit matrix obtained in the ... A basic inequality for submanifolds in.

  9. The Neutrons for Science Facility at SPIRAL-2

    Czech Academy of Sciences Publication Activity Database

    Ledoux, X.; Avrigeanu, M.; Avrigeanu, V.; Bém, Pavel; Fischer, U.; Majerle, Mitja; Mrázek, Jaromír; Negoita, F.; Novák, Jan; Simakov, S. P.; Šimečková, Eva

    2014-01-01

    Roč. 119, MAY (2014), s. 353-356 ISSN 0090-3752 Institutional support: RVO:61389005 Keywords : SPIRAL-2 * Neutron For Science * time-of-flight Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 4.571, year: 2014

  10. Drug: D08669 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 571 ... Nicotinic cholinergic receptor partial agonist Other ... DG01718 ... Drugs for addictive disorder ... DG01715 ... Drugs for nicotine depend...ence ATC code: N07BA03 Chemical group: DG00995 ... Nicotine withdrawal CHRNA4/CHRNB2

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 501 - 550 of 571 ... Vol 12, No 4 (2010), The aetiology, management and clinical outcome of ... sensitivity and specificity of malaria case definition and attributable fraction ... The epidemiology and socio-economic impact of rift valley fever in ...

  12. Simulations to Evaluate Accuracy and Patient Dose in Neutron-Stimulated, Emission-Computed Tomography (NSECT) for Diagnosis of Breast Cancer

    Science.gov (United States)

    2009-04-01

    10.000 Nitrogen 2.571 Calcium 1.429 Phosphorus 1.114 Potassium 0.200 Sulfur 0.200 Sodium 0.143 Chlorine 0.136 Magnesium 0.027 Iron 0.006 Fluorine 0.004...line in Fig. 4). The energy spectrum for events falling within the Acci- dental gate is shown in Fig. 5. As can be seen, there is some C.E. Floyd Jr...nucleotide excision repair (e.g., As, Cd, Co, Mg and Zn) or toxicity at high levels (e.g., Cu, Se, Sb) [5], [9]. Unfortunately, current methods for

  13. Medical Surveillance Monthly Report (MSMR). Volume 23, Number 5, May 2016

    Science.gov (United States)

    2016-05-01

    Prevalences of postsurgical complications and eye disease were stratified by service branch, sex , age, rank, deployment within 1 year after RS, and...ambulatory visit, or TMDS encounter. Uric acid nephrolithiasis was included in the first category, calculus of kid - ney and ureter, because there...795 5.6 518 3.7 456 3.3 315 2.4 258 2.0 -64.6 Sex Female 5,571 55.2 1,303 63.8 1,157 57.3 1,081 53.5 1,026 51.1 1,004 50.4 -21.0 Male 31,053 53.7

  14. Primary breast lymphoma: A single-institute experience in Taiwan

    Directory of Open Access Journals (Sweden)

    Che-Wei Ou

    2014-10-01

    Full Text Available Background: Breast is an uncommon location of lymphoma involvement. The most common type of primary breast lymphoma (PBL is diffuse large B-cell lymphoma (DLBCL. Rituximab is the widely used monoclonal antibody against CD20+ B-cell lymphoma, especially DLBCL. We aimed to analyze the clinical features, prognostic factors, and treatment outcome with or without rituximab in primary breast DLBCL. Methods: We retrospectively analyzed patients diagnosed with PBL from October 1987 to March 2012 in our hospital, excluding metastasis by whole-body computed tomography and bone marrow study. Results: Twenty-three patients were diagnosed with PBL. All were females. Eighteen patients were stage IE and five were stage IIE according to the Ann Arbor staging system. Two patients had lymphoma other than DLBCL. The median age of primary breast DLBCL patients was 48 years (range 27-79. Two were excluded from the analysis due to refusal or ineligibility for chemotherapy. No significant prognostic factor was found. Patients receiving chemotherapy with (RC or without (C rituximab were not significantly different in the 5-year overall survival (RC: 57.1%; C: 58.3%; p = 0.457 or progression-free survival (RC: 57.1%; C: 50.0%; p = 0.456. A high incidence of relapse in the central nervous system (CNS (17.6% was observed. Conclusions: In accordance with prior literature reports, our Taiwanese cohort of primary breast DLBCL seemed younger than those reported in Japan, Korea, and Western societies. Relapse in the CNS was not uncommon. The benefit of rituximab in addition to chemotherapy was not statistically significant. Treatment modality remained to be defined by further large-scale studies.

  15. Hysterectomy with radiotherapy or chemotherapy or both for women with locally advanced cervical cancer.

    Science.gov (United States)

    Kokka, Fani; Bryant, Andrew; Brockbank, Elly; Powell, Melanie; Oram, David

    2015-04-07

    and recurrence-free survival at 3 years between chemoradiotherapy and hysterectomy versus chemoradiotherapy alone (low quality evidence). Adverse events and morbidity data were not reported.Similarly, another trial (N = 211) found no difference in the risk of death (HR 0.65, 95% CI 0.35 to 1.21, P value = 0.19, low quality evidence), disease progression (HR 0.70, 95% CI 0.31 to 1.34, P value = 0.24, low quality evidence) or severe late complications (P value = 0.53, low quality evidence) between women who received internal radiotherapy versus hysterectomy after both groups had received external-beam chemoradiotherapy.Meta analysis of three trials of neoadjuvant chemotherapy and hysterectomy versus radiotherapy alone, assessing 571 participants, found that women who received neoadjuvant chemotherapy plus hysterectomy had less risk of death than those who received radiotherapy alone (HR 0.71, 95% CI 0.55 to 0.93, I(2) = 0%, moderate quality evidence). However, a significant number of the participants that received neoadjuvant chemotherapy plus hysterectomy had radiotherapy as well. There was no difference in the proportion of women with disease progression or recurrence between the two groups (RR 0.75, 95% CI 0.53 to 1.05, I(2) = 20%, moderate quality evidence).Results of single trials reported no apparent (P value > 0.05) difference in long-term severe complications, grade 3 acute toxicity and severe late toxicity between the two groups (low quality evidence).Quality of life outcomes were not reported in any of the trials. From the available RCTs, we found insufficient evidence that hysterectomy with radiotherapy, with or without chemotherapy, improves the survival of women with locally advanced cervical cancer who are treated with radiotherapy or chemoradiotherapy alone. The overall quality of the evidence was variable across the different outcomes and was universally downgraded due to concerns about risk of bias. The quality of the evidence for neoadjuvant

  16. 2014 Suwannee River Water Management District Lidar: Cooks Hammock (FL)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Light Detection and Ranging (LiDAR) dataset is a survey of the Suwannee River G14PD00206 0.7 Meter LiDAR Survey in central Florida and encompasses 571 square...

  17. Firehose constraints of the bi-Kappa-distributed electrons: a zero-order approach for the suprathermal electrons in the solar wind

    Czech Academy of Sciences Publication Activity Database

    Lazar, M.; Shaaban, S. M.; Poedts, S.; Štverák, Štěpán

    2017-01-01

    Roč. 464, č. 1 (2017), s. 564-571 ISSN 0035-8711 Institutional support: RVO:67985815 Keywords : instabilities * plasmas * analytical methods Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016

  18. Female silkworms have the sex factor

    Czech Academy of Sciences Publication Activity Database

    Marec, František

    2014-01-01

    Roč. 509, č. 7502 (2014), s. 570-571 ISSN 0028-0836 Institutional support: RVO:60077344 Keywords : Bombyx mori * chromosome * silkworms Impact factor: 41.456, year: 2014 http://www.nature.com/nature/journal/v509/n7502/full/nature13336.html

  19. Obturator Hernia: diagnosis and management under conditions of ...

    African Journals Online (AJOL)

    85.7%) underwent full resection and anastomosis, and one (14.3%) had partial resection. Hernia defect was closed in four (57.1%). Wound infection was common (71.4%) and three (43%) died. Conclusion: Obturator hernia is mainly a disease ...

  20. Immediate unidirectional epigenetic reprogramming of NORs occurs independently of rDNA rearrangements in synthetic and natural forms of a polyploid species Brassica napus

    Czech Academy of Sciences Publication Activity Database

    Książczyk, T.; Kovařík, Aleš; Eber, F.; Huteau, V.; Crhák Khaitová, Lucie; Tesaříková, Zuzana; Coriton, O.; Chevre, A.-M.

    2011-01-01

    Roč. 120, č. 6 (2011), s. 557-571 ISSN 0009-5915 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : allopolyploidy * ribosomal RNA * expression Subject RIV: BO - Biophysics Impact factor: 3.847, year: 2011

  1. Apolipoprotein E Genotype and educational attainment predict the rate of cognitive decline in normal aging? A 12-year follow-up of the Maastricht Aging Study

    NARCIS (Netherlands)

    van Gerven, P.W.; van Boxtel, M.P.J.; Bekers, O.; Ausems, E.E.B.; Jolles, J.

    2012-01-01

    Objective: We investigated suspected longitudinal interaction effects of apolipoprotein E (APOE) genotype and educational attainment on cognitive decline in normal aging. Method: Our sample consisted of 571 healthy, nondemented adults aged between 49 and 82 years. Linear mixed-models analyses were

  2. The Role of Platelet-Derived Growth Factor C and Its Splice Variant in Breast Cancer

    Science.gov (United States)

    2012-02-01

    epithelial-mesenchymal transition leading instead to apoptosis (8). Furthermore, inhibition of PDGFR signaling by the PDGFR inhibitor STI571...PDGFRs are expressed in many different cell types including endothelial, epithelial and neural cells and are necessary for embryological development (as

  3. Geomagnetic activity and the global temperature

    Czech Academy of Sciences Publication Activity Database

    Bucha, Václav

    2009-01-01

    Roč. 53, č. 4 (2009), s. 571-573 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : global warming * Southern Oscillation * geomagnetic storms Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.000, year: 2009

  4. Modelling and characterisation of surface plasmon based sensors for the detection of E. coli

    Czech Academy of Sciences Publication Activity Database

    Rajarajan, M.; Dar, T.; Themistos, Ch.; Rahman, A.; Grattan, K.; Homola, Jiří

    2009-01-01

    Roč. 56, č. 4 (2009), s. 564-571 ISSN 0950-0340 Institutional research plan: CEZ:AV0Z20670512 Keywords : SPR sensor * long-range surface plasmon * bacterium Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.942, year: 2009

  5. Avaliação do enraizamento, desenvolvimento de raízes e parte aérea de porta-enxertos de videira em condições de campo Evaluation of rooting, development of roots and shoot biomass from rootstock of grapevine, in field conditions

    Directory of Open Access Journals (Sweden)

    Marco Antonio Tecchio

    2007-12-01

    Full Text Available Objetivou-se neste trabalho avaliar o enraizamento, a brotação e o desenvolvimento de raízes de diferentes porta-enxertos de videira em condições de campo. Estacas lenhosas dos porta-enxertos '420 A', 'Golia', '5C', '8B', 'RR101-14', 'SO4', '99R', 'Kober 5BB', 'IAC 766', 'IAC 572', 'IAC 571-6', 'Ripária do Traviú' e 'Rupestris du Lot' foram colocadas em canteiro de terra, sem tratamento prévio. O delineamento foi em blocos ao acaso, com cinco repetições e vinte estacas por parcela, com as estacas dispostas em espaçamento de 12 x 5cm. As estacas foram colocadas para enraizar no início de julho e removidas no final de setembro para as avaliações. A porcentagem de estacas enraizadas variou de 79% para 'Ripária do Traviú' a 99% para o 'RR101-14'. Quanto à brotação, o 'Ripária do Traviú' apresentou 47%, 'IAC 571-6', 'IAC 572', '420 A', 'Rupestris du Lot', 'Kober', 'IAC 766', '8B', '5C', apresentaram de 76 a 89% e 'Golia', 'SO4', '99R' e 'RR 101-14' mais de 90%. 'IAC 572' e 'IAC 571-6' apresentaram o menor número de raízes por estaca, no entanto, foram as que apresentaram raízes mais desenvolvidas, seguidas pelo '5C' e 'Rupestris du Lot'. 'Kober 5BB' e 'Ripária do Traviú' apresentaram as raízes menos desenvolvidas. As demais variedades apresentaram valores intermediários. Concluiu-se que, entre todos os porta-enxertos, o 'Ripária do Traviú' apresentou os menores índices de enraizamento e brotação das estacas, nas condições de campo.The goals of this investigation was to evaluate the rooting, budding and development of roots from different rootstock of grapevine, in field conditions. Ligneous cutting of rootstock '420 A', 'Golia', '5C', '8B', 'RR101-14', 'SO4', '99R', 'Kober 5BB', 'IAC 766', 'IAC 572', 'IAC 571-6', 'Ripária do Traviú' and 'Rupestris du Lot' were planted in soil, without previous preparation. The experimental design was done in randomized blocks, with five repetitions and twenty cutting per plot

  6. 49 CFR 571.122 - Standard No. 122; Motorcycle brake systems.

    Science.gov (United States)

    2010-10-01

    ... cover, seal, and cover retention device. Each reservoir shall have a minimum capacity equivalent to one... capacity and retention device. (e) Master cylinder label for compliance with S5.1.2.2. Table I—Stopping..., 1974) at 40 mph, omitting water delivery as specified in paragraphs 7.1 and 7.2 of that method...

  7. 12 CFR 571.82 - Duties of users regarding address discrepancies.

    Science.gov (United States)

    2010-01-01

    ... CREDIT REPORTING Duties of Users of Consumer Reports Regarding Address Discrepancies and Records Disposal... consumer reports (user) that receives a notice of address discrepancy from a consumer reporting agency... consumer report and the address(es) in the agency's file for the consumer. (c) Reasonable belief—(1...

  8. 49 CFR 571.213 - Standard No. 213; Child restraint systems.

    Science.gov (United States)

    2010-10-01

    ... vehicle seat cushion and vehicle seat back. (b) Harnesses manufactured for use on school bus seats must... humidity between 48 and 67 percent, and any ambient temperature between 70° and 77 °F. Measure belt webbing...

  9. 57.1% of Unmarried Women Undergoing Abortion Have RTI:Survey

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    A survey of 2,002 unmarried women under 24 years of age who requested abortions in four Chinese cities indicates that reproductive tract infection (RTI) has become a major factor affecting the reproductive health of unmarried women having abortions.

  10. 49 CFR 571.208 - Standard No. 208; Occupant crash protection.

    Science.gov (United States)

    2010-10-01

    ... September 1, 1996. S4.1.5.1Frontal/angular automatic protection system. (a) Each passenger car manufactured... active and passive restraint systems. S3. Application. (a) This standard applies to passenger cars... cars. S4.1.1Passenger cars manufactured from January 1, 1972, to August 31, 1973. Each passenger car...

  11. SU-E-T-571: Microdosimetric Characterization of Proton Biological Effectiveness

    Energy Technology Data Exchange (ETDEWEB)

    Guardiola, C; Carabe-Fernandez, A; Tuttle, S [Hospital of the University of Pennsylvania, Philadelphia, PA (United States)

    2014-06-01

    Purpose: The knowledge of cell repair kinetics is critical in order to understand relevant aspects of proton therapy such optimal fractionation. High LET radiation induces larger proportions of more complex DSBs that might not be resolved in standard interfractional times (24h). We propose a method to characterize the cell repair kinetic at different positions within the spread-out Bragg peak (i.e. as a function of proton LETd) and use this information to model normal tissue complication probabilities (NTCP) as a function of LETd Methods: Repair kinetics curves will be obtained using U251-glioblastoma cells plating over microscope slides that are immersed in culture-medium that will be exposed along the axis of a proton-beam (10cm in range, 2cm modulation) of 1Gy. Culture is immersed within a solid-water block to place the distal edge of the proton-beam within the slide. gamma-H2AX foci along the slide in the beam axis is imaged with a microscope at different positions in order to correlate number of gamma-H2AX foci with dose and LET, where dose is obtained from a strip of gafchromic film placed on the side of the slide. Each slide is fixed at different time points. Results: We will present the correlation between an increase of LET and the increase of the gamma-H2AX along the depth within the proton beam, at different post-irradiation times and doses. Different fractions of unrepaired damage at 24h after irradiation will be presented at each depth of the proton beam, with larger fractions at the distal edge of the beam, where normal tissue exist. Larger values of NTCP are therefore observed at the distal edge. Conclusion: Slower repair kinetics is observed at the distal edge of a proton beam, and this study shows a method to obtain such information and the correlation between increased LET and increased NTCP. This research is supported by the Department of Radiation Oncology at the Hospital of the University of Pennsylvania as a pilot project.

  12. 49 CFR 571.500 - Standard No. 500; Low-speed vehicles.

    Science.gov (United States)

    2010-10-01

    ... replacement of any component is allowed after the start of the first performance test. S6.3.3. Tire inflation.... General test conditions. Each vehicle must meet the performance limit specified in S5(a) under the... standard reference test tire that meets the specifications of American Society for Testing and Materials...

  13. 49 CFR 571.223 - Standard No. 223; Rear impact guards.

    Science.gov (United States)

    2010-10-01

    ... frame rails of certain spacing and gauge of steel). (b) A description of the chassis surface to which... this standard is to reduce the number of deaths and serious injuries that occur when light duty... installation instructions in S5.5 of this section. Chassis means the load supporting frame structure of a motor...

  14. 49 CFR 571.124 - Standard No. 124; Accelerator control systems.

    Science.gov (United States)

    2010-10-01

    ... and injuries resulting from engine overspeed caused by malfunctions in the accelerator control system..., respectively. S5. Requirements. The vehicle shall meet the following requirements when the engine is running...

  15. 49 CFR 571.209 - Standard No. 209; Seat belt assemblies.

    Science.gov (United States)

    2010-10-01

    ... seat belt assembly to fit the user, including such hardware that may be integral with a buckle... the proper use of the assembly, stressing particularly the importance of wearing the assembly snugly... of Standard No. 208. (a)(1) A manual seat belt assembly, which is subject to the requirements of S5.1...

  16. A Further Assessment of Blanchard’s Typology of Homosexual Versus Non-Homosexual or Autogynephilic Gender Dysphoria

    Science.gov (United States)

    Bockting, Walter; Mason, Mona; Hwahng, Sel; Rosenblum, Andrew; Macri, Monica; Becker, Jeffrey

    2010-01-01

    In a series of important but now highly controversial articles, Blanchard examined associations of sexual orientation and transvestic fetishism among male-to-female (MTF) transgender persons in Toronto, Canada. Transvestic fetishism was rare among the homosexuals but prevalent among the non-homosexuals. Subtypes of non-homosexual MTFs (heterosexual, bisexual, and asexual) were consistently high with regard to transvestic fetishism. Non-linear associations of a continuous measurement of sexual attraction to women (gynephilia) and transvestic fetishism were interpreted in terms of an etiological hypothesis in which transvestic fetishism interferes with the early development of heterosexuality. Blanchard concluded that homosexual versus non-homosexual sexual orientation is a dominant and etiologically significant axis for evaluating and understanding this population. We further assessed these findings among 571 MTFs from the New York City metropolitan area. Using the Life Chart Interview, multiple measurements of transvestic fetishism were obtained and classified as lifetime, lifecourse persistent, adolescent limited, and adult onset. Large (but not deterministic) differences in lifetime, lifecourse persistent, and adolescent limited transvestic fetishism were found between the homosexuals and non-homosexuals. Contrary to Blanchard, differences in transvestic fetishism were observed across subtypes of the non-homosexuals, and linear (not curvilinear) associations were found along a continuous measurement of gynephilia and transvestic fetishism. Age and ethnicity, in addition to sexual orientation, were found to be statistically significant predictors of transvestic fetishism. The clinical, etiological, and sociopolitical implications of these findings are discussed. PMID:20039113

  17. 77 FR 40082 - Certain Gaming and Entertainment Consoles, Related Software, and Components Thereof...

    Science.gov (United States)

    2012-07-06

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-745] Certain Gaming and Entertainment... gaming and entertainment consoles, related software, and components thereof by reason of infringement of... finally concluded that an industry exists within the United States that practices the '896, '094, '571...

  18. Vascular plants at extreme elevations in eastern Ladakh, northwest Himalayas

    Czech Academy of Sciences Publication Activity Database

    Dvorský, Miroslav; Altman, Jan; Kopecký, Martin; Chlumská, Zuzana; Řeháková, Klára; Janatková, Kateřina; Doležal, Jiří

    2015-01-01

    Roč. 8, č. 4 (2015), s. 571-584 ISSN 1755-0874 R&D Projects: GA ČR GA13-13368S Institutional support: RVO:67985939 Keywords : Changthang * elevation gradient * functional traits Subject RIV: EH - Ecology, Behaviour Impact factor: 2.349, year: 2015

  19. The role of maternal behavior in children's pretense during the second year of life

    Czech Academy of Sciences Publication Activity Database

    Marková, Gabriela; Legerstee, M.

    2015-01-01

    Roč. 34, APR-JUN (2015), s. 3-15 ISSN 0885-2014 R&D Projects: GA ČR GPP407/10/P610 Institutional support: RVO:68081740 Keywords : Maternal scaffolding * Pretense * imitation Subject RIV: AN - Psychology Impact factor: 1.571, year: 2015

  20. High-resolution record of the environmental response to climatic variations during the Last Interglacial-Glacial cycle in Central Europe: The loess-palaeosol sequence of Dolní Věstonice (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Antoine, P.; Rousseau, D.-D.; Degeai, J.-P.; Moine, O.; Lagroix, F.; Kreutzer, S.; Fuchs, M.; Hatté, Ch.; Gauthier, C.; Svoboda, J.; Lisá, Lenka

    2013-01-01

    Roč. 67, 1 May (2013), s. 17-38 ISSN 0277-3791 Institutional support: RVO:67985831 Keywords : loess palaeosol * Weichselian * Early-glacial * grain size * palaeopedology * OSL * organic carbon * environmental magnetism * malacology Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.571, year: 2013

  1. Resection of individually identified high-rate high-frequency oscillations region is associated with favorable outcome in neocortical epilepsy

    Czech Academy of Sciences Publication Activity Database

    Cho, J.R.; Koo, D.L.; Joo, E.Y.; Seo, D.W.; Hong, S.-Ch.; Jiruška, Přemysl; Hong, S.B.

    2014-01-01

    Roč. 55, č. 11 (2014), s. 1872-1883 ISSN 0013-9580 R&D Projects: GA MZd(CZ) NT14489 Institutional support: RVO:67985823 Keywords : epilepsy surgery * high-frequency oscillations * neocortical epilepsy Subject RIV: FH - Neurology Impact factor: 4.571, year: 2014

  2. Román o konci jedné epochy

    Czech Academy of Sciences Publication Activity Database

    Gilk, Erik

    2011-01-01

    Roč. 59, č. 4 (2011), s. 547-571 ISSN 0009-0468 R&D Projects: GA ČR GA405/06/0972 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Fuks, Ladislav Subject RIV: AJ - Letters, Mass-media, Audiovision

  3. Assessment of forest roads and firebreaks in Turkey

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-15

    Sep 15, 2009 ... 571 607 ha and the mean forest area burned per fire is 19.64 ha. Key words: Forest ... INTRODUCTION. Forest fires are one of the most disturbing factors affect- ... that are known to be at high risk of desertification. (UNCCD ...

  4. 75 FR 76692 - Federal Motor Vehicle Safety Standards; Small Business Impacts of Motor Vehicle Safety

    Science.gov (United States)

    2010-12-09

    ..., 510, 511, 512, 520, 523, 525, 526, and 571 [Docket No. NHTSA-2010-0159] Federal Motor Vehicle Safety Standards; Small Business Impacts of Motor Vehicle Safety AGENCY: National Highway Traffic Safety... that specifically relate to passenger cars, multipurpose passenger vehicles, trucks, buses, trailers...

  5. 78 FR 25041 - Endangered and Threatened Wildlife and Plants; Endangered Status for the Fluted Kidneyshell and...

    Science.gov (United States)

    2013-04-29

    ... hearing will be held at Virginia Highlands Community College, Learning Resource Center, 110 Opportunity... project proponent's administrative cost of each projected section 7 consultation: $1,524 per formal consultation and $571 per informal consultation. These costs do not represent significant impacts on small...

  6. Tomographic findings of gastric gastrointestinal stromal tumor: a 14-case study

    International Nuclear Information System (INIS)

    Pelandre, Gustavo Lemos; Djahjah, Maria Celia; Nobre, Luiz Felipe; Gasparetto, Emerson Leandro; Marchiori, Edson; Pereira, Bruno Vilhena; Valadao, Marcus; Linhares, Eduardo

    2008-01-01

    Objective: The purpose of this study was to describe the tomographic findings of gastric gastrointestinal stromal tumor. Materials and methods: Fourteen patients with histopathologically and immunohistochemically confirmed gastric gastrointestinal stromal tumors, who had already been submitted to computed tomography scans before the treatment, were evaluated in the period between January 1999 and December 2006. The following tomographic variables were analyzed: lesion topography, size/dimensions, homogeneity, contour, margins, morphology, pattern and intravenous contrast-enhancement intensity, growth pattern, invasion of adjacent organs, presence of ulceration, fistula, calcifications, mesenteric fat infiltration, lymphadenomegaly and presence of distant metastasis. Results: Tumors were found in the body (57.1%) or in the gastric fundus (42.9%), with sizes ranging between 6.0 cm and 23.0 cm (mean, 11.5 cm). Predominantly extra luminal growth was observed in 57.1% of cases and intra/extra luminal in 35.7%. Subtle contrast-enhancement was observed in 50%, moderate in 50%, and heterogeneous in 64.3% of cases. Additionally, central hypodensity was observed in 64.3%, invasion of adjacent organs in 42.9%, and hepatic metastasis in 7.2% of cases. Conclusion: In the present study, the majority of tumors were found in the gastric body, with an average size of 11.5 cm, presenting with central hypodensity, heterogeneous contrast-enhancement and predominantly extraluminal growth. (author)

  7. Alternative Sources of Biologically Active Substances

    Czech Academy of Sciences Publication Activity Database

    Běhal, Vladislav

    2003-01-01

    Roč. 48, č. 5 (2003), s. 563-571 ISSN 0015-5632 R&D Projects: GA ČR GA204/01/1004 Institutional research plan: CEZ:AV0Z5020903 Keywords : myxobacteria * pseudomonads * nocardias Subject RIV: EE - Microbiology, Virology Impact factor: 0.857, year: 2003

  8. Fine-scale population genetic structure and short-range sex-biased dispersal in a solitary carnivore, Lutra lutra

    Czech Academy of Sciences Publication Activity Database

    Quaglietta, L.; Fonseca, V. C.; Hájková, Petra; Mira, A.; Boitani, L.

    2013-01-01

    Roč. 94, č. 3 (2013), s. 561-571 ISSN 0022-2372 Institutional support: RVO:68081766 Keywords : conservation genetics * dispersal distances * Eurasian otter * isolation by distance * radiotracking * restricted gene flow * spatial relatedness structure * spatiotemporal scale Subject RIV: EG - Zoology Impact factor: 2.225, year: 2013

  9. Dicty_cDB: VFD746 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0558 LLC cDN... 572 e-162 BC099966_1( BC099966 |pid:none) Mus musculus dyskeratosis congenit... 572 e-161 FJ...236702_1( FJ236702 |pid:none) Sus scrofa dyskeratosis congenita ... 571 e-161 BC123284_1( BC123284 |pid:none

  10. nutritional profile and yield of oyster mushroom cultivated

    African Journals Online (AJOL)

    ACSS

    African Crop Science Journal by African Crop Science Society is licensed under a Creative ... Department of Crop and Soil Science, Faculty of Agriculture, University of Port-Harcourt, PMB 5323,. Choba, Rivers State ..... Bioscience Research ... Journal of. Association of Official Analytical Chemists. International 80: 571-579.

  11. Pollinator-induced twisting of flowers sidesteps floral architecture constraints

    Czech Academy of Sciences Publication Activity Database

    Bartoš, Michael; Janeček, Štěpán

    2014-01-01

    Roč. 24, č. 17 (2014), R793-R795 ISSN 0960-9822 R&D Projects: GA ČR(CZ) GAP505/11/1617 Institutional support: RVO:67985939 Keywords : bird-pollination * adaptation * reproductive barriers Subject RIV: EH - Ecology, Behaviour Impact factor: 9.571, year: 2014

  12. Preparation and Catalytic Evaluation of a Palladium Catalyst Deposited over Two-Dimensional Zeolite ITQ-2 Modified with N-Donor Groups

    Czech Academy of Sciences Publication Activity Database

    Štěpnička, P.; Křečková, P.; Semler, M.; Čejka, Jiří

    2014-01-01

    Roč. 640, 3-4 (2014), s. 571-576 ISSN 0044-2313 R&D Projects: GA ČR GA104/09/0561 Institutional support: RVO:61388955 Keywords : supported catalysts * Heck reaction * electron microscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.160, year: 2014

  13. 76 FR 10007 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); Public Meeting

    Science.gov (United States)

    2011-02-23

    ... contact Kari Fenske at SEDAR (See FOR FURTHER INFORMATION CONTACT) to request an invitation providing webinar access information. FOR FURTHER INFORMATION CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; e-mail: kari.fenske@safmc.net...

  14. 76 FR 77491 - Fisheries of the Gulf of Mexico and South Atlantic; Southeast Data, Assessment, and Review (SEDAR...

    Science.gov (United States)

    2011-12-13

    ... Kari H. Fenske at SEDAR (see FOR FURTHER INFORMATION CONTACT) to request an invitation providing webinar access information. FOR FURTHER INFORMATION CONTACT: Kari H. Fenske, SEDAR Coordinator, 4055 Faber Place, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; email: Kari.Fenske@safmc.net...

  15. 75 FR 42378 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); South Atlantic...

    Science.gov (United States)

    2010-07-21

    ... public. Those interested in participating should contact Kari Fenske at SEDAR. See FOR FURTHER... CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place Drive, Suite 201, North Charleston, SC 29405; (843) 571- 4366; kari.fenske@safmc.net . SUPPLEMENTARY INFORMATION: The Gulf of Mexico, South Atlantic...

  16. 76 FR 35856 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); Public Meeting

    Science.gov (United States)

    2011-06-20

    ... public. Those interested in participating should contact Kari Fenske at SEDAR (See FOR FURTHER... CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; e-mail: kari.fenske@safmc.net . SUPPLEMENTARY INFORMATION: Webinar Date Day Time...

  17. Amphioxus: the model system with a distinguished past and a very bright future Preface

    Czech Academy of Sciences Publication Activity Database

    Kozmik, Zbyněk

    2017-01-01

    Roč. 61, č. 10-12 (2017), s. 571-572 ISSN 0214-6282 Institutional support: RVO:68378050 Keywords : chordates, , * vertebrates * evolution Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.981, year: 2016

  18. Radiation affects binding of Fpg repair protein to an abasic site containing DNA

    Czech Academy of Sciences Publication Activity Database

    Gillard, N.; Běgusová, Marie; Castaing, B.; Spotheim-Maurizot, M.

    2004-01-01

    Roč. 162, č. 5 (2004), s. 566-571 ISSN 0033-7587 R&D Projects: GA AV ČR IAA1048103 Institutional research plan: CEZ:AV0Z1048901 Keywords : ionizing radiation * DNA * protein komplex Subject RIV: BO - Biophysics Impact factor: 3.208, year: 2003

  19. THE PLACE OF ENVIRONMENTAL PROTECTION IN THE ...

    African Journals Online (AJOL)

    GTP to advocate better environmental protection in the country in the years ..... energy sector implies, inter alia, using clean energy such as solar and wind ..... accelerate growth; creating the balance between economic development and .... Establishment Proclamation No 575, and Radiation Protection Proclamation No 571.

  20. Intense Pulsed Light (IPL) in Aesthetic Dermatology

    Science.gov (United States)

    Pytras, B.; Drozdowski, P.; Zub, K.

    2011-08-01

    Introduction. Newer and newer technologies have been widely developed in recent years due to increasing need for aesthetic medicine procedures. Less invasive methods of skin imperfection and time-related lesions removal, IPL (Intense Pulse Light) being one of them, are gaining more and more interest. The shorter the "downtime" for the patient is and the more efficient the procedure results, the more popular the method becomes. Materials and methods_Authors analyse the results of treatment of a 571 patients-group (501 women and 70 men) aged 5-72 years in the period: October 2006-August 2010. IPL™ Quantum (Lumenis Ltd.) device with 560 nm. cut-off filter was used. Results. The results were regarded as: very good, good or satisfying (%):Skin photoaging symptomes 37/40/23, Isolated facial dyschromia 30/55/25, Isolated facial erythema 62/34/4, Lower limbs teleangiectasia 12/36/52, Keratosis solaris on hands 100/-/-. Approximately half of the patients developed transitory erythema and 25%- transitory, mild, circumscribed oedema. Following undesirable effects were noted: skin thermal irritation (6,1% of the patients) and skin hypopigmentation (2% of the patients). Discussion. Results and post-treatment management proposed by authors are similar to those reported by other authors. Conclusions. Treatment results of the 571-patients group prove IPL to be a very efficient method of non-ablative skin rejuvenation. It turned out effective also in lower limbs teleangiectasia treatment. It presents low risk of transitory and mild side effects. Futhermore, with short or no downtime, it is well-tolerated by the patients.

  1. Distribution Frequency and Incidence of Seed-borne Pathogens of Some Cereals and Industrial Crops in Serbia

    Directory of Open Access Journals (Sweden)

    Jelena Lević

    2012-01-01

    Full Text Available A total of 41 species of fungi were isolated from seed samples of barley, maize, soybean,and sunflower collected at different locations in Serbia. The majority of detected speciesoccurred on barley (35 of 41 species or 87.8% comparing to soybean (17 of 41 species or41.5%, sunflower (16 of 41 species or 39.0% and maize (15 of 41 species or 36.9%. Speciesbelonging to genera Alternaria, Chaetomium, Epicoccum, Fusarium, Penicillium and Rhizopuswere present on seeds of all four plant species. Alternaria species were dominant on soybean,barley and sunflower seeds (85.7%, 84.7% and 76.9%. F. verticillioides and Penicilliumspp. were mainly isolated from maize seeds (100 and 92.3% respectively, while other specieswere isolated up to 38.5% (Chaetomium spp. and Rhizopus spp.. F. graminearum, F. proliferatum,F. poae and F. sporotrichioides were the most common Fusarium species isolatedfrom barley (51.1-93.3%, while on the soybean seeds F. oxysporum (71.4%, F. semitectum(57.1% and F. sporotrichioides (57.1% were prevalent. Frequency of Fusarium species onsunflower seeds varied from 7% (F. equiseti, F. graminearum, F. proliferatum and F. subglutinansto 15.4% (F. verticillioides. Statistically significant negative correlation (r = –0.678* wasdetermined for the incidence of F. graminearum and Alternaria spp., as well as, Fusarium spp.and Alternaria spp. (r = –0.614*, on barley seeds. The obtained results revealed that seedbornepathogens were present in most seed samples of important cereals and industrialcrops grown under different agroecological conditions in Serbia. Some of the identifiedfungi are potential producers of mycotoxins, thus their presence is important in termsof reduced food safety for humans and animals. Therefore, an early and accurate diagnosisand pathogen surveillance will provide time for the development and the applicationof disease strategies.

  2. Protection From Radiation Of Allied Health Professionals

    International Nuclear Information System (INIS)

    Medvedec, M.

    2015-01-01

    According to the Croatian legislators, but not to the International (ISCO-08) and National (NKZ-10) Standard Classification of Occupations, university degree health professionals are limited to those individuals who have health-orientated education gained at the School of Medicine, School of Dental Medicine, Faculty of Pharmacy and Biochemistry, and study programs of Speech and Language Pathology. All other clinical scientists are considered as university degree non-health professionals who participate in diagnostic and therapeutic procedures, i.e. as allied health professionals. The objective of this paper is to discuss the status of university degree health associates within the Croatian health care system. The latest Ordinance on job titles/positions and coefficients of job complexity (i.e. basic salary coefficients) in public services provides only one coefficient (1.571) for clinical physicists, psychologists, biologists etc., and just three coefficients (1.445, 1.513, 1.571) for clinical engineers, social workers etc., at the bottom of the coefficients scale of all clinical staff completed different university studies of equal duration in years and/or workloads in European Credit Transfer and Accumulation System (ECTS) credits. Simultaneously, there are 30 coefficients (1.659-2.361) for health professionals, meticulously taking into account all possible combinations of their employment in state hospital/institute or not, obtained B.Sc., M.Sc. or Ph.D. degrees, titles of primarius, specialist or subspecialist, etc. Since 750 university degree health associates make currently only about 1 percent of the Croatian health workforce, any discrimination among clinical staff is unnecessary. Full regulation and appreciation of all professions, equal opportunities of continuing professional education and training, as well as career advancement (internship, residency, sub-specialization, postgraduate specialist programs, etc.) should be facilitated and provided to all

  3. 49 CFR 571.202 - Standard No. 202; Head restraints; Applicable at the manufacturers option until September 1, 2009.

    Science.gov (United States)

    2010-10-01

    ... either S4.2 (a) or (b) of this section must be provided at each outboard front designated seating....org/trans/main/wp29/wp29regs/r017r4e.pdf, or by writing to: United Nations, Conference Services Division, Distribution and Sales Section, Office C.115-1, Palais des Nations, CH-1211, Geneva 10...

  4. Identification of a murine cysteinyl leukotriene receptor by expression in Xenopus laevis oocytes

    DEFF Research Database (Denmark)

    Mollerup, Jens; Jørgensen, Sune T.; Hougaard, Charlotte

    2001-01-01

    We report the identification of an EST encoding a murine cysteinyl leukotriene (mCysLT) receptor. LTD4, LTC4 and LTE4 but not LTB4 or various nucleotides activated Ca2+-evoked Cl- currents in mCysLT1 expressing Xenopus laevis oocytes. The response to LTD4 was blocked by MK-571, reduced by pretrea...... by pretreatment with pertussis toxin (PTX), and was partly dependent on extracellular Ca2+. The identified murine CysLT1 receptor differs from the hCysLT1 receptor with regard to PTX sensitivity, receptor-mediated Ca2+ influx, and antagonist sensitivity....

  5. 75 FR 64692 - Green Technology Pilot Program

    Science.gov (United States)

    2010-10-20

    ... DEPARTMENT OF COMMERCE Patent and Trademark Office Green Technology Pilot Program ACTION: Proposed...- 0062 Green Technology Pilot Program comment'' in the subject line of the message. Fax: 571-273-0112... United States Patent and Trademark Office (USPTO) implemented a pilot program on December 8, 2009, that...

  6. Anatomy Journal of Africa - Vol 4, No 2 (2015)

    African Journals Online (AJOL)

    Variant Anatomy of Intracranial Part of Middle Meningeal Artery in a Kenyan Population · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Julius Ogeng'o, Beda Olabu, Mary I. Otiti, Beryl S. Ominde, Larry Mburu, Hemed Elbusaidy, 571-577 ...

  7. Solubility of fused silica in sub- and supercritical water: Estimation from a thermodynamic model

    Czech Academy of Sciences Publication Activity Database

    Karásek, Pavel; Šťavíková, Lenka; Planeta, Josef; Hohnová, Barbora; Roth, Michal

    2013-01-01

    Roč. 83, NOV (2013), s. 72-77 ISSN 0896-8446 R&D Projects: GA ČR(CZ) GAP106/12/0522 Institutional support: RVO:68081715 Keywords : amorphous silica * fused silica * supercritical water * aqueous solubility Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.571, year: 2013

  8. Playing in three makes it simpler: Mapping the cognitive figure-ground framework onto cancer-immunology and immunotherapy (Review)

    Czech Academy of Sciences Publication Activity Database

    Gidron, Y.; Vannucci, Luca

    2010-01-01

    Roč. 36, č. 5 (2010), s. 1061-1065 ISSN 1019-6439 R&D Projects: GA AV ČR IAA500200917 Institutional research plan: CEZ:AV0Z50200510 Keywords : immune system * cancer development * tumour escape Subject RIV: EC - Immunology Impact factor: 2.571, year: 2010

  9. Current but not past smoking increases the risk of cardiac events: Insights from coronary computed tomographic angiography

    NARCIS (Netherlands)

    R. Nakanishi (Rine); D.S. Berman (Daniel); M.J. Budoff (Matthew J.); H. Gransar (Heidi); S. Achenbach (Stephan); M. Al-Mallah (Mouaz); D. Andreini (Daniele); F. Cademartiri (Filippo); T.Q. Callister (Tracy); H.-J. Chang (Hyuk-Jae); V.Y. Cheng (Victor Y.); K. Chinnaiyan (Kavitha); B.J.W. Chow (Benjamin); R.C. Cury (Ricardo); A. Delago (Augustin); M. Hadamitzky (Martin); J. Hausleiter (Jörg); G.M. Feuchtner (Gudrun); Y.-J. Kim (Yong-Jin); P.A. Kaufmann (Philipp A.); J. Leipsic (Jonathon); F.Y. Lin (Fay); E. Maffei (Erica); G. Pontone (Gianluca); G.L. Raff (Gilbert); L.J. Shaw (Leslee J.); T.C. Villines (Todd); A. Dunning (Allison); J.K. Min (James)

    2015-01-01

    textabstractAims We evaluated coronary artery disease (CAD) extent, severity, and major adverse cardiac events (MACEs) in never, past, and current smokers undergoing coronary CT angiography (CCTA). Methods and results We evaluated 9456 patients (57.1 ± 12.3 years, 55.5% male) without known CAD (1588

  10. Neoplastic progression of the human breast cancer cell line G3S1 is associated with elevation of cytoskeletal dynamics and upregulation of MT1-MMP

    Czech Academy of Sciences Publication Activity Database

    Tolde, O.; Rosel, D.; Mierke, C.T.; Paňková, D.; Folk, P.; Veselý, Pavel; Brabek, J.

    2010-01-01

    Roč. 36, č. 4 (2010), s. 833-839 ISSN 1019-6439 R&D Projects: GA MŠk(CZ) LC06061 Institutional research plan: CEZ:AV0Z50520514 Keywords : invasiveness * neoplastic progression * cytoskeletal dynamics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.571, year: 2010

  11. Dutch learner English in close-up: use of pre-subject adverbials as a defining feature of advanced Dutch EFL writing

    NARCIS (Netherlands)

    Vuuren, S. van; Laskin, L.

    2017-01-01

    This study presents a longitudinal Bayesian analysis of pre-subject adverbial (PSA) use in a 571,174-word corpus of Dutch learner English. Overall, learners use more circumstance and linking adverbials, but fewer stance adverbials than both novice and expert native writers. Learners also use more

  12. 78 FR 77697 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-12-24

    ... Pentagon, Washington, DC 20310, (571) 256-8145; Coast Guard: Commandant, United States Coast Guard, Attn... Facilities To Assist the Homeless AGENCY: Office of the Assistant Secretary for Community Planning and... surplus Federal property reviewed by HUD for suitability for use to assist the homeless. FOR FURTHER...

  13. 76 FR 78294 - Federal Property Suitable as Facilities to Assist the Homeless

    Science.gov (United States)

    2011-12-16

    ..., 2511 Jefferson Davis Hwy, Arlington, VA 22202: (571) 256-8145; Coast Guard: Commandant, United States... Facilities to Assist the Homeless AGENCY: Office of the Assistant Secretary for Community Planning and... surplus Federal property reviewed by HUD for suitability for use to assist the homeless. FOR FURTHER...

  14. 76 FR 82317 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2011-12-30

    ..., 2511 Jefferson Davis Hwy, Arlington, VA 22202: (571) 256-8145; Coast Guard: Commandant, United States... Facilities To Assist the Homeless AGENCY: Office of the Assistant Secretary for Community Planning and... surplus Federal property reviewed by HUD for suitability for use to assist the homeless. FOR FURTHER...

  15. 76 FR 76984 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2011-12-09

    ..., Arlington, VA 22202: (571) 256-8145; COAST GUARD: Commandant, United States Coast Guard, Attn: Jennifer... Facilities To Assist the Homeless AGENCY: Office of the Assistant Secretary for Community Planning and... surplus Federal property reviewed by HUD for suitability for use to assist the homeless. FOR FURTHER...

  16. 76 FR 55230 - Special Conditions: Embraer S.A.; Model EMB 505; Single-Place Side-Facing Lavatory Seat Dynamic...

    Science.gov (United States)

    2011-09-07

    .... The FAA therefore finds that good cause exists for making these special conditions effective upon..., these criteria should be documented in special conditions. The FAA decision to review compliance with... (FMVSS) Part 571.214, section S6.13.5. Rational analysis, comparing an installation with another...

  17. 2016-2017 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beata Bialic

    Date(s):. 2016-07-06. Destination(s):. Ottawa. Airfare: $482.11. Other. Transportation: $64.30. Accommodation: $0.00. Meals and. Incidentals: $25.28. Other: $0.00. Total: $571.69. Comments: 2016-2017 Travel Expense Reports for Mary. Anne Chambers, Governor, Chairperson of the. Human Resources Committee.

  18. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Logo of the Indian Academy of Sciences. Indian Academy of ... 2013 pp 571-589. An evolutionary approach for colour constancy based on gamut mapping constraint satisfaction ... A new colour constancy algorithm based on automatic determination of gray framework parameters using neural network · Mohammad Mehdi ...

  19. 75 FR 47266 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); South Atlantic...

    Science.gov (United States)

    2010-08-05

    ... participating should contact Kari Fenske at SEDAR. See FOR FURTHER INFORMATION CONTACT to request an invitation providing webinar access information. FOR FURTHER INFORMATION CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place Drive, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; e-mail: kari.fenske...

  20. 76 FR 47564 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); Assessment...

    Science.gov (United States)

    2011-08-05

    ... open to the public. Those interested in participating should contact Kari Fenske at SEDAR (See Contact... CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; e-mail: kari.fenske@safmc.net . SUPPLEMENTARY INFORMATION: The Gulf of Mexico...

  1. 77 FR 11065 - Fisheries of the Gulf of Mexico and South Atlantic; Southeast Data, Assessment, and Review (SEDAR...

    Science.gov (United States)

    2012-02-24

    ... public. Those interested in participating should contact Kari Fenske at SEDAR (See FOR FURTHER... invitations at least 24 hours in advance of each webinar. FOR FURTHER INFORMATION CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place Dr. Suite 201; phone (843) 571-4366. Email: kari.fenske@safmc.net...

  2. 75 FR 39918 - Fisheries of the South Atlantic; Southeast Data, Assessment, and Review (SEDAR); South Atlantic...

    Science.gov (United States)

    2010-07-13

    ... interested in participating should contact Kari Fenske at SEDAR. See FOR FURTHER INFORMATION CONTACT to... CONTACT: Kari Fenske, SEDAR Coordinator, 4055 Faber Place Drive, Suite 201, North Charleston, SC 29405; telephone: (843) 571-4366; e-mail: kari.fenske@safmc.net . SUPPLEMENTARY INFORMATION: The Gulf of Mexico...

  3. Publications | Page 58 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 6341 ... ... treatment for cholera and other diseases causing diarrheal dehydration. ... skills development, which both have a strong impact on labour market inequality. ... Gender, small-scale livestock farming and food security : policy ... Women are powerful but often neglected agents of change, and their ...

  4. The Impact of Personal Resources on Turnover Intention: The Mediating Effects of Work Engagement

    Science.gov (United States)

    Kim, Woocheol; Hyun, Young Sup

    2017-01-01

    Purpose: This paper aims to investigate mediating effects of employees' work engagement in the relationships between their personal resources (i.e. self-efficacy, organizational-based self-esteem and optimism) and turnover intention within Korean organizations. Design/methodology/approach: A total of 571 survey responses collected from Korean…

  5. AcEST: BP920102 [AcEST

    Lifescience Database Archive (English)

    Full Text Available DC04|RGS3_MOUSE Regulator of G-protein signaling 3 OS=Mus m... 32 1.9 sp|P87245|KMS1_SCHPO Karyoga...PAGQESTSQDPLLSQE 569 Query: 327 SP 332 P Sbjct: 570 PP 571 >sp|P87245|KMS1_SCHPO Karyogamy meiotic segregati

  6. 77 FR 20558 - Federal Motor Vehicle Safety Standards; Platform Lifts for Motor Vehicles; Platform Lift...

    Science.gov (United States)

    2012-04-05

    ... unrelated to the barrier's safety. Lift-U also questioned the agency's statement that it could be difficult... DEPARTMENT OF TRANSPORTATION National Highway Traffic Safety Administration 49 CFR Part 571 [Docket No. NHTSA-2012-0039] RIN 2127-AJ93 Federal Motor Vehicle Safety Standards; Platform Lifts for...

  7. 48 CFR 3033.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ..., DISPUTES, AND APPEALS Disputes and Appeals 3033.214 Alternative dispute resolution (ADR). (c) The Administrative Dispute Resolution Act (ADRA) of 1996, as amended, 5 U.S.C. 571, et seq., authorizes and... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Alternative dispute...

  8. Regional chemostratigraphic key horizons in the macrofossil-barren siliciclastic lower Miocene lacustrine sediments (Most Basin, Eger Graben, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Matys Grygar, Tomáš; Mach, K.

    2013-01-01

    Roč. 88, č. 3 (2013), s. 557-571 ISSN 1214-1119 R&D Projects: GA ČR(CZ) GAP210/11/1357 Institutional support: RVO:61388980 Keywords : Most Basin * Burdigalian * chemostratigraphy * proxy analyses * lacustrine sediments Subject RIV: DD - Geochemistry Impact factor: 1.495, year: 2013

  9. p16(INK4a) /Ki-67 dual labelling as a marker for the presence of high-grade cancer cells or disease progression in urinary cytopathology.

    Science.gov (United States)

    Piaton, E; Advenier, A S; Carré, C; Decaussin-Petrucci, M; Mege-Lechevallier, F; Ruffion, A

    2013-10-01

    Overexpression of p16(INK4a) independent of the presence of E6-E7 oncoproteins of high-risk papillomaviruses has been identified in bladder carcinoma in situ lesions with or without concurrent papillary or invasive high-grade (HG) urothelial carcinoma. As p16(INK4a) and Ki-67 co-expression clearly indicates deregulation of the cell cycle, the aim of this study was to investigate the frequency of p16(INK4a) /Ki-67 dual labelling in urinary cytology samples. Immunolabelling was performed in demounted, destained Papanicolaou slides after ThinPrep(®) processing. A total of 84 urinary cytology samples (18 negative, 10 low grade, 19 atypical urothelial cells and 37 high grade) were analysed for p16(INK4a) /Ki-67 co-expression. We assessed underlying urothelial malignancy with cystoscopy, histopathology and follow-up data in every case. Compared with raw histopathological results, p16 (INK4a) /Ki-67 dual labelling was observed in 48 out of 55 (87.3%) HG lesions and in 11 out of 29 (37.9%) negative, papillary urothelial neoplasia of low malignant potential or low-grade carcinomas (P = 0.05). All cases with high-grade/malignant cytology were dual labelled. Sixteen out of 17 (94.1%) carcinoma in situ cases and eight out of 14 (57.1%) cases with atypical urothelial cells matching with HG lesions were dual labelled. Extended follow-up allowed three cases of progression to be diagnosed in dual-labelled cases with negative/low-grade cytology results after a 9- to 11-months delay. The data show that p16(INK4a) /Ki-67 co-expression allows most HG cancer cells to be detected initially and in the follow-up period. Additional studies are needed in order to determine whether dual labelling can be used as a triage tool for atypical urothelial cells in the urine. © 2012 John Wiley & Sons Ltd.

  10. Hepatitis in pregnancy

    International Nuclear Information System (INIS)

    Ain, F.U.; Amin, A.; Yasmin, F.

    2007-01-01

    To determine the frequency of viral hepatitis in general, spectrum of hepatitis E in particular, and to study the maternal and fetal morbidity and mortality associated with it. In this prospective study, total number of pregnant women was 4723, sera of 35 pregnant women having clinical jaundice in pregnancy were analyzed for markers of hepatitis A , B, C and E viruses. Of the 35 pregnant women with jaundice HEV IgM were 60%,HA V IgM20%, Anti HCV 8.75%,Hbs Ag 5.71%, unexplained 5.71%. Amongst HEV 23.80% had hepatic encephalopathy DIC in 42.85%, PPH in 23.80%, renal failure in 9.52% an- maternal mortality in 4.76%. Approximately two third of pregnant women with HEV infection had preterm deliveries (76.19) % and perinatal mortality of 42.8%. Hepatitis E was the commonest etiological agent in those who had fulminant disease during pregnancy and was associated with high morbidity and mortality. (author)

  11. Microsatellite markers of water buffalo, Bubalus bubalis - development, characterisation and linkage disequilibrium studies

    Directory of Open Access Journals (Sweden)

    Vaidhegi R

    2009-10-01

    Full Text Available Abstract Background Microsatellite markers are highly polymorphic and widely used in genome mapping and population genetic studies in livestock species. River buffalo, Bubalus bubalis is an economically important livestock species, though only a limited number of microsatellite markers have been reported thus far in this species. Results In the present study, using two different approaches 571 microsatellite markers have been characterized for water buffalo. Of the 571 microsatellite markers, 498 were polymorphic with average heterozygosity of 0.51 on a panel of 24 unrelated buffalo. Fisher exact test was used to detect LD between the marker pairs. Among the 137550 pairs of marker combination, 14.58% pairs showed significant LD (P Conclusion The high conservation of cattle microsatellite loci in water buffalo promises the usefulness of the cattle microsatellites markers on buffalo. The polymorphic markers characterised in this study will contribute to genetic linkage and radiation hybrid mapping of water buffalo and population genetic studies.

  12. Synthesis of piperazine sulfonamide analogs as diabetic-II inhibitors and their molecular docking study.

    Science.gov (United States)

    Taha, Muhammad; Irshad, Maryam; Imran, Syahrul; Chigurupati, Sridevi; Selvaraj, Manikandan; Rahim, Fazal; Ismail, Nor Hadiani; Nawaz, Faisal; Khan, Khalid Mohammed

    2017-12-01

    Piperazine Sulfonamide analogs (1-19) have been synthesized, characterized by different spectroscopic techniques and evaluated for α-amylase Inhibition. Analogs 1-19 exhibited a varying degree of α-amylase inhibitory activity with IC 50 values ranging in between 1.571 ± 0.05 to 3.98 ± 0.397 μM when compared with the standard acarbose (IC 50  = 1.353 ± 0.232 μM). Compound 1, 2, 3 and 7 showed significant inhibitory effects with IC 50 value 2.348 ± 0.444, 2.064 ± 0.04, 1.571 ± 0.05 and 2.118 ± 0.204 μM, respectively better than the rest of the series. Structure activity relationships were established. Molecular docking studies were performed to understand the binding interaction of the compounds. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  13. New data on oribatid mites of Galumna (Galumna) (Acari, Oribatida, Galumnidae) from Northern Vietnam, with a key to species of this subgenus in the Oriental region

    Czech Academy of Sciences Publication Activity Database

    Ermilov, S.G.; Starý, Josef

    2017-01-01

    Roč. 22, č. 4 (2017), s. 550-571 ISSN 1362-1971 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : galumnid mites * supplementary description * morphology * systematics * Tam Dao National Park Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.467, year: 2016

  14. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 650 ... ... ACCESS TO HEALTH CARE 23 Apply ACCESS TO HEALTH CARE filter ... Africa's Great Lakes region is home to violent and prolonged conflicts that cause a ... Poverty and Information and Communication Technology Systems in ... Emergency Plan for AIDS Relief (PEPFAR) and the World Bank.

  15. Low back pain in drivers exposed to whole body vibration: analysis of a dose-response pattern

    NARCIS (Netherlands)

    Tiemessen, I. J. H.; Hulshof, C. T. J.; Frings-Dresen, M. H. W.

    2008-01-01

    Analysis of a dose-response pattern between exposure to whole body vibration (WBV) and low back pain (LBP) in a group of drivers. This study assessed individual factors, work-related risk factors, various LBP outcome measures and LBP disability in a group of drivers (n = 571) approached at baseline

  16. Contact angle measurement on xerogel sensitivity layer for optical fibre sensor

    Czech Academy of Sciences Publication Activity Database

    Cherif, K.; Hleli, S.; Abdelghani, A.; Jaffrezic-Renault, N.; Matějec, Vlastimil

    2003-01-01

    Roč. 23, č. 5 (2003), s. 571-577 ISSN 0928-4931 R&D Projects: GA ČR GA102/02/0780 Institutional research plan: CEZ:AV0Z2067918 Keywords : optical fibres * measurement * fibre lasers Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.122, year: 2003

  17. Search Results | Page 58 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 8531 ... Exploring and profiling of childhood illnesses in informal settlements in relation to flooding : a case study of Barcelona, Cape Town, South Africa. INTRODUCTION: A significant number of studies have documented illnesses that follow flooding as a result of people coming into contact with ...

  18. 78 FR 71635 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-11-29

    ... 5A128, 600 Army Pentagon, Washington, DC 20310, (571) 256-8145; Coast Guard: Commandant, United States... Facilities To Assist the Homeless AGENCY: Office of the Assistant Secretary for Community Planning and... surplus Federal property reviewed by HUD for suitability for use to assist the homeless. FOR FURTHER...

  19. 75 FR 29268 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-05-25

    ... impact assessment has not been prepared. Regulatory Flexibility Act. As flood elevation determinations.... Approximately 1.7 mile None +714 upstream of Due West Highway. Beaver Creek At the confluence with None +571... confluence with Beaver Creek Tributary 15. Beaver Creek Tributary 1 At the confluence with None +572...

  20. Complete Genome Sequence of the Facultative Methylotroph Methylobacterium extorquens TK 0001 Isolated from Soil in Poland.

    Science.gov (United States)

    Belkhelfa, Sophia; Labadie, Karine; Cruaud, Corinne; Aury, Jean-Marc; Roche, David; Bouzon, Madeleine; Salanoubat, Marcel; Döring, Volker

    2018-02-22

    Methylobacterium extorquens TK 0001 (DSM 1337, ATCC 43645) is an aerobic pink-pigmented facultative methylotrophic alphaproteobacterium isolated from soil in Poland. Here, we report the whole-genome sequence and annotation of this organism, which consists of a single 5.71-Mb chromosome. Copyright © 2018 Belkhelfa et al.

  1. 75 FR 70071 - Terrafugia, Inc.; Receipt of Application for Temporary Exemption From Requirements for Tire...

    Science.gov (United States)

    2010-11-16

    .... 126. ESC systems employ automatic computer-controlled braking of individual wheels to assist the... handling and braking. B. FMVSS No. 126, Electronic Stability Control Systems \\16\\ \\16\\ 49 CFR 571.126... benefit of the ESC system to braking performance on the ground. Terrafugia states that it currently does...

  2. Marie-Eugénie Kaufmant, Poétique des espaces naturels dans la «Comedia nueva»

    Directory of Open Access Journals (Sweden)

    Alexandre Roquain

    2012-12-01

    Full Text Available Review of Marie-Eugénie Kaufmant, Poétique des espaces naturels dans la «Comedia nueva», Casa de Velázquez (Bibliothèque de la Casa de Velázquez, 48, Madrid, 2010, 571 pp. ISBN: 978-84-96820-40-1.

  3. Four point measurements of electrons using PEACE in the high-altitude cusp

    Czech Academy of Sciences Publication Activity Database

    Taylor, M. G. G. T.; Fazakerley, A. N.; Krauklis, I. C.; Owen, C.; Trávníček, Pavel; Dunlop, M. W.; Carter, P. J.; Coates, A. J.; Szita, S.; Watson, G.; Wilson, R. J.

    2001-01-01

    Roč. 19, - (2001), s. 1567-1578 ISSN 0992-7689 Grant - others:European Space Agency - Prodex(XE) IMF CS/SFe/571/2000 Institutional research plan: CEZ:AV0Z3042911 Keywords : magnetospheric physics * magnetopause * cusp and boundary layers Subject RIV: BE - Theoretical Physics Impact factor: 1.199, year: 2001

  4. 76 FR 21695 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2011-04-18

    ... County. At the Betts Spring None +571 Branch and Bradford Creek confluence. Big Cove Creek Approximately.... Approximately 0.7 mile None +677 upstream of the Big Cove Creek confluence. Blue Spring Creek Approximately 400... Road. Approximately 450 feet None +748 upstream of Spragins Hollow Road Northwest. East Fork Pinhook...

  5. Molecular evidence and functional expression of multidrug resistance associated protein (MRP) in rabbit corneal epithelial cells.

    Science.gov (United States)

    Karla, Pradeep K; Pal, Dananjay; Mitra, Ashim K

    2007-01-01

    Multidrug resistance associated protein (MRP) is a major family of efflux transporters involved in drug efflux leading to drug resistance. The objective of this study was to explore physical barriers for ocular drug absorption and to verify if the role of efflux transporters. MRP-2 is a major homologue of MRP family and found to express on the apical side of cell membrane. Cultured Rabbit Corneal Epithelial Cells (rCEC) were selected as an in vitro model for corneal epithelium. [14C]-erythromycin which is a proven substrate for MRP-2 was selected as a model drug for functional expression studies. MK-571, a known specific and potent inhibitor for MRP-2 was added to inhibit MRP mediated efflux. Membrane fraction of rCEC was used for western blot analysis. Polarized transport of [14C]-erythromycin was observed in rCEC and transport from B-->A was significantly high than from A-->B. Permeability's increased significantly from A-->B in the presence of MK-571 and ketoconozole. Uptake of [14C]-erythromycin in the presence of MK-571 was significantly higher than control in rCEC. RT-PCR analysis indicated a unique and distinct band at approximately 498 bp corresponding to MRP-2 in rCEC and MDCK11-MRP-2 cells. Immunoprecipitation followed by Western Blot analysis indicated a specific band at approximately 190 kDa in membrane fraction of rCEC and MDCK11-MRP-2 cells. For the first time we have demonstrated high expression of MRP-2 in rabbit corneal epithelium and its functional activity causing drug efflux. RT-PCR, immunoprecipitation followed by Western blot analysis further confirms the result.

  6. 40 CFR 80.571 - What labeling requirements apply to retailers and wholesale purchaser-consumers of NRLM diesel...

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine... June 1, 2007, and beyond, for pumps dispensing non-motor vehicle diesel fuel for use other than in... retailers and wholesale purchaser-consumers of NRLM diesel fuel or heating oil beginning June 1, 2007? 80...

  7. Comportamento das cultivares Cabernet Sauvignon e Syrah em diferentes porta-enxertos Yield-related performance of cv Cabernet Sauvingnon and Petite Syrah on different rootstocks

    Directory of Open Access Journals (Sweden)

    Tânia das Graças Silva Orlando

    2008-06-01

    Full Text Available As cultivares Cabernet Sauvignon e Syrah são destinadas à elaboração de vinhos tintos jovens ou de guarda bastante difundidas em diversas zonas vitivinícolas de todo o mundo. No Brasil, são utilizadas principalmente no Rio Grande do Sul e Vale do Rio São Francisco. Atualmente, produtores da região de Jundiaí, SP, têm demonstrado interesse na utilização de tais cultivares com intuito de obter vinhos de qualidade superior aos originários de cultivares americanas. Por isso, realizou-se o estudo do comportamento das cultivares Cabernet Sauvignon e Syrah em diferentes porta-enxertos, na região de Jundiaí, SP (23º06' S; 46º55' W, 715 m. Não houve influência dos diferentes porta-enxertos sobre o comportamento da cultivar Cabernet Sauvignon. O porta-enxerto IAC 571-6 'Jundiaí' tendeu a conferir colheita tardia na cultivar Syrah. Os porta-enxertos IAC 572 'Jales' e IAC 571-6 'Jundiaí' conferiram maior produção a cultivar Syrah. A cultivar Syrah apresentou-se como boa opção de plantio para obtenção de vinho de qualidade na região.Grapevines cv. Cabernet Sauvignon and Syrah are largely used for high quality vine making all around the world. In Brazil they are concentrated moreover, at the Rio Grande do Sul state and in the São Francisco Valley. Producers from Jundiaí region (São Paulo state have been interested in such cultivars for improved quality vine making as they generally use american cultivars for that propose. Aiming study the performance of cv Cabernet Sauvingnon and Syrah, cultivated over different rootstocks an experiment was conducted in the region of Jundiaí (SP (23º06' S; 46º55' W, 715 m. Results showed that there wasn't influence of different rootstocks on the performance of both analyzed cultivars. It was observed a trend of the rootstock IAC 571-6 'Jundiaí' to improve final yield of cv Syrah. The Rootstocks IAC 572 'Jales' and IAC 571-6 'Jundiaí' combined to Syrah resulted in the highest yield in the

  8. Cytogenetic analysis using fluorescence in situ hybridization (FISH) to evaluate occupational exposure to carcinogens

    Czech Academy of Sciences Publication Activity Database

    Šrám, Radim; Beskid, Olena; Binková, Blanka; Rössner, P.; Šmerhovský, Zdeněk

    2004-01-01

    Roč. 149, - (2004), s. 335-344 ISSN 0378-4274 R&D Projects: GA MŽP SI/340/2/00 Institutional research plan: CEZ:AV0Z5039906 Keywords : Chromosomal aberrations * Fluorescence in situ hybridization Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 2.571, year: 2004

  9. Host genetic resistance to symptomatic norovirus (GGII.4) infections in Denmark

    DEFF Research Database (Denmark)

    Kindberg, Elin; Akerlind, Britt; Johnsen, Christina

    2007-01-01

    A total of 61 individuals involved in five norovirus outbreaks in Denmark were genotyped at nucleotides 428 and 571 of the FUT2 gene, determining secretor status, i.e., the presence of ABH antigens in secretions and on mucosa. A strong correlation (P = 0.003) was found between the secretor phenot...

  10. CORPOR- AND SPONDYLECTOMYIN SYSTEM OF SURGICAL TREATMENT OF VERTEBRAL TUMORS

    Directory of Open Access Journals (Sweden)

    V. D. Usikov

    2010-01-01

    Full Text Available The authors have reported the 10-years experience of treatment of 571 patient with spinal tumors. Radical resection (en bloc of tumors was done in 114 cases (65 - corpectomy, 55 - spondylectomy. The rate of tumors recurrence was - 9%, it depended from type of tumors and it's size.

  11. 49 CFR 570.54 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... part 571 of this chapter, Motor Vehicle Safety Standards, are used as defined in that part. Air-over..., DEPARTMENT OF TRANSPORTATION VEHICLE IN USE INSPECTION STANDARDS Vehicles With GVWR of More Than 10,000... from the driver control to a hydraulic brake system to actuate the service brakes. Electric brake...

  12. 49 CFR 580.17 - Exemptions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION (CONTINUED) ODOMETER DISCLOSURE REQUIREMENTS § 580.17 Exemptions... Rating, as defined in § 571.3 of this title, of more than 16,000 pounds; (2) A vehicle that is not self... (a) of this section need not notify the lessee of any of these vehicles of the disclosure...

  13. 76 FR 53660 - Federal Motor Vehicle Safety Standards; Seat Belt Assemblies

    Science.gov (United States)

    2011-08-29

    ... Traffic Safety Administration 49 CFR Part 571 [Docket No. NHTSA-2011-0078] Federal Motor Vehicle Safety... integration of electrical signals from vehicle crash sensors would work with the requested mechanical seat... (350,000) of the vehicles were stopped in the traffic lane prior to the crash event (pg. 22, Table 7...

  14. Structured RNAs and synteny regions in the pig genome

    DEFF Research Database (Denmark)

    Anthon, Christian; Tafer, Hakim; Havgaard, Jakob Hull

    2014-01-01

    annotation. To further enhance the reliability, 571 of the 3,556 structured RNAs were manually curated by methods depending on the RNA class while 1,581 were declared as pseudogenes. We further created a multiple alignment of pig against 20 representative vertebrates, from which RNAz predicted 83,859 de novo...

  15. Benchmarking DoD Use of Additive Manufacturing and Quantifying Costs

    Science.gov (United States)

    2017-03-01

    design software. CAD software converts point cloud data from a structured light scanner into surfaces and volumes required to generate a 3D model...Tinker REACT 405‐622‐7607 NAVAIR Lakehurst 732-323-1945 HQ Marine Corps Installations & Logistics 571-256-2740 67    Appendix C: Summary

  16. Ocular Disorders In Patients Infected With The Human ...

    African Journals Online (AJOL)

    Fourteen patients (2.7%) had Herpes zoster ophthalmicus, four (0.8%) had Squamuos cell carcinoma, two (0.4%) had Kaposi\\'s sarcoma while one (0.2%) had Cytomegalovirus retinitis. The signs seen on ocular examination were vesicular rash (66.7%) diminished vision (57.1%) corneal ulcers (38.0%), conjunctival ...

  17. 2015-2016 Expense report for Uri Rosenthal | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-03-20

    $19,852.37. Board meetings. March 20, 2016 to March 22, 2016. CA$7,795.95. Board meetings. November 15, 2015 to November 18, 2015. CA$5,571.40. Board meetings. July 13, 2015 to July 14, 2015. CA$6,485.02. What we do · Funding · Resources ...

  18. Assessment of ceftriaxone utilization in different wards of the Federal ...

    African Journals Online (AJOL)

    Data was collected by using a structured format and evaluated against the standard treatment guideline of Ethiopia as well as the Infectious Disease Society of America and American Society of Health-System Pharmacists' guidelines. Out of the 682 patient medication records sampled, 571 were found to be complete and ...

  19. Complexity theory and genetics: The computational power of crossing over

    Czech Academy of Sciences Publication Activity Database

    Pudlák, Pavel

    2001-01-01

    Roč. 171, č. 1 (2001), s. 201-223 ISSN 0890-5401 R&D Projects: GA AV ČR IAA1019901 Institutional research plan: CEZ:AV0Z1019905; CEZ:AV0Z1019905 Keywords : complexity * genetics * croning over Subject RIV: BA - General Mathematics Impact factor: 0.571, year: 2001

  20. Sídliště kultury s moravskou malovanou keramikou u Slavíkovic a jeho postavení v kontextu západní periferie lengyelské oikumeny na Moravě

    Czech Academy of Sciences Publication Activity Database

    Bartík, J.; Vokáč, M.; Kuča, M.; Čerevková, A.; Prokeš, L.; Nývltová Fišáková, Miriam

    2016-01-01

    Roč. 57, č. 1 (2016), s. 59-85 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Southwestern Moravia * Lengyel Culture * periphery * radiocarbon dating * paleoenvironment Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV-57-1_bartik.pdf

  1. 78 FR 78838 - Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human...

    Science.gov (United States)

    2013-12-27

    ...] Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human Parathyroid...,801. FOR FURTHER INFORMATION CONTACT: Mary C. Till by telephone at (571) 272-7755; by mail marked to... No. 5,496,801. The patent claims the human biological product recombinant human parathyroid hormone...

  2. Effect of composition on the matrix transformation of the Co-Re-Cr-Ta-C alloys

    Czech Academy of Sciences Publication Activity Database

    Beran, Přemysl; Mukherji, D.; Strunz, Pavel; Gilles, R.; Hofmann, M.; Karge, L.; Dolotko, O.; Rösler, J.

    2016-01-01

    Roč. 22, č. 4 (2016), s. 562-571 ISSN 1598-9623 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389005 Keywords : alloys * phase transformation * scanning electron microscopy (SEM) * X-ray diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.889, year: 2016

  3. Parent Ratings of ADHD Symptoms: Differential Symptom Functioning across Malaysian Malay and Chinese Children

    Science.gov (United States)

    Gomez, Rapson; Vance, Alasdair

    2008-01-01

    This study examined differential symptom functioning (DSF) in ADHD symptoms across Malay and Chinese children in Malaysia. Malay (N = 571) and Chinese (N = 254) parents completed the Disruptive Behavior Rating Scale, which lists the DSM-IV ADHD symptoms. DSF was examined using the multiple indicators multiple causes (MIMIC) structural equation…

  4. Determinants of fertility desire among married or cohabiting individuals in Rakai, Uganda: a cross-sectional study.

    Science.gov (United States)

    Matovu, Joseph K B; Makumbi, Fredrick; Wanyenze, Rhoda K; Serwadda, David

    2017-01-10

    Recent trends in fertility rates indicate declines in total fertility rate (TFR) in some sub-Saharan African countries. However, countries such as Uganda continue to have a persistently high TFR partly attributed to strong preferences for large family sizes. We explored the factors that influence fertility desire among married or cohabiting individuals in Rakai, a rural district in southwestern Uganda. This cross-sectional study of fertility desire (desire to have another child) was nested in a cluster-randomized demand-creation intervention trial for the promotion of couples' HIV counseling and testing uptake among married or cohabiting individuals that was conducted in Rakai district between March 1 and April 30, 2015. A total of 1490 married or cohabiting individuals, resident in three study regions with differing background HIV prevalence, were enrolled into the study. Data were collected on socio-demographic, behavioral and fertility-related characteristics. We used a modified Poisson regression model to generate prevalence ratio (PR) as a measure of association for factors that were independently associated with fertility desire. We adjusted for clustering at community level and used STATA version 14.0 for all analyses. Overall, fertility desire was high (63.1%, n = 940); higher in men (69.9%, n = 489) than women (57.1%, n = 451). More than three-quarters (78.8%, n = 1174) had 3+ biological children while slightly more than two-thirds (68.5%, n = 1020) reported an ideal family size of 5+ children. Only 30% (n = 452) reported that they had attained their desired family size. After adjusting for potential and suspected confounders, the factors that were negatively associated with fertility desire were: age 30-39 (adjusted prevalence ratio [aPR] = 0.82, 95% CI: 0.78, 0.86) and 40+ years (aPR = 0.65, 95% CI: 0.60, 0.71); having six or more biological children (aPR = 0.88, 95% CI: 0.80, 0.97); being HIV-positive (aPR = 0

  5. BCR/ABL downregulates DNA-PK(CS)-dependent and upregulates backup non-homologous end joining in leukemic cells.

    Science.gov (United States)

    Poplawski, Tomasz; Blasiak, Janusz

    2010-06-01

    Non-homologous end joining (NHEJ) and homologous recombination repair (HRR) are the main mechanisms involved in the processing of DNA double strand breaks (DSBs) in humans. We showed previously that the oncogenic tyrosine kinase BCR/ABL stimulated DSBs repair by HRR. To evaluate the role of BCR/ABL in DSBs repair by NHEJ we examined the ability of leukemic BCR/ABL-expressing cell line BV173 to repair DNA damage induced by two DNA topoisomerase II inhibitors: etoposide and sobuzoxane. DNA lesions induced by sobuzoxane are repaired by a NHEJ pathway which is dependent on the catalytic subunit of protein kinase dependent on DNA (DNA-PK(CS); D-NHEJ), whereas damage evoked by etoposide are repaired by two distinct NHEJ pathways, dependent on or independent of DNA-PK(CS) (backup NHEJ, B-NHEJ). Cells incubated with STI571, a highly specific inhibitor of BCR/ABL, displayed resistance to these agents associated with an accelerated kinetics of DSBs repair, as measured by the neutral comet assay and pulsed field gel electrophoresis. However, in a functional NHEJ assay, cells preincubated with STI571 repaired DSBs induced by a restriction enzyme with a lower efficacy than without the preincubation and addition of wortmannin, a specific inhibitor of DNA-PK(CS), did not change efficacy of the NHEJ reaction. We suggest that BCR/ABL switch on B-NHEJ which is more error-prone then D-NHEJ and in such manner contribute to the increase of the genomic instability of leukemic cells.

  6. The 'holi' dermatoses: annual spate of skin diseases following the spring festival in India.

    Science.gov (United States)

    Ghosh, Sudip Kumar; Bandyopadhyay, Debabrata; Chatterjee, Gobinda; Saha, Debabrata

    2009-07-01

    'Holi' is an annual spring festival celebrated all over India. The central ritual of Holi involves throwing of colors on one another. Playing with toxic industrial dyes often results in various dermatological complaints in a significant number of people immediately following the celebration. To describe patterns of various skin manifestations directly or indirectly related to the use of different colors in the celebration of Holi. Observational clinical study on consecutive patients presenting to a teaching hospital in Kolkata, India. Forty-two patients with a mean age of 24.2 years were studied. Itching was the commonest symptom (25, 59.5%), followed by burning sensation, pain, oozing, and scaling. Eleven patients' symptoms were attributed to activities related to preparation of colors and the removal of colors from the skin surface. Eczematous lesions were the most common pattern (24, 57.1%) followed by erosions, xerosis and scaling, erythema, urticaria, acute nail-fold inflammation, and abrasions. Thirteen (30.9%) patients reported aggravation of preexisting dermatoses (acne, eczema, and paronychia). Secondary pyoderma occurred in 3 (7.1%). Face was the commonest site affected (24, 57.1%), followed by dorsum of the hands, scalp, forearm, palms, arms, and trunk. Ocular complaints in the form of redness, watering, and grittiness occurred in 7 (16.7%) patients. Various forms of cutaneous manifestations, often associated with ocular complaints, occur commonly due to Holi colors. Public awareness and regulatory actions are needed to avoid these preventable conditions.

  7. The ′Holi′ dermatoses : Annual spate of skin diseases following the spring festival in India

    Directory of Open Access Journals (Sweden)

    Ghosh Sudip

    2009-01-01

    Full Text Available Background : ′Holi′ is an annual spring festival celebrated all over India. The central ritual of Holi involves throwing of colors on one another. Playing with toxic industrial dyes often results in various dermatological complaints in a significant number of people immediately following the celebration. Aims : To describe patterns of various skin manifestations directly or indirectly related to the use of different colors in the celebration of Holi. Methods : Observational clinical study on consecutive patients presenting to a teaching hospital in Kolkata, India. Results : Forty-two patients with a mean age of 24.2 years were studied. Itching was the commonest symptom (25, 59.5%, followed by burning sensation, pain, oozing, and scaling. Eleven patients′ symptoms were attributed to activities related to preparation of colors and the removal of colors from the skin surface. Eczematous lesions were the most common pattern (24, 57.1% followed by erosions, xerosis and scaling, erythema, urticaria, acute nail-fold inflammation, and abrasions. Thirteen (30.9% patients reported aggravation of preexisting dermatoses (acne, eczema, and paronychia. Secondary pyoderma occurred in 3 (7.1%. Face was the commonest site affected (24, 57.1%, followed by dorsum of the hands, scalp, forearm, palms, arms, and trunk. Ocular complaints in the form of redness, watering, and grittiness occurred in 7 (16.7% patients. Conclusion : Various forms of cutaneous manifestations, often associated with ocular complaints, occur commonly due to Holi colors. Public awareness and regulatory actions are needed to avoid these preventable conditions.

  8. THE ‘HOLI’ DERMATOSES: ANNUAL SPATE OF SKIN DISEASES FOLLOWING THE SPRING FESTIVAL IN INDIA

    Science.gov (United States)

    Ghosh, Sudip Kumar; Bandyopadhyay, Debabrata; Chatterjee, Gobinda; Saha, Debabrata

    2009-01-01

    Background: ‘Holi’ is an annual spring festival celebrated all over India. The central ritual of Holi involves throwing of colors on one another. Playing with toxic industrial dyes often results in various dermatological complaints in a significant number of people immediately following the celebration. Aims: To describe patterns of various skin manifestations directly or indirectly related to the use of different colors in the celebration of Holi. Methods: Observational clinical study on consecutive patients presenting to a teaching hospital in Kolkata, India. Results: Forty-two patients with a mean age of 24.2 years were studied. Itching was the commonest symptom (25, 59.5%), followed by burning sensation, pain, oozing, and scaling. Eleven patients’ symptoms were attributed to activities related to preparation of colors and the removal of colors from the skin surface. Eczematous lesions were the most common pattern (24, 57.1%) followed by erosions, xerosis and scaling, erythema, urticaria, acute nail-fold inflammation, and abrasions. Thirteen (30.9%) patients reported aggravation of preexisting dermatoses (acne, eczema, and paronychia). Secondary pyoderma occurred in 3 (7.1%). Face was the commonest site affected (24, 57.1%), followed by dorsum of the hands, scalp, forearm, palms, arms, and trunk. Ocular complaints in the form of redness, watering, and grittiness occurred in 7 (16.7%) patients. Conclusion: Various forms of cutaneous manifestations, often associated with ocular complaints, occur commonly due to Holi colors. Public awareness and regulatory actions are needed to avoid these preventable conditions. PMID:20161854

  9. Identification of streptococcal proteins reacting with sera from Behçet's disease and rheumatic disorders.

    Science.gov (United States)

    Cho, Sung Bin; Lee, Ju Hee; Ahn, Keun Jae; Cho, Suhyun; Park, Yong-Beom; Lee, Soo-Kon; Bang, Dongsik; Lee, Kwang Hoon

    2010-01-01

    We evaluated the reactivity of sera from Behçet's disease (BD), systemic lupus erythematosus (SLE), dermatomyositis (DM), rheumatoid arthritis (RA), and Takayasu's arteritis (TA) patients against human α-enolase and streptococcal α-enolase, and identified additional streptococcal antigens. Enzyme-linked immunosorbent assay (ELISA) and immunoblotting were performed using sera from patients with BD, SLE, DM, RA, and TA and healthy volunteers (control) against human α-enolase and streptococcal α-enolase. Immunoblot analysis and matrix-assisted laser desorption ionisation-time-of-flight mass spectrometry were used to identify and recombine other streptococcal antigens. Specific positive signals against recombinant human α-enolase were detected by IgM ELISA of serum samples from 50% of BD, 14.3% of SLE, 57.1% of DM, 42.9% of RA, and 57.1% of TA patients. Specific positive signals against streptococcal α-enolase were detected from 42.9% of BD, 14.3% of DM, and 14.3% of TA patients. No SLE and RA sera reacted against streptococcal α-enolase antigen. Streptococcal proteins reacting with sera were identified as hypothetical protein (HP) for SLE and DM patients, acid phosphatase (AP) for RA patients, and glyceraldehyde-3-phosphate dehydrogenase (GAPDH) for TA patients. We observed that RA patients did not present serum reactivity against either HP or GAPDH though BD, SLE, DM, and TA patients did. Also, AP reacted with sera from BD, SLE, DM, RA, and TA patients.

  10. : tous les projets | Page 571 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    américain de portails éducatifs (RELPE) ont grandement aidé à mieux faire comprendre l'utilisation et l'intégration des technologies de l'information et de la communication (TIC) en éducation. Date de début : 31 juillet 2006. End Date: 1 août 2011.

  11. 49 CFR 571.302 - Standard No. 302; Flammability of interior materials.

    Science.gov (United States)

    2010-10-01

    ... frame. S5.1.4A bunsen burner with a tube of 10 mm inside diameter is used. The gas adjusting valve is set to provide a flame, with the tube vertical, of 38 mm in height. The air inlet to the burner is... seven to eight smooth, rounded teeth per 25 mm. S5.3Procedure. (a) Mount the specimen so that both sides...

  12. 49 CFR 571.135 - Standard No. 135; Light vehicle brake systems.

    Science.gov (United States)

    2010-10-01

    ... service brake system, such as a pump, that automatically supplies energy in the event of a primary brake...). S6.1.2. Wind speed. The wind speed is not greater than 5 m/s (11.2 mph). S6.2. Road test surface. S6...

  13. 49 CFR 571.138 - Standard No. 138; Tire pressure monitoring systems.

    Science.gov (United States)

    2010-10-01

    ... following statement in English: Each tire, including the spare (if provided), should be checked monthly when... level to trigger illumination of the TPMS low tire pressure telltale. [The following paragraph is.... If necessary, drive the vehicle until the telltale has extinguished. (o) The test may be repeated...

  14. 14 CFR 25.571 - Damage-tolerance and fatigue evaluation of structure.

    Science.gov (United States)

    2010-01-01

    ... contribute to a catastrophic failure (such as wing, empennage, control surfaces and their systems, the... TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Fatigue Evaluation § 25... and sonic excitation environment, that— (1) Sonic fatigue cracks are not probable in any part of the...

  15. 49 CFR 571.126 - Standard No. 126; Electronic stability control systems.

    Science.gov (United States)

    2010-10-01

    ... and injuries that result from crashes in which the driver loses directional control of the vehicle... first and second peaks)(Peak in Figure 1) during the same test run, and S5.2.2The yaw rate measured 1.75... peaks) during the same test run. S5.2.3The lateral displacement of the vehicle center of gravity with...

  16. 49 CFR 571.225 - Standard No. 225; Child restraint anchorage systems.

    Science.gov (United States)

    2010-10-01

    .... A steel cable is connected to the X point through which the test force is applied. S8.1Apply the... tightened to a tension of not less than 53.5 N and not more than 67 N on the webbing portion of the belt.... While maintaining the force, tighten the vehicle seat belt to a tension of not less than 53.5 N and not...

  17. Development of functional markers associated with phenotypic characteristics for identification of soy variety

    International Nuclear Information System (INIS)

    Ibarra, M.; Castro, A; Capdevielle, F.

    2013-01-01

    The organization of agricultural systems requires the verification of the genetic identity and purity of cultivars. The increase in the number of soy varieties to be evaluated, and the narrow genetic base of soybean cultivars, make the identification using phenotypic descriptors very difficult. The International Union for the Protection of New Varieties of Plants (UPOV) has recognized the utility of molecular markers associated with descriptive phenotypic characteristics. With the goal of developing this kind of markers, six genic or genomic S SR were selected in silico (Sat286, Satt229, GmPrx1, GMES1173, Satt571 and Gm Hi), plus two previously reported markers (GmF35H and SoyF3H). All were evaluated in 35 soybean cultivars. The SSRs GmPrx1 and Gm Hi selected for seed coat peroxidase and hilum color respectively were monomorphic. The mean Polymorphism Information Content (PI C) value within the selected group of polymorphic markers was 0.48 with an average of 3.12 allele per locus. GmF35H discriminated the soybean varieties according to the flower color (white and purple). Discrimination tests showed a high percentage of accurate classification of growth habit (95.8%) and pubescence color (80.6%) with Sat286 and Soy F3H, respectively. The classification values for pod color (74.2%) and leaflet size (73.5%) were intermediate using GMES1173 and Satt571, respectively. The marker Satt229 was not discriminating for flowering time (50%) and maturity (42.8%). Molecular markers selected in or close to sequences of interest can be integrated into a genetic identification system as complementary markers to the classic phenotypic descriptors of soybean varieties

  18. 77 FR 47922 - BNSF Railway Company-Trackage Rights Exemption-Northern Lines Railway, Inc.

    Science.gov (United States)

    2012-08-10

    ... includes: (a) Track 204 between 33rd Avenue North and Rice Junction, Minn.; and (b) Track 203 between milepost 0.0, at Rice Junction, and milepost 5.71, just west of the Highway I-94 overpass (the Lines). \\1....C.C. 605 (1978), as modified in Mendocino Coast Railway--Lease & Operate--California Western...

  19. Hepatitis B virus surface antigen and anti-hepatitis C virus rapid tests underestimate hepatitis prevalence among HIV-infected patients

    DEFF Research Database (Denmark)

    Hønge, Bo Langhoff; Jespersen, S; Medina, C

    2014-01-01

    . RESULTS: Two rapid tests were used in Guinea-Bissau: HBsAg Strip Ref 2034 (VEDA.LAB, Alençon, France; sensitivity 62.3%; specificity 99.2%) and HEPA-SCAN (Bhat Bio-Tech, Bangalore, India; sensitivity 57.1%; specificity 99.7%). In the two tests the ability to obtain the correct outcome depended...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 571 ... MRS Mlozi, EH Shayo, KP Senkoro, BK Mayala, SF Rumisha, B Mutayoba, E Senkondo, A Maerere, LEG Mboera. Vol 5, No 1 (2003) .... Vol 10, No 3 (2008), Prevalence and correlates of cigarette smoking among adolescents in Malawi: results from the Global Youth Tobacco Survey 2005, Abstract PDF.

  1. Arboviruses pathogenic for domestic and wild animals

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Rudolf, Ivo; Nowotny, N.

    2014-01-01

    Roč. 89, č. 5 (2014), s. 201-275 ISSN 0065-3527 Institutional support: RVO:68081766 Keywords : West-Nile virus * Tick-borne encephalitis * Louping-ill virus * Cache-Valley virus * African-swine-fever * California serogroup virus * Kyasanur-forest-disease * sparrows Passer domesticus Subject RIV: EE - Microbiology, Virology Impact factor: 4.571, year: 2014

  2. The Study of Externalizing and Internalizing Behaviours in Greek, Russian, Indian, and Chinese Children Using the Fairy Tale Test

    Science.gov (United States)

    Savina, Elena; Coulacoglou, Carina; Sanyal, Nilanjana; Zhang, Jianxin

    2012-01-01

    The present study investigated externalizing and internalizing behaviours in Greek (n = 599), Russian (n = 596), Indian (n = 571), and Chinese (n = 376) 7- to 12-year-old children. The Fairy Tale Test was used to measure impulsive and motivated aggression, fear of aggression, anxiety, and depression. The results indicated culture-specific patterns…

  3. Content Analysis of the "Professional School Counseling" Journal: The First Ten Years

    Science.gov (United States)

    Falco, Lia D.; Bauman, Sheri; Sumnicht, Zachary; Engelstad, Alicia

    2011-01-01

    The authors conducted a content analysis of the articles published in the first 10 volumes of the "Professional School Counseling" (PSC) journal, beginning in October 1997 when "The School Counselor" merged with "Elementary School Counseling and Guidance". The analysis coded a total of 571 articles into 20 content categories. Findings address the…

  4. Atlantic and Mediterranean synoptic drivers of central Spanish juniper growth

    Czech Academy of Sciences Publication Activity Database

    Esper, J.; Großjean, J.; Camarero, J. J.; Garcia-Cervigón, A. I.; Olano, J. M.; González-Rouco, J. F.; Dominiguez-Castro, F.; Büntgen, Ulf

    2015-01-01

    Roč. 121, 3-4 (2015), s. 571-579 ISSN 0177-798X R&D Projects: GA MŠk(CZ) EE2.3.20.0248 Institutional support: RVO:67179843 Keywords : rogation ceremonies * Nort-atlantic * temporal patterns * climate * Spain * variability * reconstruction Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 2.433, year: 2015

  5. Assessing uncertainties of water footprints using an ensemble of crop growth models on winter wheat

    Czech Academy of Sciences Publication Activity Database

    Kersebaum, K. C.; Kroes, J.; Gobin, A.; Takáč, J.; Hlavinka, Petr; Trnka, Miroslav; Ventrella, D.; Giglio, L.; Ferrise, R.; Moriondo, M.; Marta, A. D.; Luo, Q.; Eitzinger, Josef; Mirschel, W.; Weigel, H-J.; Manderscheid, R.; Hofmann, M.; Nejedlík, P.; Hösch, J.

    2016-01-01

    Roč. 8, č. 12 (2016), č. článku 571. ISSN 2073-4441 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LD13030 Institutional support: RVO:67179843 Keywords : water footprint * uncertainty * model ensemble * wheat Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.832, year: 2016

  6. A nano approach to consolidation of degraded historic lime mortars

    Czech Academy of Sciences Publication Activity Database

    Drdácký, Miloš; Slížková, Zuzana; Ziegenbalg, G.

    2009-01-01

    Roč. 8, č. 2 (2009), s. 13-22 ISSN 1662-5250 R&D Projects: GA ČR(CZ) GA103/06/1609 Institutional research plan: CEZ:AV0Z20710524 Keywords : lime water * calcium hydroxide nanosuspension * lime mortar Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 0.571, year: 2009

  7. Crystallization and preliminary diffraction analysis of Escherichia coli WrbA in complex with its cofactor flavin mononucleotide

    Czech Academy of Sciences Publication Activity Database

    Wolfová, Julie; Mesters, J. R.; Brynda, Jiří; Grandori, R.; Natalello, A.; Carey, J.; Kutá-Smatanová, Ivana

    2007-01-01

    Roč. 63, Pt7 (2007), s. 571-575 ISSN 1744-3091 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z60870520 Keywords : WrbA * flavodoxin * crystal structure Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.645, year: 2007

  8. Detection and characterization of feline Bartonella henselae in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Melter, O.; Hercík, Kamil; Weyant, R. S.; Janeček, Jiří; Němec, A.; Mecera, J.; Gonzorová, L.; Branny, Pavel

    2003-01-01

    Roč. 93, - (2003), s. 261-273 ISSN 0378-1135 R&D Projects: GA ČR GA310/98/0417; GA ČR GP204/02/D121 Institutional research plan: CEZ:AV0Z5020903 Keywords : bartonella henselae * cat * molecular typing Subject RIV: EE - Microbiology, Virology Impact factor: 1.571, year: 2003

  9. Diethyl 3H-naphtho[2,1-b]pyran-2,3-dicarboxylate

    Directory of Open Access Journals (Sweden)

    Abdullah Mohamed Asiri

    2009-04-01

    Full Text Available The sp3-hybridized methine C atom in the title compound, C19H18O5, lies out of the mean plane of the remaining 13 atoms of the naphthopyran fused-ring system by 0.571 (1 Å, and its H atom occupies a pseudo-equatorial site.

  10. The adenylate cyclase toxin from Bordetella pertussis - a novel promising vehicke fer antigen delivery to dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Šimšová, Marcela; Šebo, Peter; Leclerc, C.

    2004-01-01

    Roč. 293, - (2004), s. 571-576 ISSN 1438-4221 R&D Projects: GA ČR GA310/01/0934; GA AV ČR IAA5020907 Grant - others:GA QLK2-CT-1999(XX) 00556 Keywords : cyaa * cellular immune response * antigen delivery Subject RIV: EE - Microbiology, Virology Impact factor: 2.919, year: 2004

  11. Control over the biological synthesis of Ag nanoparticles by selection of the specific algal species

    Czech Academy of Sciences Publication Activity Database

    Sedlaková-Kaduková, J.; Velgosová, O.; Vosátka, Miroslav; Lukavský, Jaromír; Dodd, J. C.; Willner, J.; Fornalczyk, A.

    2017-01-01

    Roč. 62, č. 3 (2017), s. 1439-1442 ISSN 1733-3490 R&D Projects: GA TA ČR TE01020080 Institutional support: RVO:67985939 Keywords : nannoparticles * silver * algae * Parachlorella kessleri * Dictyosphaerium chlorelloides * Desmodesmus quadricauda Subject RIV: EI - Biotechnology ; Bionics OBOR OECD: Nano -materials (production and properties) Impact factor: 0.571, year: 2016

  12. Publications | Page 58 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 571 - 580 of 6373 ... This entails development of mechanisms whereby redress can be sought when human rights. ... Seear''s analysis of risk, the constitution of the patient through the medical encounter, and the ambiguities of self-care all have important implications for the sociology of medicine and gender. The book ...

  13. 48 CFR 1233.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... Alternative dispute resolution (ADR). (c) The Administrative Dispute Resolution Act (ADRA) of 1990, Public Law... Specialist, who is responsible for the operations of the Center for Alternative Dispute Resolution, (C-4... alternative means of dispute resolution set forth in the ADRA, 5 U.S.C. 571(3) on a non-reimbursable basis for...

  14. Evaluation of Pharmaceutical and Microbial Qualities of Some ...

    African Journals Online (AJOL)

    Phytochemical tests were carried out to assess the class of compounds present in the formulations and the microbial quality of the products was also evaluated. Results: The results show that twelve (57.1%) of the products had their manufacturing and expiry dates stated, nine (42.9%) products have been registered by ...

  15. Selective use of the biphasic-contrast barium enema study for evaluation of colonic lesions: Results of a prospective study

    International Nuclear Information System (INIS)

    De Lange, E.E.; Shaffer, H.A. Jr.; Riddervold, H.O.

    1987-01-01

    The authors performed a prospective study to determine the value of selective use of the biphasic contrast technique for a variety of indications. In a series of 571 double-contrast barium enema examinations, the examination was immediately followed by a single-contrast study in 85 cases. The biphasic procedure was performed to reexamine a colonic segment that was poorly evaluated initially because of diverticulosis (eta = 35), incomplete filling (eta = 28), or poor mucosal coating (eta = 26); or to verify or exclude a possible lesion identified during the double-contrast examination (eta = 22). The single-contrast study confirmed five polyps and excluded lesions in 17 cases with suspected polyps (eta = 5), strictures (eta = 4), and spasm (eta = 8). Six polyps not visualized on the double-contrast examination were detected with the single-contrast procedure

  16. 49 CFR 571.208a - Optional test procedures for vehicles manufactured between January 27, 2004 and August 31, 2004.

    Science.gov (United States)

    2010-10-01

    ... with the vehicles brake or clutch pedal, rotate the test dummy's left foot about the leg. If there is... pedal in that position. S16.3.2.2.2 If the ball of the foot does not contact the pedal, change the angle... the vehicle's brake or clutch pedal, rotate the test dummy's left foot about the lower leg. If there...

  17. Epidemiological study on varicose veins in Budapest.

    Science.gov (United States)

    Bihari, I; Tornoci, L; Bihari, P

    2012-03-01

    To analyse the prevalence and risk factors of varicose veins and chronic venous disease in Budapest. Data were collected using a questionnaire, as well as by performing physical and Doppler ultrasound examination of 566 adult inhabitants of Budapest and some neighbouring villages. The prevalence of lower-extremity varicose veins was 57.1% in the study population. Verified risk factors include advancing age, pregnancy, jobs requiring a lot of standing, blue-collar work and excess body weight. Neither female gender nor the use of oral contraceptives or hormone replacement therapy was identified as a contributing factor. Hungarian prevalence data and risk factors seem to be similar to other European countries.

  18. Is the routine use of bevacizumab in the treatment of women with advanced or recurrent cancer of the cervix sustainable?

    Directory of Open Access Journals (Sweden)

    Klag N

    2016-06-01

    Full Text Available Natalie Klag, Adam C Walter, Kristen M Sheely, Kelly J Manahan, John P Geisler Division of Gynecologic Oncology, Cancer Treatment Centers of America Newnan, Georgia, USA Background: New chemotherapy combinations are being tested for the treatment of women with advanced, persistent or recurrent cervical cancer. We sought to evaluate the cost effectiveness of some newer combination therapies in cervical cancer. Patients and methods: A cost effectiveness decision model was used to analyze Gynecologic Oncology Group 240. All regimens were modeled for seven cycles. The regimens studied are as follows: regimen 1, cisplatin/paclitaxel (CP; regimen 2, CP with bevacizumab (CP+B; regimen 3, paclitaxel/topotecan (PT; and regimen 4, PT with bevacizumab (PT+B. Overall survival, cost, and complications were studied. Sensitivity analyses were performed. Results: Mean chemotherapy costs over mean total costs for seven cycles of each follows: CP $571/$32,966; CP+B $61,671/$96,842; PT $9,211/$71,620; and PT+B $70,312/$109,211. Incremental cost-effectiveness ratio (ICER for CP+B was $133,559/quality adjusted life year (QALY. ICER for PT+B was $124,576/QALY. To achieve an incremental ICER for CP+B:CP of <$50,000/QALY gained, the mean overall survival has to increase from 1.1 years with CP to 3.5 years with CP+B. An ICER <$50,000/QALY for the other regimens would take a survival of >10 years for PT and 4.1 years for PT+B. Treating 1,000 women with cervical cancer with CP+B would cost almost double the cost of treating >18,000 women with ovarian cancer annually (carboplatin/paclitaxel. Conclusion: CP is the most cost effective regimen. A 12-month increase in overall survival will not even make the newer combinations cost effective. Currently, the use of bevacizumab is not sustainable at today's costs. Keywords: cervical cancer, chemotherapy, bevacizumab, cost-effectiveness

  19. MERTK interactions with SH2-domain proteins in the retinal pigment epithelium.

    Science.gov (United States)

    Shelby, Shameka J; Colwill, Karen; Dhe-Paganon, Sirano; Pawson, Tony; Thompson, Debra A

    2013-01-01

    The receptor tyrosine kinase MERTK plays an essential role in the phagocytic uptake of shed photoreceptor membranes by the retinal pigment epithelium (RPE). A fundamental aspect of signal transduction by receptor tyrosine kinases involves autophosphorylation of tyrosine residues that recruit Src-homology 2 (SH2)-domain proteins to the receptor intracellular domain. The goal of the current study was to evaluate the interactions of human MERTK with SH2-domain proteins present in the RPE. The MERTK intracellular domain was expressed as a 6xHis-fusion protein (6xHis-rMERTK(571-999)), purified and phosphorylated. Ni(2+)-NTA pull downs were performed using 6xHis-rMERTK(571-999) in incubations with recombinant phosphotyrosine-recognition sequences expressed as GST-fusion proteins. In addition, pull downs of native SH2-domain proteins were performed using 6xHis-rMERTK(571-999) and protein homogenates from rat RPE/choroid. For both recombinant and native proteins, western analysis detected MERTK interactions with GRB2, PIK3R1 (P85α), VAV3, and SRC. Immunohistochemical analysis localized each protein to mouse RPE. In cultured RPE-J cells incubated with rod outer segments (OS), siRNA knockdown of Grb2 had no effect on OS binding, but significantly reduced OS uptake. Pik3r1 localized to early phagosomes along with Rab5 and Eea1. Phosphorylation and activation of Src was detected downstream of phagocytosis and Mertk activation. These findings suggest that MERTK signaling in the RPE involves a cohort of SH2-domain proteins with the potential to regulate both cytoskeletal rearrangement and membrane movement. Identification of the SH2-domain signaling partners of MERTK is an important step toward further defining the mechanism of RPE phagocytosis that is central to the function and survival of the retina.

  20. MERTK interactions with SH2-domain proteins in the retinal pigment epithelium.

    Directory of Open Access Journals (Sweden)

    Shameka J Shelby

    Full Text Available The receptor tyrosine kinase MERTK plays an essential role in the phagocytic uptake of shed photoreceptor membranes by the retinal pigment epithelium (RPE. A fundamental aspect of signal transduction by receptor tyrosine kinases involves autophosphorylation of tyrosine residues that recruit Src-homology 2 (SH2-domain proteins to the receptor intracellular domain. The goal of the current study was to evaluate the interactions of human MERTK with SH2-domain proteins present in the RPE. The MERTK intracellular domain was expressed as a 6xHis-fusion protein (6xHis-rMERTK(571-999, purified and phosphorylated. Ni(2+-NTA pull downs were performed using 6xHis-rMERTK(571-999 in incubations with recombinant phosphotyrosine-recognition sequences expressed as GST-fusion proteins. In addition, pull downs of native SH2-domain proteins were performed using 6xHis-rMERTK(571-999 and protein homogenates from rat RPE/choroid. For both recombinant and native proteins, western analysis detected MERTK interactions with GRB2, PIK3R1 (P85α, VAV3, and SRC. Immunohistochemical analysis localized each protein to mouse RPE. In cultured RPE-J cells incubated with rod outer segments (OS, siRNA knockdown of Grb2 had no effect on OS binding, but significantly reduced OS uptake. Pik3r1 localized to early phagosomes along with Rab5 and Eea1. Phosphorylation and activation of Src was detected downstream of phagocytosis and Mertk activation. These findings suggest that MERTK signaling in the RPE involves a cohort of SH2-domain proteins with the potential to regulate both cytoskeletal rearrangement and membrane movement. Identification of the SH2-domain signaling partners of MERTK is an important step toward further defining the mechanism of RPE phagocytosis that is central to the function and survival of the retina.

  1. 78 FR 36716 - Approval and Promulgation of Air Quality Implementation Plans; Pennsylvania; Philadelphia County...

    Science.gov (United States)

    2013-06-19

    ... reflects RACT for the 1997 8-hour ozone standard based on the current availability of technically and...,069 High-gloss 420 841 1,069 High-temperature 500 1,237 1,597 Inorganic zinc high-build 340 571 728... containing VOC, including cloth and paper, in closed containers; (2) maintaining lids on any VOC-bearing...

  2. Small Flux Buoy for Characterizing Marine Surface Layers

    Science.gov (United States)

    2013-06-01

    platform for air-sea interaction study since early 1960s (Fisher and Spiess 1963). It was designed to be a stable platform for mounting various types of...COARE algorithm. J. of Climate, 16, 571–591. Fisher F. H., and F. N. Spiess , 1963: FLIP-floating instrument platform. J. Acoust. Soc. Am., 35, 1633

  3. 77 FR 751 - Federal Motor Vehicle Safety Standards; Matters Incorporated by Reference

    Science.gov (United States)

    2012-01-06

    ... Recommended Practice J1133, ``School Bus Stop Arm,'' revised April 1984, into Sec. 571.131. (45) SAE Standard... constriction requirement of S5.3.1 after having been subjected to a temperature of 248 degrees Fahrenheit (120... mandatory requirements. * * * * * S6.4.5 School bus signal lamp aiming. Each school bus signal lamp must be...

  4. Simultaneous use of 82Br and 24Na radionuclides in the whole-body counting of animals by high-resolution gamma-ray spektrometry

    Czech Academy of Sciences Publication Activity Database

    Pavelka, Stanislav; Babický, Arnošt; Vobecký, Miloslav

    2008-01-01

    Roč. 278, č. 3 (2008), s. 571-574 ISSN 0236-5731 Grant - others:EC(XE) LSHG-CT-2004-511978 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : gamma-spectrometry * whole-body counting * radionuclide Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.659, year: 2008

  5. Integrated Theory of Planned Behavior with Extrinsic Motivation to Predict Intention Not to Use Illicit Drugs by Fifth-Grade Students in Taiwan

    Science.gov (United States)

    Liao, Jung-Yu; Chang, Li-Chun; Hsu, Hsiao-Pei; Huang, Chiu-Mieh; Huang, Su-Fei; Guo, Jong-Long

    2017-01-01

    This study assessed the effects of a model that integrated the theory of planned behavior (TPB) with extrinsic motivation (EM) in predicting the intentions of fifth-grade students to not use illicit drugs. A cluster-sampling design was adopted in a cross-sectional survey (N = 571). The structural equation modeling results showed that the model…

  6. Osteogenic Differentiation of Miniature Pig Mesenchymal Stem Cells in 2D and 3D Environment

    Czech Academy of Sciences Publication Activity Database

    Juhásová, Jana; Juhás, Štefan; Klíma, Jiří; Strnádel, Ján; Holubová, Monika; Motlík, Jan

    2011-01-01

    Roč. 60, č. 3 (2011), s. 559-571 ISSN 0862-8408 R&D Projects: GA MŠk 1M0538; GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50450515 Keywords : miniature pig * mesenchymal stem cells * cell differentiation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.555, year: 2011

  7. Utilization of Singularity Exponent in Nearest Neighbor Based Classifier

    Czech Academy of Sciences Publication Activity Database

    Jiřina, Marcel; Jiřina jr., M.

    2013-01-01

    Roč. 30, č. 1 (2013), s. 3-29 ISSN 0176-4268 Grant - others:Czech Technical University(CZ) CZ68407700 Institutional support: RVO:67985807 Keywords : multivariate data * probability density estimation * classification * probability distribution mapping function * probability density mapping function * power approximation Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.571, year: 2013

  8. Attitudinal and motivational factors influencing job performance of ...

    African Journals Online (AJOL)

    The study investigated the attitudinal and motivational factors influencing job performance of female extension agents in Edo State, Nigeria. A random sample of 35 female extension agents was selected for the study. Findings reveal that the majority of the respondents (57.1%) were in the age group of 31 – 40 years and ...

  9. Non-Catalytic Reforming with Applications to Portable Power

    Science.gov (United States)

    2013-10-01

    Mokhov, and H.B. Levinsky, A laser-induced fluorescence and coherent anti-Stokes Raman scattering study of NO formation in preheated, laminar, rich...Flame, 1995. 100(4): p. 571- 590 . 43. Evertsen, R., J.A. Van Oijen, R.T.E. Hermanns, L.P.H. De Goey, and J.J. Ter Meulen, Measurements of absolute

  10. Progressive Supranuclear Palsy Misdiagnosed as Parkinson's ...

    African Journals Online (AJOL)

    cerebellar peduncle were 0.30 cm2 and 0.28 cm on the right and left sides, respectively [Figure 2], and the pons to mid‑brain ratio was 5.71 [Figure 3]. ..... Longoni G, Agosta F, Kostić VS, Stojković T, Pagani E,. Stošić‑Opinćal T, et al.

  11. Thermophysical properties of the CsPbCl.sub.3./sub. single crystal using pulse transient method

    Czech Academy of Sciences Publication Activity Database

    Kubičár, L.; Boháč, V.; Nitsch, Karel

    2000-01-01

    Roč. 21, č. 2 (2000), s. 571-583 ISSN 0195-928X. [Asian Thermophysical Properties Conference /5./. Seoul, 30.08.1998-02.09.1998] R&D Projects: GA AV ČR IAA2010926 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.569, year: 2000

  12. Evaluación de un método de aglutinación con látex para la detección de factor reumatoide Evaluation of a latex agglutination method for the detection of rheumatoid factor

    Directory of Open Access Journals (Sweden)

    Ana M. Guerreiro Hernández

    2008-04-01

    Full Text Available Se evaluó un método de aglutinación con látex de producción nacional (Centis, para la detección de factor reumatoide, empleándose como procedimiento de referencia un ensayo turbidimétrico con látex (Spin React, España en un grupo de pacientes con artritis reumatoide. Los resultados obtenidos en el método evaluado: sensibilidad 93 %; especificidad 80 %; valor predictivo positivo 97,6 %; valor predictivo negativo 57,1 %; y un límite de detección de 15 UI/mL, indican su calidad y utilidad.An agglutination method with latex of national production (Centis was evaluated to detect the rheumatoid factor by using a turbidimetric assay with latex (Spin React, Spain as a reference procedure in a group of patients with rheumatoid arthritis. The results obtained in the evaluated method (sensitivity 93 %, specificity 80 %, positive predictive value 97.6 %, negative predictive value 57.1 %, and a detection limit of 15 UI/mL showed its quality and usefulness.

  13. A Classification Method of Technical Security Controls for Digital I and C Systems in NPPs

    International Nuclear Information System (INIS)

    Song, J. G.; Lee, J. W.; Park, G. Y.; Kwon, K. C.; Lee, D. Y.; Lee, C. K.

    2012-01-01

    The instrumentation and control (I and C) systems in nuclear power plants (NPPs) are a key facility to monitor plant state, control plant devices, and prevent accidents. Recent I and C systems have been composed of digital systems in order to enhance the effectiveness of operation and maintenance of NPPs. An assessment method for the analysis of security controls is needed to respond to potential cyber attacks against digital I and C systems. RG 5.71 'Cyber Security Programs for Nuclear Facilities' published by U.S.NRC in 2010 presents a comprehensive set of security controls for NPPs. Although this document provides the requirements of security controls, a guidance describing which security controls should be applied to specific digital assets and how to implement them is still needed for the I and C system design and development. In this paper, a classification method of the technical security controls listed in RG 5.71 is proposed to provide a guide useful for the application of the controls during the design and implementation phases of I and C systems

  14. A Classification Method of Technical Security Controls for Digital I and C Systems in NPPs

    Energy Technology Data Exchange (ETDEWEB)

    Song, J. G.; Lee, J. W.; Park, G. Y.; Kwon, K. C.; Lee, D. Y.; Lee, C. K. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2012-05-15

    The instrumentation and control (I and C) systems in nuclear power plants (NPPs) are a key facility to monitor plant state, control plant devices, and prevent accidents. Recent I and C systems have been composed of digital systems in order to enhance the effectiveness of operation and maintenance of NPPs. An assessment method for the analysis of security controls is needed to respond to potential cyber attacks against digital I and C systems. RG 5.71 'Cyber Security Programs for Nuclear Facilities' published by U.S.NRC in 2010 presents a comprehensive set of security controls for NPPs. Although this document provides the requirements of security controls, a guidance describing which security controls should be applied to specific digital assets and how to implement them is still needed for the I and C system design and development. In this paper, a classification method of the technical security controls listed in RG 5.71 is proposed to provide a guide useful for the application of the controls during the design and implementation phases of I and C systems

  15. Non-uniformity of phase structure in immiscible polymer blends

    Czech Academy of Sciences Publication Activity Database

    Fortelný, Ivan; Lapčíková, Monika; Lednický, František; Starý, Zdeněk; Kruliš, Zdeněk

    2008-01-01

    Roč. 48, č. 3 (2008), s. 564-571 ISSN 0032-3888 R&D Projects: GA ČR GA106/06/0729; GA ČR GA106/06/0761 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * melt mixing * non-uniform morphology Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.245, year: 2008

  16. Materialism, Stress and Health Behaviors among Future Educators

    Science.gov (United States)

    Brouskeli, Vasiliki; Loumakou, Maria

    2014-01-01

    In this study we investigated materialism among future educators and its relationship with stress and a number of health behaviors. Participants were 228 students (Mean = 20.64 years of age, S.D = 2.571) of the Department of Education Sciences in Early Childhood of the University of Thrace, Greece. The instrument consisted of a short form of the…

  17. On compactoid and limited sets in non-Archimedean locally convex ...

    African Journals Online (AJOL)

    In [2] and [3] spaces in which every bounded subset is a compactoid was studied. Every compactoid set is limited but the converse is not true [3]. In this paper, we shall study some spaces in which every limited set is compactoid. Journal of the Nigerian Association of Mathematical Physics Vol. 10 2006: pp. 571-574.

  18. Nochmals zum archäologischen Niederschlag der frühen Völkerwanderungszeit in Nordprovinzen des römischen Reiches

    Czech Academy of Sciences Publication Activity Database

    Tejral, Jaroslav

    2016-01-01

    Roč. 57, č. 1 (2016), s. 123-147 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Early Migration Period * Northern Roman Provinces * material culture reflection Subject RIV: AC - Archeology, Anthropology, Ethnology http://prehled-vyzkumu.arub.avcr.cz/miranda2/export/sitesavcr/arub-prehled-vyzkumu/prehled-cisel-a-clanku/prehled-vydanych-cisel/files/PV-57-1_tejral.pdf

  19. Remark on zeros of solutions of second-order linear ordinary differential equations

    Czech Academy of Sciences Publication Activity Database

    Dosoudilová, M.; Lomtatidze, Alexander

    2016-01-01

    Roč. 23, č. 4 (2016), s. 571-577 ISSN 1072-947X Institutional support: RVO:67985840 Keywords : second-order linear equation * zeros of solutions * periodic boundary value problem Subject RIV: BA - General Mathematics Impact factor: 0.290, year: 2016 https://www.degruyter.com/view/j/gmj.2016.23.issue-4/gmj-2016-0052/gmj-2016-0052. xml

  20. Classifying multi-model wheat yield impact response surfaces showing sensitivity to temperature and precipitation change

    Czech Academy of Sciences Publication Activity Database

    Fronzek, S.; Pirttioja, N. K.; Carter, T. R.; Bindi, M.; Hoffmann, H.; Palosuo, T.; Ruiz-Ramos, M.; Tao, F.; Trnka, Miroslav; Acutis, M.; Asseng, S.; Baranowski, P.; Basso, B.; Bodin, P.; Buis, S.; Cammarano, D.; Deligios, P.; Destain, M. F.; Dumont, B.; Ewert, F.; Ferrise, R.; Francois, L.; Gaiser, T.; Hlavinka, Petr; Jacquemin, I.; Kersebaum, K. C.; Kollas, C.; Krzyszczak, J.; Lorite, I. J.; Minet, J.; Ines Minguez, M.; Montesino, M.; Moriondo, M.; Mueller, C.; Nendel, C.; Öztürk, I.; Perego, A.; Rodriguez, A.; Ruane, A. C.; Ruget, F.; Sanna, M.; Semenov, M. A.; Slawinski, C.; Stratonovitch, P.; Supit, I.; Waha, K.; Wang, E.; Wu, L.; Zhao, Z.; Rötter, R.

    2018-01-01

    Roč. 159, jan (2018), s. 209-224 ISSN 0308-521X Institutional support: RVO:86652079 Keywords : climate - change * crop models * probabilistic assessment * simulating impacts * british catchments * uncertainty * europe * productivity * calibration * adaptation * Classification * Climate change * Crop model * Ensemble * Sensitivity analysis * Wheat Subject RIV: GC - Agronomy OBOR OECD: Agronomy, plant breeding and plant protection Impact factor: 2.571, year: 2016

  1. Sharks caught in the protective gill nets off KwaZulu-Natal, South ...

    African Journals Online (AJOL)

    Between 1978 and 1999, a total of 5 626 dusky sharks Carcharhinus obscurus, constituting 20% of the total shark catch, was caught in the protective nets off KwaZulu-Natal, South Africa. The mean annual catch was 256 sharks (SD = 107.5, range 129–571). There was no significant linear trend in catch rate with time.

  2. Remark on zeros of solutions of second-order linear ordinary differential equations

    Czech Academy of Sciences Publication Activity Database

    Dosoudilová, M.; Lomtatidze, Alexander

    2016-01-01

    Roč. 23, č. 4 (2016), s. 571-577 ISSN 1072-947X Institutional support: RVO:67985840 Keywords : second-order linear equation * zero s of solutions * periodic boundary value problem Subject RIV: BA - General Mathematics Impact factor: 0.290, year: 2016 https://www.degruyter.com/view/j/gmj.2016.23.issue-4/gmj-2016-0052/gmj-2016-0052.xml

  3. Response of inherently brittle materials on higher loading rates

    Czech Academy of Sciences Publication Activity Database

    Chlup, Zdeněk; Flašar, Petr; Dlouhý, Ivo

    2010-01-01

    Roč. 77, č. 2 (2010), s. 359-366 ISSN 0013-7944 R&D Projects: GA ČR GA101/09/1821; GA AV ČR IAA200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : Dynamic fracture toughness * Stress intensity factor * Ceramics Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.571, year: 2010

  4. Signaling through the PI 3-K, Akt and SGK Pathway in Breast Cancer Progression

    Science.gov (United States)

    2013-12-01

    Moritz A, Li Y, Guo A, Villen J, Wang Y, MacNeill J, et al. Akt-RSK-S6 Kinase 552 Signaling Networks Activated by Oncogenic Receptor Tyrosine Kinases. Sci...polarity by afadin during the formation of embryoid bodies. Genes Cells. 2008;13:79– 570 90. 571 23. Su L, Hattori M, Moriyama M, Murata N, Harazaki M

  5. Switching to olanzapine long-acting injection from either oral olanzapine or any other antipsychotic: comparative post hoc analyses

    Directory of Open Access Journals (Sweden)

    Ciudad A

    2013-11-01

    Full Text Available Antonio Ciudad,1 Ernie Anand,2 Lovisa Berggren,3 Marta Casillas,4 Alexander Schacht,3 Elena Perrin5 1Department of Clinical Research and Development, Eli Lilly & Co, Madrid, Spain; 2Neuroscience Medical Affairs – EU, Lilly Research Centre, Windlesham, Surrey, UK; 3Global Statistical Sciences, Eli Lilly & Co, Bad Homburg, Germany; 4European Scientific Communications, Eli Lilly & Co, Madrid, Spain; 5Medical Department, Eli Lilly & Co, Suresnes, Paris, France Background: A considerable proportion of patients suffering from schizophrenia show suboptimal responses to oral antipsychotics due to inadequate adherence. Hence, they are likely to benefit from switching to a long-acting injectable formulation. These post hoc analyses assessed the clinical effects of switching to olanzapine long-acting injection (OLAI from either oral olanzapine (OLZ or other antipsychotics (non-OLZ. Methods: Post hoc analyses were done based on two randomized studies (one short-term, one long-term conducted in patients suffering from schizophrenia and treated with OLAI. The short-term study was an 8-week placebo-controlled, double-blind trial in acute patients, and the long-term study was a 2-year, oral olanzapine-controlled, open-label, follow-up of stabilized outpatients. Results: These analyses used data from 62 OLAI-treated patients (12 switched from OLZ, 50 from non-OLZ from the short-term study and 190 OLAI-treated patients (56 switched from OLZ, 134 from non-OLZ from the long-term study. Kaplan–Meier survival analyses of time to all-cause discontinuation of OLAI treatment did not differ significantly between OLZ and non-OLZ patients in the short-term study (P=0.209 or long-term study (P=0.448. Similarly, the proportions of OLZ and non-OLZ patients that discontinued OLAI were not statistically different in the short-term (16.7% versus 36.0%, respectively; P=0.198 or long-term (57.1% versus 47.8% respectively; P=0.238 studies. In the short-term study, no

  6. Comparison of maternal and fetal outcomes among Asian Indian pregnant women with or without gestational diabetes mellitus: A situational analysis study (WINGS-3

    Directory of Open Access Journals (Sweden)

    Manni Mohanraj Mahalakshmi

    2016-01-01

    Full Text Available Aim: To compare the existing maternal and fetal outcomes in Asian Indian women with or without gestational diabetes mellitus (GDM before the development of the Women in India with GDM Strategy (WINGS GDM model of care (MOC. Materials and Methods: Records of pregnant women were extracted retrospectively from three maternity centers in Chennai. GDM was diagnosed using the International Association for Pregnancy Study Groups criteria or the Carpenter and Coustan criteria. Demographic details, obstetric history, antenatal follow-up, treatment for GDM, and outcomes of delivery were collected from the electronic medical records. Results: Of the 3642 records analyzed, 799 (21.9% had GDM, of whom 456 (57.1% were treated with insulin and medical nutrition therapy (MNT, 339 (42.4% with MNT alone, and 4 (0.5% with metformin. Women with GDM were older than those without (28.5 ± 4.5 vs. 27.1 ± 4.5 years; P < 0.001 and had higher mean body mass index at first booking (26.4 ± 5.2 kg/m2 vs. 25.2 ± 5.1 kg/m2; P < 0.001. Rates of cesarean section (26.2% vs. 18.7%; P < 0.001, preeclampsia (1.8% vs. 0.8%; P = 0.04, and macrosomia (13.9% vs. 10.8%; P = 0.02 were significantly higher among women with GDM. In women with GDM treated with insulin and MNT, emergency cesarean section (16.2% vs. 36.6%; P < 0.0001, preeclampsia (0.7% vs. 3.2%; P = 0.015, and macrosomia (9.9% vs. 18.6%; P = 0.0006 were significantly lesser compared to those treated with MNT alone. Conclusion: Pregnancy outcomes were in general worse in GDM women. Treatment with insulin was associated with a significantly lower risk of complications. However, in countries with limited access to insulin and other medicines may lead to poor follow-up and management of GDM. Data from this retrospective study will form the basis for the development of the WINGS GDM MOC, which will address these gaps in GDM care in low-resource settings.

  7. c-Abl is an upstream regulator of acid sphingomyelinase in apoptosis induced by inhibition of integrins αvβ3 and αvβ5.

    Directory of Open Access Journals (Sweden)

    Xiuhai Ren

    Full Text Available Inhibition of integrins αvβ3/αvβ5 by the cyclic function-blocking peptide, RGDfV (Arg-Gly-Asp-Phe-Val can induce apoptosis in both normal cells and tumor cells. We show that RGDfV induced apoptosis in ECV-304 carcinoma cells, increased activity and mRNA expression of acid sphingomyelinase (ASM, and increased ceramides C(16, C(18:0, C(24:0 and C(24:1 while decreasing the corresponding sphingomyelins. siRNA to ASM decreased RGDfV-induced apoptosis as measured by TUNEL, PARP cleavage, mitochondrial depolarization, and caspase-3 and caspase-8 activities, as well as by annexinV in a 3D collagen model. These findings indicate a causal role for ASM in RGDfV-induced apoptosis in ECV-304. We have shown that c-Abl, a non-receptor tyrosine kinase, also mediates RGDfV-induced apoptosis. However, c-Abl, has not been previously linked to ASM in any system. Here we show that STI-571 (imatinib, inhibitor of c-Abl inhibited RGDfV-induced ASM activity. Furthermore, STI-571 and c-Abl-siRNA both inhibited RGDfV-induced increase in ASM mRNA, but ASM-siRNA did not affect c-Abl phosphorylation or expression, supporting that c-Abl regulates the RGDfV-induced increase in ASM expression. These studies implicate ASM as a mediator of apoptosis induced by inhibition of integrins αvβ3/αvβ5, and for the first time place c-Abl as an upstream regulator of ASM expression and activity.

  8. Expression and activity of multidrug resistance protein 1 in a murine thymoma cell line

    Science.gov (United States)

    Echevarria-Lima, Juliana; Kyle-Cezar, Fernanda; Leite, Daniela F P; Capella, Luiz; Capella, Márcia A M; Rumjanek, Vivian M

    2005-01-01

    Multidrug resistance proteins [MRPs and P-glycoprotein (Pgp)] are members of the family of ATP-binding cassette (ABC) transport proteins, originally described as being involved in the resistance against anti-cancer agents in tumour cells. These proteins act as ATP-dependent efflux pumps and have now been described in normal cells where they exert physiological roles. The aim of this work was to investigate the expression and activity of MRP and Pgp in the thymoma cell line, EL4. It was observed that EL4 cells expressed mRNA for MRP1, but not for MRP2, MRP3 or Pgp. The activity of ABC transport proteins was evaluated by using the efflux of the fluorescent probes carboxy-2′-7′-dichlorofluorescein diacetate (CFDA) and rhodamine 123 (Rho 123). EL4 cells did not retain CFDA intracellularly, and MRP inhibitors (probenecid, indomethacin and MK 571) decreased MRP1 activity in a concentration-dependent manner. As expected, EL4 cells accumulated Rho 123, and the presence of cyclosporin A and verapamil did not modify this accumulation. Most importantly, when EL4 cells were incubated in the presence of the MRP1 inhibitors indomethacin and MK 571 for 6 days, they started to express CD4 and CD8 molecules on their surface, producing double-positive cells and CD8 single-positive cells. Our results suggest that MRP activity is important for the maintenance of the undifferentiated state in this cell type. This finding might have implications in the physiological process of normal thymocyte maturation. PMID:15804283

  9. Impact of the integration of proton magnetic resonance imaging spectroscopy to PI-RADS 2 for prediction of high grade and high stage prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Leapman, Michael S.; Wang, Zhen J.; Behr, Spencer C.; Kurhanewicz, John; Zagoria, Ronald J.; Carroll, Peter R.; Westphalen, Antonio C., E-mail: antonio.westphalen@ucsf.edu [University of California, San Francisco, CA (United States)

    2017-09-15

    Objective: To compare the predictions of dominant Gleason pattern ≥ 4 or non-organ confined disease with Prostate Imaging Reporting and Data System (PI-RADS v2) with or without proton magnetic resonance spectroscopic imaging ({sup 1}H-MRSI). Materials and Methods: Thirty-nine men underwent 3-tesla endorectal multiparametric MRI including {sup 1}H-MRSI and prostatectomy. Two radiologists assigned PI-RADS v2 and {sup 1}H-MRSI scores to index lesions. Statistical analyses used logistic regressions, receiver operating characteristic (ROC) curves, and 2 x 2 tables for diagnostic accuracies. Results: The sensitivity and specificity of {sup 1}H-MRSI and PI-RADS v2 for high-grade prostate cancer (PCa) were 85.7% (57.1%) and 92.9% (100%), and 56% (68.0%) and 24.0% (24.0%). The sensitivity and specificity of {sup 1}H-MRSI and PI-RADS v2 for extra-prostatic extension (EPE) were 64.0% (40%) and 20.0% (48%), and 50.0% (57.1%) and 71.4% (64.3%). The area under the ROC curves (AUC) for prediction of high-grade prostate cancer were 0.65 and 0.61 for PI-RADS v2 and 0.72 and 0.70 when combined with {sup 1}H-MRSI (readers 1 and 2, p = 0.04 and 0.21). For prediction of EPE the AUC were 0.54 and 0.60 for PI-RADS v2 and 0.55 and 0.61 when combined with {sup 1}H-MRSI (p > 0.05). Conclusion: {sup 1}H-MRSI might improve the discrimination of high-grade prostate cancer when combined to PI-RADS v2, particularly for PI-RADS v2 score 4 lesions, but it does not affect the prediction of EPE. (author)

  10. Impact of the integration of proton magnetic resonance imaging spectroscopy to PI-RADS 2 for prediction of high grade and high stage prostate cancer

    International Nuclear Information System (INIS)

    Leapman, Michael S.; Wang, Zhen J.; Behr, Spencer C.; Kurhanewicz, John; Zagoria, Ronald J.; Carroll, Peter R.; Westphalen, Antonio C.

    2017-01-01

    Objective: To compare the predictions of dominant Gleason pattern ≥ 4 or non-organ confined disease with Prostate Imaging Reporting and Data System (PI-RADS v2) with or without proton magnetic resonance spectroscopic imaging ("1H-MRSI). Materials and Methods: Thirty-nine men underwent 3-tesla endorectal multiparametric MRI including "1H-MRSI and prostatectomy. Two radiologists assigned PI-RADS v2 and "1H-MRSI scores to index lesions. Statistical analyses used logistic regressions, receiver operating characteristic (ROC) curves, and 2 x 2 tables for diagnostic accuracies. Results: The sensitivity and specificity of "1H-MRSI and PI-RADS v2 for high-grade prostate cancer (PCa) were 85.7% (57.1%) and 92.9% (100%), and 56% (68.0%) and 24.0% (24.0%). The sensitivity and specificity of "1H-MRSI and PI-RADS v2 for extra-prostatic extension (EPE) were 64.0% (40%) and 20.0% (48%), and 50.0% (57.1%) and 71.4% (64.3%). The area under the ROC curves (AUC) for prediction of high-grade prostate cancer were 0.65 and 0.61 for PI-RADS v2 and 0.72 and 0.70 when combined with "1H-MRSI (readers 1 and 2, p = 0.04 and 0.21). For prediction of EPE the AUC were 0.54 and 0.60 for PI-RADS v2 and 0.55 and 0.61 when combined with "1H-MRSI (p > 0.05). Conclusion: "1H-MRSI might improve the discrimination of high-grade prostate cancer when combined to PI-RADS v2, particularly for PI-RADS v2 score 4 lesions, but it does not affect the prediction of EPE. (author)

  11. Health and Nutritional Status of Vegetarian Candidates for Bariatric Surgery and Practical Recommendations.

    Science.gov (United States)

    Sherf-Dagan, Shiri; Hod, Keren; Buch, Assaf; Mardy-Tilbor, Limor; Regev, Ziva; Ben-Porat, Tair; Sakran, Nasser; Goitein, David; Raziel, Asnat

    2018-01-01

    Data on vegetarianism and bariatric surgery (BS) are scarce. We herein describe the health and nutritional status of vegetarian patients who plan to undergo BS and propose combined recommendations for vegetarian patients who undergo BS, based on our clinical experience and current scientific literature in both nutrition fields. Cross-sectional analysis of a prospectively maintained database of all primary laparoscopic sleeve gastrectomies (LSG) performed at a bariatric center of excellence between January 2014 and November 2016 was carried out querying patients who declared a vegetarian or vegan lifestyle before surgery. Preoperative data collected included demographics, anthropometrics, dietary patterns, supplementation use, physical activity, smoking habits, co-morbidities, and blood tests. Each vegetarian was matched to five different omnivores based on age, gender, and BMI. During the study period, 1470 patients underwent primary LSG surgery (63.7% females). Twenty-one declared a vegetarian or vegan lifestyle (1.4%) pre-surgery. Most were classified as lacto-ovo (57.1%) and were driven from ethical reasons (85.7%). No differences were found between vegetarian and omnivore LSG candidates regarding co-morbidities and nutritional deficiencies, except for lower prevalence of impaired fasting glucose (14.3 vs. 47.1%;P = 0.007), lower ferritin levels (54.3 ± 50.5 vs. 96.8 ± 121.8 ng/ml; P = 0.052) and higher transferrin levels (313.9 ± 42.7 vs. 278.4 ± 40.4 mg/dl; P = 0.009) among the vegetarian cohort. Preoperative use of vitamin B12 and iron supplementation was higher among vegetarian LSG candidates than their omnivore counterparts (57.1 vs. 6.7%;P nutritional deficiencies, lower iron stores, and higher supplementation use before surgery compared to omnivore LSG candidates.

  12. Recombinant Activated Factor VIIa (rFVIIa) Treatment in Very-Low-Birth-Weight (VLBW) Premature Infants with Acute Pulmonary Hemorrhage: A Single-Center, Retrospective Study.

    Science.gov (United States)

    Cosar, Hese; Isik, Halil; Cakır, Salih Cagrı; Yar, Nese; Goksen, Bulent; Tokbay, Hakan; Kertmen, Hasan; Erdoğan, Nihal; Durak, Ikbal

    2017-02-01

    We aimed to evaluate the efficacy of intravenous administration of recombinant activated factor VIIa (rFVIIa) for acute pulmonary hemorrhage treatment in very-low-birth-weight (VLBW) premature infants. This study was carried out retrospectively in premature infants with pulmonary hemorrhage that were ≤30 weeks gestational age or hemorrhage who were hospitalized in our neonatal intensive care unit between 01 January 2013 and 31 December 2015 were evaluated. Group 1 (n = 21) received rFVIIa support within the first 30 min of pulmonary hemorrhage plus conventional treatment, while Group 2 (n = 21) received conventional treatment only. The number of patients whose pulmonary hemorrhage was stopped within the first 2 h was significantly higher in Group 1 than Group 2 (n = 14 vs n = 4; p = 0.002). After pulmonary hemorrhage, hemoglobin values of Group 1 were higher than Group 2 (11.12 ± 1.06 vs 10.14 ± 1.59 g/dL; p = 0.024). Erythrocyte suspension (1.43 ± 4.51 vs 5.71 ± 7.46 mL/kg; p = 0.030) and fresh frozen plasma use (5.71 ± 8.10 vs 19.52 ± 12.44 mL/kg; p hemorrhage after 72 h, overall mortality, mortality from pulmonary hemorrhage, surfactant use, intubation time, hospitalization duration, intraventricular hemorrhage (IVH), severe IVH, patent ductus arteriosus rates, or short-term complication rates. rFVIIa administration was observed to be effective in stopping pulmonary hemorrhage, reducing blood product requirement, and improving coagulation test parameters. Prospective studies are needed to evaluate the efficacy, reliability, and long-term results of rFVIIa in the prevention and treatment of pulmonary hemorrhage in premature infants.

  13. 49 CFR 571.202a - Standard No. 202a; Head restraints; Mandatory applicability begins on September 1, 2009.

    Science.gov (United States)

    2010-10-01

    ... of adjustment within the specified range. S4.1Performance levels. In each vehicle other than a school... rear head restraint must conform to either S4.2 or S4.3 of this section. In each school bus, a head... the ambient temperature between 18 degrees C. and 28 degrees C. S5.1Except as specified in S5.2.3 and...

  14. Biomarkers in assessing residential insecticide exposures during pregnancy and effects on fetal growth

    International Nuclear Information System (INIS)

    Whyatt, R.M.; Camann, D.; Perera, F.P.; Rauh, V.A.; Tang, D; Kinney, P.L.; Garfinkel, R; Andrews, H.; Hoepner, L.; Barr, D.B.

    2005-01-01

    The Columbia Center for Children's Environmental Health is using a combination of environmental and biologic measures to evaluate the effects of prenatal insecticide exposures among urban minorities in New York City. Of the 571 women enrolled, 85% report using some form of pest control during pregnancy and 46% report using exterminators, can sprays, and/or pest bombs. Chlorpyrifos, diazinon, and propoxur were detected in 99.7-100% of 48-h personal air samples collected from the mothers during pregnancy (n = 394) and in 39-70% of blood samples collected from the mothers (n = 326) and/or newborns (n = 341) at delivery. Maternal and newborn blood levels are similar and highly correlated (r = 0.4-08, P 0.8). Results support recent regulatory action to phase out residential uses of these insecticides

  15. Analyzing health organizations' use of Twitter for promoting health literacy.

    Science.gov (United States)

    Park, Hyojung; Rodgers, Shelly; Stemmle, Jon

    2013-01-01

    This study explored health-related organizations' use of Twitter in delivering health literacy messages. A content analysis of 571 tweets from health-related organizations revealed that the organizations' tweets were often quoted or retweeted by other Twitter users. Nonprofit organizations and community groups had more tweets about health literacy than did other types of health-related organizations examined, including health business corporations, educational institutions, and government agencies. Tweets on health literacy topics focused predominantly on using simple language rather than complicated language. The results suggest that health organizations need a more strategic approach to managing positive organizational self-presentations in order to create an optimal level of exposure on social networking sites.

  16. Acute Aortic Dissection in a Third Trimester Pregnancy without Risk Factors

    Directory of Open Access Journals (Sweden)

    Elizabeth L Walters

    2011-05-01

    Full Text Available Spontaneous aortic dissection in pregnancy is rare and life threatening for both the mother and the fetus. Most commonly, it is associated with connective tissue disorders, cardiac valve variants, or trauma. We present the case of a 23-year-old previously healthy woman, 36 weeks pregnant with a syncopal episode after dyspnea and vomiting. She subsequently developed cardiac arrest and underwent aggressive resuscitation, emergent thoracotomy, and cesarean delivery without recovery. On autopsy, she was found to have an aortic dissection of the ascending aorta. This case is presented to raise awareness and review the literature and the clinical approach to critical care for pregnant patients. [West J Emerg Med. 2011;12(4:571–574.

  17. Time-dependent spectral-feature variations of stars displaying the B[e] phenomenon

    Czech Academy of Sciences Publication Activity Database

    Polster, J.; Korčáková, D.; Votruba, Viktor; Škoda, Petr; Šlechta, Miroslav; Kučerová, B.; Kubát, Jiří

    2012-01-01

    Roč. 542, June (2012), A57/1-A57/6 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GP205/09/P476; GA ČR GD205/08/H005 Institutional research plan: CEZ:AV0Z10030501 Keywords : line profiles * circumstellar matter * Be stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.084, year: 2012

  18. Performance of process-based models for simulation of grain N in crop rotations across Europe

    Czech Academy of Sciences Publication Activity Database

    Xiaogang, Y.; Kesebaum, K. C.; Kollas, C.; Manevski, K.; Baby, S.; Beaudoin, N.; Öztürk, I.; Gaiser, T.; Wu, L.; Hoffmann, M.; Charfeddine, M.; Conradt, T.; Constantin, J.; Ewert, F.; de Cortazar-Atauri, I. G.; Giglio, L.; Hlavinka, Petr; Hoffmann, H.; Launay, M.; Louarn, G.; Manderscheid, R.; Mary, B.; Mirschel, W.; Nendel, C.; Pacholski, A.; Palouso, T.; Ripoche-Wachter, D.; Rötter, R. P.; Ruget, F.; Sharif, B.; Trnka, Miroslav; Ventrella, D.; Weigel, H-J.; Olesen, J. E.

    2017-01-01

    Roč. 154, JUN (2017), s. 63-77 ISSN 0308-521X R&D Projects: GA MŠk(CZ) LO1415; GA MZe QJ1310123 Institutional support: RVO:67179843 Keywords : Calibration * Crop model * Crop rotation * Grain N content * Model evaluation * Model initialization Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.571, year: 2016

  19. Retention of dead standing plant biomass (marcescence) increases subsequent litter decomposition in the soil organic layer

    Czech Academy of Sciences Publication Activity Database

    Angst, Šárka; Cajthaml, T.; Angst, Gerrit; Šimáčková, H.; Brus, Jiří; Frouz, Jan

    2017-01-01

    Roč. 418, 1-2 (2017), s. 571-579 ISSN 0032-079X Institutional support: RVO:60077344 ; RVO:61389013 Keywords : photodegradation * C-13 CP/MAS NMR spectroscopy * litter decomposition * pyrolysis GC-MS * Calamagrostis epigeios * photo-facilitation Subject RIV: DF - Soil Science; CD - Macromolecular Chemistry (UMCH-V) OBOR OECD: Soil science; Polymer science (UMCH-V) Impact factor: 3.052, year: 2016

  20. The Stability, Sustained Release and Cellular Antioxidant Activity of Curcumin Nanoliposomes

    OpenAIRE

    Chen, Xing; Zou, Li-Qiang; Niu, Jing; Liu, Wei; Peng, Sheng-Feng; Liu, Cheng-Mei

    2015-01-01

    Curcumin is a multifunctional and natural agent considered to be pharmacologically safe. However, its application in the food and medical industry is greatly limited by its poor water solubility, physicochemical instability and inadequate bioavailability. Nanoliposome encapsulation could significantly enhance the solubility and stability of curcumin. Curcumin nanoliposomes exhibited good physicochemical properties (entrapment efficiency = 57.1, particle size = 68.1 nm, polydispersity index = ...

  1. Seismic activity around and under Krakatau volcano, Sunda Arc: constraints to the source region of island arc volcanics

    Czech Academy of Sciences Publication Activity Database

    Špičák, Aleš; Hanuš, Václav; Vaněk, Jiří

    2002-01-01

    Roč. 46, č. 3 (2002), s. 545-565 ISSN 0039-3169 R&D Projects: GA ČR GA205/97/0898; GA AV ČR IAA3012002 Institutional research plan: CEZ:AV0Z3012916 Keywords : Krakatau * Sunda Strait seismicity * island arc volcanism * subduction * Wadati-Benioff zone Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.571, year: 2002

  2. Initiation and propagation of fatigue cracks in cast IN713LC superalloy

    Czech Academy of Sciences Publication Activity Database

    Kunz, Ludvík; Lukáš, Petr; Konečná, R.

    2010-01-01

    Roč. 77, č. 11 (2010), s. 2008-2015 ISSN 0013-7944 R&D Projects: GA MPO FT-TA4/023; GA AV ČR 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : IN 713LC * high temperature fatigue * crystallographic fatigue crack initiation * mean stress effect Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.571, year: 2010

  3. Contribution Of Autopsy To Medical Practice In Cameroon: A 10 year ...

    African Journals Online (AJOL)

    Of 12.000 bodies received at the mortuary of the Yaounde General Hospital, 126 were autopsied in this 10-year retrospective study from 1997 to 2007, giving a rate of 1 autopsy in 100 deaths. 72.2% of cases were males against 27.8% females. The predominant age group was 20-69 years (57.1%). The main causes of ...

  4. Adaptation response surfaces for managing wheat under perturbed climate and COinf2/infin a Mediterranean environment

    Czech Academy of Sciences Publication Activity Database

    Ruiz-Ramos, M.; Ferrise, R.; Rodríguez, A.; Lorite, I. J.; Bindi, M.; Carter, T. R.; Fronzek, S.; Palosuo, T.; Pirttioja, N. K.; Baranowski, P.; Buis, S.; Cammarano, D.; Chen, Y.; Dumont, B.; Ewert, F.; Gaiser, T.; Hlavinka, Petr; Hoffmann, H.; Höhn, J.; Jurečka, František; Kersebaum, K. C.; Krzyszczak, J.; Lana, M.; Mechiche-Alami, A.; Minet, J.; Montesino, M.; Nendel, C.; Porter, J. R.; Ruget, F.; Semenov, M. A.; Steinmetz, Z.; Stratonovitch, P.; Supit, I.; Tao, F.; Trnka, Miroslav; de Wit, H. A.; Rötter, R. P.

    2018-01-01

    Roč. 159, JAN (2018), s. 260-274 ISSN 0308-521X R&D Projects: GA MŠk(CZ) LO1415; GA MZe QJ1310123 Institutional support: RVO:86652079 Keywords : AOCK concept * Crop model ensemble * Mediterranean cropping system * Rainfed * Sensitivity analysis * Wheat adaptation Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 2.571, year: 2016

  5. Federal Research and Development Funding: FY2017

    Science.gov (United States)

    2017-01-27

    International Center (FIC) 70 70 National Library of Medicine (NLM) 396 396 Office of Director (OD) 1,571 1,716 Buildings & Facilities (B&F...operates the National Agricultural Library , one of the department’s primary information repositories for food, agriculture, and natural resource... Multicultural Scholars Program, Women and Minorities in STEM Program, Agriculture in the Classroom, and Secondary/Postsecondary Challenge Grants. For

  6. Kulturní proměny na přelomu doby kamenné a bronzové na Moravě a mimo ni ve světle kamenné štípané industrie

    Czech Academy of Sciences Publication Activity Database

    Šebela, Lubomír

    2016-01-01

    Roč. 57, č. 1 (2016), s. 87-121 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Moravia * turn of the Stone and Bronze Ages * chipped stone industries * cultural transformations * genesis of the Bronze Age Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV-57-1_sebela.pdf

  7. Inhibition of cyclooxygenase 2 in mice increases production of G-CSF and induces radioprotection

    Czech Academy of Sciences Publication Activity Database

    Hofer, Michal; Pospíšil, Milan; Holá, Jiřina; Vacek, Antonín; Štreitová, Denisa; Znojil, V.

    2008-01-01

    Roč. 170, č. 5 (2008), s. 566-571 ISSN 0033-7587 R&D Projects: GA ČR(CZ) GA305/08/0158; GA AV ČR(CZ) 1QS500040507 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : cyclooxygenase 2 * G- CSF * meloxicam Subject RIV: BO - Biophysics Impact factor: 3.043, year: 2008

  8. Ořechov IV: Nová lokalita bohunicienu nad údolím Bobravy

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Nejman, L.; Bartík, J.; Hrušková, A.; Krása, J.

    2016-01-01

    Roč. 57, č. 1 (2016), s. 11-31 ISSN 1211-7250 R&D Projects: GA AV ČR IAA800010801; GA ČR GA15-19170S Keywords : Moravia * Bohunician * GPS survey * structured hearth Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV-57-1_skrdla.pdf

  9. 1861-IJBCS-Article-Hamidu usman

    African Journals Online (AJOL)

    hp

    diagnostic peak for glucose at 4.571 ppm, a series of doublet-like signals centered at. 3.336, 3.394, 3.287 .... spectrum is a diagnostic tool that is expected to reveal strong nitrile absorption as a result of significant ... with a C=C stretching vibrations at 1620 cm-1. (Eudea et al., 1983). The nitrile group is a reliable functional ...

  10. Dispersion and domestication shaped the genome of bread wheat

    Czech Academy of Sciences Publication Activity Database

    Berkman, P.J.; Visendi, P.; Lee, H.C.; Stiller, J.; Šimková, Hana; Kubaláková, Marie; Song, W.N.; Doležel, Jaroslav; Edwards, D.

    2013-01-01

    Roč. 11, č. 5 (2013), s. 564-571 ISSN 1467-7644 R&D Projects: GA ČR(CZ) GAP501/12/2554 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : Triticum aestivum * genome sequencing * evolution Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.677, year: 2013

  11. Prediction of crack propagation in layered ceramics with strong interfaces

    Czech Academy of Sciences Publication Activity Database

    Náhlík, Luboš; Šestáková, L.; Hutař, Pavel; Bermejo, R.

    2010-01-01

    Roč. 77, č. 11 (2010), s. 2192-2199 ISSN 0013-7944 R&D Projects: GA AV ČR(CZ) KJB200410803; GA ČR GA101/09/1821 Institutional research plan: CEZ:AV0Z20410507 Keywords : Ceramic laminate * Crack propagation direction * Residual stress * Flaw tolerant ceramics * Optimal design Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.571, year: 2010

  12. 49 CFR 571.201 - Standard No. 201; Occupant protection in interior impact.

    Science.gov (United States)

    2010-10-01

    ... than 3 milliseconds. S5.2.1The requirements of S5.2 do not apply to seats installed in school buses which comply with the requirements of Standard No. 222, School Bus Passenger Seating and Occupant... the midpoint of the two extreme positions. S8.8Temperature and humidity. (a) The ambient temperature...

  13. 49 CFR 571.103 - Standard No. 103; Windshield defrosting and defogging systems.

    Science.gov (United States)

    2010-10-01

    ... passenger vehicles, trucks, and buses. S3. Definitions. Road load means the power output required to move a... S4.3, and each multipurpose passenger vehicle, truck, and bus shall meet the requirements specified in § 4.1. (b) Each passenger car, multipurpose passenger vehicle, truck, and bus manufactured for...

  14. 49 CFR 571.131 - Standard No. 131; School bus pedestrian safety devices.

    Science.gov (United States)

    2010-10-01

    ... purpose of this standard is to reduce deaths and injuries by minimizing the likelihood of vehicles passing... opened while the engine is running and the manual override is engaged. S6 Test Procedures. S6.1...

  15. Cyber security consideration on I and C system development process

    International Nuclear Information System (INIS)

    Park, Jaek Wan; Park, Jeyun; Kim, Young Ki

    2012-01-01

    Instrumentation and control (I and C) systems in nuclear power plants collect sensor signals installed in plant fields, monitor plant performance and status, and generate signals to control instruments for plant operation and protection. Recently, digital systems of I and C are required to be protected from cyber threats. It has been reported that several plants have been attacked and malfunctioned by outside intruders. To cope with cyber attacks, various studies have been proposed in IT and plant industries. From 2006, regulatory guides and industry standards for cyber security have been published. Therefore, these guides should be strongly considered in the development process of a digital system. Our framework refers to the system development life cycle described in RG 1.152. The main activities of RG 5.71 are included in the framework appropriately. This approach supports the consistent application of system features for cyber security by incorporating the security requirements required in the operation and maintenance phases into the initial phase of development process. It is expected that the application of the framework to a new plant system design may comply with both RG 1.152 and 5.71

  16. Cyber security consideration on I and C system development process

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jaek Wan; Park, Jeyun; Kim, Young Ki [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    Instrumentation and control (I and C) systems in nuclear power plants collect sensor signals installed in plant fields, monitor plant performance and status, and generate signals to control instruments for plant operation and protection. Recently, digital systems of I and C are required to be protected from cyber threats. It has been reported that several plants have been attacked and malfunctioned by outside intruders. To cope with cyber attacks, various studies have been proposed in IT and plant industries. From 2006, regulatory guides and industry standards for cyber security have been published. Therefore, these guides should be strongly considered in the development process of a digital system. Our framework refers to the system development life cycle described in RG 1.152. The main activities of RG 5.71 are included in the framework appropriately. This approach supports the consistent application of system features for cyber security by incorporating the security requirements required in the operation and maintenance phases into the initial phase of development process. It is expected that the application of the framework to a new plant system design may comply with both RG 1.152 and 5.71.

  17. Correlation between blood lead concentration and iron deficiency in ...

    African Journals Online (AJOL)

    Results: We studied 223 cases including 98 control children and 125 patients. All children had lead intoxication. Mean (±SD) blood lead concentration in the control group was 57.1 ± 25.3 (ranged 20-212) μg/dl and in the patient group was 57 ± 20.4 (ranged 10.9-159) μg/dl with no significant difference (P value = 0.713).

  18. Pavlov I. Předběžné výsledky výzkumu v letech 2013 - 2015

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Novák, Martin; Sázelová, Sandra

    2016-01-01

    Roč. 57, č. 1 (2016), s. 33-57 ISSN 1211-7250 R&D Projects: GA MŠk(CZ) EE2.3.20.0181 Institutional support: RVO:68081758 Keywords : Pavlov * Early Upper Paleolithic * Gravettian * chronology * microstratigraphy * settlement structure * mammoth bone deposit Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV-57-1_svoboda.pdf

  19. Trends in lumber processing in the western United States. Part I: board foot Scribner volume per cubic foot of timber

    Science.gov (United States)

    Charles E. Keegan; Todd A. Morgan; Keith A. Blatner; Jean M. Daniels

    2010-01-01

    This article describes trends in board foot Scribner volume per cubic foot of timber for logs processed by sawmills in the western United States. Board foot to cubic foot (BF/CF) ratios for the period from 2000 through 2006 ranged from 3.70 in Montana to 5.71 in the Four Corners Region (Arizona, Colorado, New Mexico, and Utah). Sawmills in the Four Corners Region,...

  20. Prevalence, haemolysis and antibiograms of Campylobacters ...

    African Journals Online (AJOL)

    However, most isolates from farm Y were more resistant to ciprofloxacin (57.1%) than isolates from farm X (36.4%) and Z (40.7%). Resistance rates to tetracycline by C. coli isolated from farm Y (48%), farm Z (45.5%) and farm X (44.4%) were noted. Similar trend was observed for C. coli from farm Y (40%), farm Z (31.8%) and ...

  1. Application of a Leap Motion Sensor for Improved Drone Control

    Science.gov (United States)

    2017-12-01

    gas , and mineral exploration,  Domestic surveillance,  Policing activities by law enforcement agencies,  Forest fire detection,  Precision...search and rescue missions,  Security of pipelines , power lines, coastline and borders monitoring for illegal immigration and imports,  Delivery...5.71 3.9 inches Motor Type Brush Motors Material Plastic, Metal Power Source Electric Remote Distance 10 - 12 meters Control Channels 3

  2. Untitled

    Indian Academy of Sciences (India)

    Proc. Nat. Acad. Sci., U.S.A., 1929, 15, 896. 5. D. N. Read & sº ... Phys. Rev., 1934, 46, 571. 6. D. Coster and F. Brons ... Physica, 1934, 1, 155; Nature, 1934, 133, 140. 7. W. W. Watson ... ... Phys. Rev., 1932, 42, 509. -. 8. R. de L. Kronig .. . . Zs. f. Physik, 1928, 50, 347. 9. J. Kaplan * * ... Phys. Rev., 1930, 36, 788. 10. L. Gerő .

  3. Induction of protective immunity against MHC class I-deficient, HPV16-associated tumours with peptide and dendritic cell-based vaccines

    Czech Academy of Sciences Publication Activity Database

    Reiniš, Milan; Štěpánek, Ivan; Šímová, Jana; Bieblová, Jana; Přibylová, Hana; Indrová, Marie; Bubeník, Jan

    2010-01-01

    Roč. 36, č. 3 (2010), s. 545-551 ISSN 1019-6439 R&D Projects: GA AV ČR IAA500520605; GA AV ČR IAA500520807 EU Projects: European Commission(XE) 18933 - CLINIGENE Institutional research plan: CEZ:AV0Z50520514 Keywords : MHC class I-deficient tumours * CpG oligodeoxynucleotides * human papilloma virus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.571, year: 2010

  4. The function and developmental expression of alternatively spliced isoforms of amphioxus and Xenopus laevis Pax2/5/8 genes: revealing divergence at the invertebrate to vertebrate transition

    Czech Academy of Sciences Publication Activity Database

    Short, S.; Kozmik, Zbyněk; Holland, L. Z.

    2012-01-01

    Roč. 318, č. 7 (2012), s. 555-571 ISSN 1552-5007 R&D Projects: GA ČR GAP305/10/2141; GA MŠk LH12047 Grant - others:NSF(US) MCB 06-20019 Institutional research plan: CEZ:AV0Z50520514 Keywords : Pax2/5/8 * alternative splicing * eye development * amphioxus * Xenopus laevis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.123, year: 2012

  5. Use of a combined effect model approach for discriminating between ABCB1- and ABCC1-type efflux activities in native bivalve gill tissue

    Energy Technology Data Exchange (ETDEWEB)

    Faria, Melissa [Department of Environmental Chemistry, IDAEA-CSIC, Jordi Girona 18, 08034 Barcelona (Spain); CESAM & Departamento de Biologia, Universidade de Aveiro, 3810-193 Aveiro (Portugal); Pavlichenko, Vasiliy [Siberian Institute of Plant Physiology and Biochemistry, Siberian Branch of Russian Academy of Sciences (SIPPB SB RAS), Lermontov Str. 132, 664033, Irkutsk (Russian Federation); Department of Bioanalytical Ecotoxicology, UFZ — Helmholtz Centre for Environmental Research, Permoserstr. 15, D-04318 Leipzig (Germany); Burkhardt-Medicke, Kathleen [Department of Bioanalytical Ecotoxicology, UFZ — Helmholtz Centre for Environmental Research, Permoserstr. 15, D-04318 Leipzig (Germany); Institute of Hydrobiology, Dresden University of Technology, D-01062 Dresden (Germany); Soares, Amadeu M.V.M. [CESAM & Departamento de Biologia, Universidade de Aveiro, 3810-193 Aveiro (Portugal); Altenburger, Rolf [Department of Bioanalytical Ecotoxicology, UFZ — Helmholtz Centre for Environmental Research, Permoserstr. 15, D-04318 Leipzig (Germany); Barata, Carlos [Department of Environmental Chemistry, IDAEA-CSIC, Jordi Girona 18, 08034 Barcelona (Spain); Luckenbach, Till, E-mail: till.luckenbach@ufz.de [Department of Bioanalytical Ecotoxicology, UFZ — Helmholtz Centre for Environmental Research, Permoserstr. 15, D-04318 Leipzig (Germany)

    2016-04-15

    Aquatic organisms, such as bivalves, employ ATP binding cassette (ABC) transporters for efflux of potentially toxic chemicals. Anthropogenic water contaminants can, as chemosensitizers, disrupt efflux transporter function enabling other, putatively toxic compounds to enter the organism. Applying rapid amplification of cDNA ends (RACE) PCR we identified complete cDNAs encoding ABCB1- and ABCC1-type transporter homologs from zebra mussel providing the molecular basis for expression of both transporter types in zebra mussel gills. Further, efflux activities of both transporter types in gills were indicated with dye accumulation assays where efflux of the dye calcein-am was sensitive to both ABCB1- (reversin 205, verapamil) and ABCC1- (MK571) type specific inhibitors. The assumption that different inhibitors targeted different efflux pump types was confirmed when comparing measured effects of binary inhibitor compound mixtures in dye accumulation assays with predictions from mixture effect models. Effects by the MK571/reversin 205 mixture corresponded better with independent action, whereas reversin 205/verapamil joint effects were better predicted by the concentration addition model indicating different and equal targets, respectively. The binary mixture approach was further applied to identify the efflux pump type targeted by environmentally relevant chemosensitizing compounds. Pentachlorophenol and musk ketone, which were selected after a pre-screen of twelve compounds that previously had been identified as chemosensitizers, showed mixture effects that corresponded better with concentration addition when combined with reversine 205 but with independent action predictions when combined with MK571 indicating targeting of an ABCB1-type efflux pump by these compounds. - Highlights: • Sequences and function of ABC efflux transporters in bivalve gills were explored. • Full length Dreissena polymorpha abcb1 and abcc1 cDNA sequences were identified. • A mixture effect

  6. Use of a combined effect model approach for discriminating between ABCB1- and ABCC1-type efflux activities in native bivalve gill tissue

    International Nuclear Information System (INIS)

    Faria, Melissa; Pavlichenko, Vasiliy; Burkhardt-Medicke, Kathleen; Soares, Amadeu M.V.M.; Altenburger, Rolf; Barata, Carlos; Luckenbach, Till

    2016-01-01

    Aquatic organisms, such as bivalves, employ ATP binding cassette (ABC) transporters for efflux of potentially toxic chemicals. Anthropogenic water contaminants can, as chemosensitizers, disrupt efflux transporter function enabling other, putatively toxic compounds to enter the organism. Applying rapid amplification of cDNA ends (RACE) PCR we identified complete cDNAs encoding ABCB1- and ABCC1-type transporter homologs from zebra mussel providing the molecular basis for expression of both transporter types in zebra mussel gills. Further, efflux activities of both transporter types in gills were indicated with dye accumulation assays where efflux of the dye calcein-am was sensitive to both ABCB1- (reversin 205, verapamil) and ABCC1- (MK571) type specific inhibitors. The assumption that different inhibitors targeted different efflux pump types was confirmed when comparing measured effects of binary inhibitor compound mixtures in dye accumulation assays with predictions from mixture effect models. Effects by the MK571/reversin 205 mixture corresponded better with independent action, whereas reversin 205/verapamil joint effects were better predicted by the concentration addition model indicating different and equal targets, respectively. The binary mixture approach was further applied to identify the efflux pump type targeted by environmentally relevant chemosensitizing compounds. Pentachlorophenol and musk ketone, which were selected after a pre-screen of twelve compounds that previously had been identified as chemosensitizers, showed mixture effects that corresponded better with concentration addition when combined with reversine 205 but with independent action predictions when combined with MK571 indicating targeting of an ABCB1-type efflux pump by these compounds. - Highlights: • Sequences and function of ABC efflux transporters in bivalve gills were explored. • Full length Dreissena polymorpha abcb1 and abcc1 cDNA sequences were identified. • A mixture effect

  7. An Observation of Ultrasonographic Findings in Thyroid Disease

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jun Bae; Chung, Chun Phil; Kim, Dong Won; Kim, Byung Soo [Busan National University College of Medicine, Busan (Korea, Republic of)

    1983-09-15

    The authors analyzed ultrasonographically the total 45 cases of thyroid disease verified by historical diagnosis, functional diagnosis, and morphological diagnosis at the Department of Radiology, Busan National University Hospital from June to September 1982. The results obtained were as follows: 1. In the sex distribution female was 38 cases (84.4%), and male 7 cases (15.6%). The second, third, and fourth decades of age (78.0%) were most prevalent. 2. Among the total 45 cases thyroid adenoma was 24 cases (53.3%), nodular hyperplasia cases (17.7%), thyroid carcinoma 7 cases (15.6%), diffuse hyperplsia 3 cases (6.7%), Hashimoto's thyroiditis 1 cases (2.2%), subacute thyroiditis 1 cases (2.2%), tuberculous thyroiditis 1 case (2.2%) in orders. 3. On ultrasonogram, total 24 cases of thyroid adenoma showed a single nodule in 24 cases (100.0%), smooth outer margin in 23 cases (95.8%), capsular echo in 23 cases (95.8%), pure cystic nodule in 4 cases (16.7%), and increased echogenicity in 17 cases (85.0%) among the 20 cases exclude that pure cystic nodules. 4. Total 7 cases of thyroid carcinoma showed no capsular echo in 4 cases (57.1%), irregular outer margin in 4 case (57.1%), no pure cystic nodule in all cases, and enlargement of metastatic lymphnode in 4 cases (57.1%). 5. Total 8 cases of nodular hyperplasia showed enlargement of thyroid gland and multiple nodule in 8 cases (100.0%), and increased echogenicity in 7 cases (87.5%). 6. Total 3 cases of diffuse hyperplasia showed enlargement of thyroid gland and increased echogenicity in 3 cases (100.0%). 7. Total 3 cases of thyroiditis showed decreased echogenicity in 3 cases (100.0%) and enlargement of thyroid gland in 2 cases (66.7%). 8. The cold area visualized on radionuclide scan could be differentiated from a solid mass and cystic one by ultrasonogram.

  8. Comparison of curative effect of 131I and antithyroid drugs in Graves' disease: a meta analysis.

    Science.gov (United States)

    Yuan, Ju; Lu, Xiuqing; Yue, Yan

    2017-03-01

    Radioactive 131I is currently reported to be a potential effective intervention for Graves' Disease treatment in China. Whether 131I treatment was associated with effective outcome or reduced risk of side effects, reccurence rate remained unknown. Eligible studies were selected from Chinese VIP, Wangfang, CNKI databases using the keywords "Iodine" and "Graves Disease". Finally, 13 clinical trials met the inclusion criterion and were included this meta-analysis. Our meta-analysis included 1355 patients diagnosed of Graves' Disease with regular anti-thyroid drugs oral administration and 1320 patients with 131I therapy. The results showed that there was significant symptom improvement with radioactive iodine intervention (Odd Ratio (OR)=4.50, 95% CI [3.55, 5.71], PGraves' Disease. Treatment with 131I was associated with better clinical outcome; it reduced side effects and reccurence rate but increased hypothyroidism in Graves' Disease.

  9. Defects in SiO2 crystals after neutron irradiations at 20 K and 360 K

    International Nuclear Information System (INIS)

    Nakagawa, M.; Okada, M.; Kawabata, Y.; Atobe, K.; Itoh, H.; Nakanishi, S.

    1994-01-01

    The synthetic silicon dioxide (SiO 2 ), cut parallel (x-plate) or perpendicular (z-plate) to c-axis, are irradiated by reactor neutrons at 360 K (2.8x10 18 n/cm 2 ) or at 20 K (8.0x10 16 n/cm 2 ). After neutron irradiation at 360 K, the main absorption peak can be observed at 212 nm (5.84 eV) for z-plate and 217 nm (5.71 eV) for x-plate. After irradiation at 20 K a new band at 250 nm (4.96 eV) can be observed in addition to the band at about 220 nm. The 250 nm band having FWHM similar 0.44 eV disappears at 300-340 K. Thermoluminescences are also observed between 80 to 400 K; which show some difference between x-plate and z-plate. ((orig.))

  10. Design concept of CSRAS (Cyber Security Risk Analysis and Assessment System) for digital I and C systems

    International Nuclear Information System (INIS)

    Song, J. G.; Lee, J. W.; Lee, D. Y.; Lee, C. K.

    2012-01-01

    The instrumentation and control (I and C) systems in nuclear power plants (NPPs) have been digitalized recently. Hence, cyber security becomes an important feature to be incorporated into the I and C systems. The Regulatory Guide 5.71 published by U.C NRC in 2010 presents a comprehensive set of security controls for the cyber security of I and C systems in NPPs. However, the application of security controls specified in the RG 5.71 in a specific I and C system still requires many analysis efforts based on the understanding of the security controls, since the guideline does not provide the details to system designers or developers regarding what, where, and how to apply the security controls. To apply security controls to I and C systems, cyber security requirements should be identified based on the cyber security policy and program, then the design and implementation of security controls should be performed along with the I and C system development life cycle. It can be assumed that cyber security requirements are identified during the system design(SD) phase and the design and implementation of security controls is performed during the component design(CD) phase. When identifying security requirements and performing the design and implementation of security controls, cyber security risk assessments should be processed with the understanding of the characteristics of target systems. In this study, the Cyber Security Risk Analysis and Assessment System (CSRAS) has been developed as a tool for analyzing security requirements and technical security controls considering based on a general cyber security risk assessment procedure with the consideration of the characteristics of I and C systems and the development phases

  11. Kidney Disease in Human Immunodeficiency Virus-seropositive Patients: Absence of Human Immunodeficiency Virus-associated Nephropathy was a Characteristic Feature.

    Science.gov (United States)

    Prakash, J; Ganiger, V; Prakash, S; Sivasankar, M; Sunder, S; Singh, U

    2017-01-01

    Human immunodeficiency virus (HIV) infection can cause a broad spectrum of renal diseases. However, there is paucity of Indian data on the patterns of renal lesions in HIV-seropositive patients. The aim of the present study was to delineate the spectrum of renal lesions in HIV/acquired immunodeficiency syndrome patients. In this prospective study, all HIV-positive patients of both genders aged >18 years were screened for renal disease. Patients with proteinuria of more than 1 g/24 h were subjected to renal biopsy. A total of 293 HIV-positive patients were screened; of these, 136 (46.4%) patients found to have renal involvement. Dipstick-positive proteinuria of 1+ or more was observed in 112 (38.2%) patients, and 16 (14.2%) patients had proteinuria of more than 1 g/24 h. Renal biopsy in 14 cases revealed glomerulonephritis (GN) in 12 (85.7%) (isolated GN in 4 [28.5%] and GN mixed with chronic TIN in 8 [57.1%]) patients. These include mesangioproliferative GN in 5 (35.7%), membranoproliferative GN in 2 (14.2%), focal segmental glomerulosclerosis in 2 (14.2%), diffuse proliferative GN in 2 (14.2%), and diabetic nephropathy in 1 (7.1%) patients. Chronic interstitial nephritis was noted in 10 (71.42%) (superimposed on GN in 8 [57.1%], isolated in 2 [14.2%]) patients. Granulomatous interstitial nephritis was seen in 3 (24.1%) cases. GN and chronic interstitial nephritis were noted in 85.7% and 71.42% of patients, respectively, mostly superimposed on each other. Mesangioproliferative GN was the most common glomerular lesion, but classical HIV-associated nephropathy was not observed.

  12. Breastfeeding practice and knowledge among women attending primary health-care centers in Riyadh 2016

    Directory of Open Access Journals (Sweden)

    Norah Faleh Al-Mutairi

    2017-01-01

    Full Text Available Introduction: Breast milk is the best natural essential nutrition to newborns and infants. However, the practice of breastfeeding (BF has declined in Saudi Arabia. Objective: The objective of this study was to assess the knowledge and practice of BF with their determinants among mothers in Riyadh. Materials and Methods: In this cross-sectional study, 252 mothers attending the well-baby clinics in Riyadh from March 2016 to May 2017 were selected randomly with their consent and studied by a standardized questionnaire. Results: Of the 252 women, 69.4% were 25–35 years of age and 56.7% with a bachelor degree or higher education. Nearly 75% mothers had education on BF before our study. Mixed feeding was the most preferred method (51.6% followed by artificial milk (29.4%. The most reported reason for discontinuing BF was breast milk insufficiency (37.3% and of breastfeed continuation was their perceived benefit (36.6%. Excellent knowledge was observed among 12.7%, good knowledge in 57.1%, and unsatisfactory level in 30.2% mothers. The regression model shows that high school education improved the knowledge by 10.9 points (P = 0.024 and undergraduate by 18.7 points (P value = 0.001 when compared to women who were literate. Women with parity> 5 improved knowledge score by 17.3 points (P < 0.001. Conclusion: We observed that majority (57.1% of Saudi mothers had a moderate level of knowledge on BF benefits and 19% had practiced exclusive BF. There is a need for better educational programs to increase awareness on its benefits for the health situation in the country on the long term.

  13. Design concept of CSRAS (Cyber Security Risk Analysis and Assessment System) for digital I and C systems

    Energy Technology Data Exchange (ETDEWEB)

    Song, J. G.; Lee, J. W.; Lee, D. Y.; Lee, C. K. [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    The instrumentation and control (I and C) systems in nuclear power plants (NPPs) have been digitalized recently. Hence, cyber security becomes an important feature to be incorporated into the I and C systems. The Regulatory Guide 5.71 published by U.C NRC in 2010 presents a comprehensive set of security controls for the cyber security of I and C systems in NPPs. However, the application of security controls specified in the RG 5.71 in a specific I and C system still requires many analysis efforts based on the understanding of the security controls, since the guideline does not provide the details to system designers or developers regarding what, where, and how to apply the security controls. To apply security controls to I and C systems, cyber security requirements should be identified based on the cyber security policy and program, then the design and implementation of security controls should be performed along with the I and C system development life cycle. It can be assumed that cyber security requirements are identified during the system design(SD) phase and the design and implementation of security controls is performed during the component design(CD) phase. When identifying security requirements and performing the design and implementation of security controls, cyber security risk assessments should be processed with the understanding of the characteristics of target systems. In this study, the Cyber Security Risk Analysis and Assessment System (CSRAS) has been developed as a tool for analyzing security requirements and technical security controls considering based on a general cyber security risk assessment procedure with the consideration of the characteristics of I and C systems and the development phases.

  14. An Electrically Tight In Vitro Blood-Brain Barrier Model Displays Net Brain-to-Blood Efflux of Substrates for the ABC Transporters, P-gp, Bcrp and Mrp-1

    DEFF Research Database (Denmark)

    Helms, Hans Christian; Hersom, Maria; Kuhlmann, Louise Borella

    2014-01-01

    Efflux transporters of the ATP-binding cassette superfamily including breast cancer resistance protein (Bcrp/Abcg2), P-glycoprotein (P-gp/Abcb1) and multidrug resistance-associated proteins (Mrp's/Abcc's) are expressed in the blood-brain barrier (BBB). The aim of this study was to investigate......, zosuquidar, reversan and MK 571 alone or in combinations. Digoxin was mainly transported via P-gp, estrone-3-sulphate via Bcrp and Mrp's and etoposide via P-gp and Mrp's. The expression of P-gp, Bcrp and Mrp-1 was confirmed using immunocytochemistry. The findings indicate that P-gp, Bcrp and at least one...... isoform of Mrp are functionally expressed in our bovine/rat co-culture model and that the model is suitable for investigations of small molecule transport....

  15. Economic characteristics of grape production in South Banat

    Directory of Open Access Journals (Sweden)

    Milić Dragan

    2016-01-01

    Full Text Available Wine production in Serbia has a long tradition. Serbia has great potentials for the production of grape and wine, but they are at a low level of utilization. Grape production in Serbia takes place on only 25,000 ha with an average annual production of 285,571 t of grapes with variations according to year. The vineyards and wine production are in a significant decline, while the main bearers of production are small family households or individual producers. The research presented in this paper is the economic characteristics of grapes production in the region of South Banat, Vršac wine-growing region, which occupies 81.2% of the total vineyard area in this part of AP Vojvodina.

  16. Framing preventive care messaging and cervical cancer screening in a health-insured population in South Africa: Implications for population-based communication?

    Science.gov (United States)

    Adonis, Leegale; Paramanund, Jithen; Basu, Debashis; Luiz, John

    2017-09-01

    The impact of health message framing on cervical cancer screening uptake is poorly understood. In a prospective randomized control study with 748 females, aged 21-65 years with no Pap smear in the previous 3 years, they randomly received a loss-framed, gain-framed, or neutral health message (control) regarding cervical cancer screening by email. Screening rate in the control group was 9.58 percent (CI: 9.29%-9.87%), 5.71 percent (CI: 5.48%-6.98%) in the gain-framed group, and 8.53 percent (CI: 8.24%-8.81%) in the loss-framed group. Statistically there was no difference between the three screening rates. Framing of health messages may not be a significant consideration when communicating through emails.

  17. Perfil clínico-epidemiológico dos casos suspeitos de Dengue em um bairro da zona sul de Teresina, PI, Brasil Perfíl clinico-epidemiológico de los casos sospechosos de Dengue en un distrito de la zona sur de Teresina, PI, Brasil Clinical-epidemiologic profile of Dengue suspicious cases in a district in the south zone of Teresina, PI, Brazil

    Directory of Open Access Journals (Sweden)

    Polyana da Costa Ribeiro

    2008-04-01

    Full Text Available O objetivo foi traçar o perfil clínico-epidemiológico dos casos suspeitos de Dengue em um bairro da zona sul de Teresina. Realizou-se um estudo descritivo-exploratório, por meio de inquérito domiciliar mediante aplicação de formulário com 28 pessoas. 88,9% tinham coleta de lixo 3 vezes por semana; 57,1% dos depósitos encontrados foram material de construção/peças de carro; 75% destinam as águas servidas a céu aberto; 60,7% desenvolveram primo-infecção, 75% realizaram sorologia, com 33,3% confirmados. Faltou uma maior efetividade de ações de saneamento por parte do poder público e um envolvimento da população no desenvolvimento de medidas preventivas no combate à dengue.El un objetivo del estudio fue establecer un perfil clínico-epidemiológico de los casos sospechosos de Dengue en un distrito de la zona sur de la cuidad de Teresina, PI, Brasil. Tratase de un estudio descriptivo-exploratorio en lo cual se aplicó un cuestionario a 28 residentes del área del estudio. 88,9% tenían colección de basura 3 veces por la semana; 57,1% de los depósitos analizados tenían material de construcción o piezas de auto; 75% de las casas tenían el escoto con destino a áreas libres; 60,7% tuvieron prima-infección, 75% fueron sometidos a serología, con 33,3% confirmaciones. Mayor efectividad de acciones sanitarias por el gobierno y un envolvimiento de la población en el desarrollo de programas preventivos de combate a la Dengue son necesarios.The objective of the study was to establish a clinical-epidemiologic profile of Dengue suspicious cases in a district in the south zone of Teresina, PI, Brazil. This study is a descriptive-exploratory survey in which it was applied a questionnaire to 28 residents of the mentioned district. 88.9% had garbage collection 3 times per week; 57.1% of the deposits had construction material or car parts; 75% destine served waters to opencast; 60.7% had developed first-infection, 75% were submitted to

  18. Firehose constraints of the bi-Kappa-distributed electrons: a zero-order approach for the suprathermal electrons in the solar wind

    Czech Academy of Sciences Publication Activity Database

    Lazar, M.; Shaaban, S. M.; Poedts, S.; Štverák, Štěpán

    2017-01-01

    Roč. 464, č. 1 (2017), s. 564-571 ISSN 0035-8711 Institutional support: RVO:68378289 Keywords : instabilities * plasmas * methods * analytical * methods: observational * solar wind Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 4.961, year: 2016 https://academic.oup.com/mnras/article-abstract/464/1/564/2236068/Firehose-constraints-of-the-bi-Kappa-distributed?redirectedFrom=fulltext

  19. Abstracts of contributed papers

    Energy Technology Data Exchange (ETDEWEB)

    1994-08-01

    This volume contains 571 abstracts of contributed papers to be presented during the Twelfth US National Congress of Applied Mechanics. Abstracts are arranged in the order in which they fall in the program -- the main sessions are listed chronologically in the Table of Contents. The Author Index is in alphabetical order and lists each paper number (matching the schedule in the Final Program) with its corresponding page number in the book.

  20. Diminished synthesis of subunit a (ATP6) and altered function of ATP synthase and cytochrome c oxidase due to the mtDNA 2 bp microdeletion of TA at positions 9205 and 9206

    Czech Academy of Sciences Publication Activity Database

    Ješina, Pavel; Tesařová, M.; Fornůsková, D.; Vojtíšková, Alena; Pecina, Petr; Kaplanová, Vilma; Hansíková, H.; Zeman, J.; Houštěk, Josef

    2004-01-01

    Roč. 383, č. 3 (2004), s. 561-571 ISSN 0264-6021 R&D Projects: GA ČR(CZ) GA303/03/0749; GA MZd(CZ) NR7790; GA MZd(CZ) NR8065 Grant - others:GA UK(CZ) 14/2004 Institutional research plan: CEZ:AV0Z5011922 Keywords : ATP6 * ATP synthase * mitochondrial disease Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 4.278, year: 2004

  1. On the steady equations for compressible radiative gas

    Czech Academy of Sciences Publication Activity Database

    Kreml, Ondřej; Nečasová, Šárka; Pokorný, M.

    2013-01-01

    Roč. 64, č. 3 (2013), s. 539-571 ISSN 0044-2275 R&D Projects: GA ČR(CZ) GAP201/11/1304; GA ČR GA201/08/0012 Institutional research plan: CEZ:AV0Z10190503 Keywords : radiative gas * variational entropy solution * weak solution Subject RIV: BA - General Mathematics Impact factor: 1.214, year: 2013 http://link.springer.com/article/10.1007%2Fs00033-012-0246-4

  2. Molecular characterization of adenosine 5'-monophosphate deaminase--the key enzyme responsible for the umami taste of nori (Porphyra yezoensis Ueda, Rhodophyta).

    Science.gov (United States)

    Minami, Seiko; Sato, Minoru; Shiraiwa, Yoshihiro; Iwamoto, Koji

    2011-12-01

    The enzyme adenosine 5'-monophosphate deaminase (AMPD, EC 3.5.4.6) catalyzes the conversion of adenosine 5'-monophosphate to inosine 5'-mononucleotide (IMP). IMP is generally known as the compound responsible for the umami taste of the edible red alga Porphyra yezoensis Ueda that is known in Japan as nori. Therefore, we suspect that AMPD plays a key role in providing a favorable nori taste. In this study, we undertake the molecular characterization of nori-derived AMPD. The nori AMPD protein has a molecular mass of 55 kDa as estimated from both gel filtration and sodium dodecyl sulfate polyacrylamide gel electrophoresis. The calculated molecular mass from the amino acid sequence deduced from cDNA is 57.1 kDa. The isoelectric point is 5.71. The coding region of AMPD consists of 1,566 bp encoding 522 amino acids and possesses a transmembrane domain and two N-glycosylation sites. The sequence identity of nori AMPD in human and yeast AMPDs was found to be less than 50% and 20% in DNA and amino acid sequences, respectively. Proline in the conserved motif of [SA]-[LIVM]-[NGS]-[STA]-D-D-P was found to be converted to glutamate. These results indicate that nori AMPD is a novel type of AMPD.

  3. Hip arthroscopy in patients with recurrent pain following Bernese periacetabular osteotomy for acetabular dysplasia: operative findings and clinical outcomes

    Science.gov (United States)

    Cvetanovich, Gregory L.; Heyworth, Benton E.; Murray, Kerri; Yen, Yi-Meng; Kocher, Mininder S.; Millis, Michael B.

    2015-01-01

    To report the operative findings and outcomes of hip arthroscopy for recurrent pain following periacetabular osteotomy (PAO) for acetabular dysplasia. A departmental database was used to identify patients who underwent hip arthroscopy following PAO between 2000 and 2009. Demographic data, arthroscopic findings, functional outcome scores and patient satisfaction were analysed. Of 556 PAO patients, 17 hips in 16 patients (3.1%) underwent post-PAO hip arthroscopy. Mean age at PAO was 23.8 years, and mean age at arthroscopy was 27.0 years. Common hip arthroscopy findings included labral tears (13 hips, 81.3%), significant (≥grade 2) chondral changes (12 hips, 75%), cam impingement (7 hips, 43.8%) and pincer impingement (6 hips, 37.5%). At mean follow-up 2.8 years after arthroscopy, additional procedures had been performed in six hips (37.5%), including total hip arthroplasty in one hip. Post-PAO arthroscopy questionnaire revealed 85.7% of patients with improved hip pain, 57.1% improved hip stiffness and 57.1% improved hip function. There was no significant difference in functional outcome measures. Common post-PAO hip arthroscopy findings include labral tears, chondral changes and femoroacetabular impingement. Many patients reported subjective hip improvement from post-PAO arthroscopy, but hip outcome scores were unchanged and one-third of patients had further surgery. PMID:27011852

  4. Pegylated interferon alpha-2a and ribavirin combination therapy in HCV liver transplant recipients. Experience of 7 cases.

    Science.gov (United States)

    Iacob, Speranta; Gheorghe, Liana; Hrehoret, Doina; Becheanu, Gabriel; Herlea, Vlad; Popescu, Irinel

    2008-06-01

    Hepatitis C virus (HCV) related cirrhosis represents the leading indication for liver transplantation (LT) worldwide and HCV reinfection is the rule among transplant recipients. Combination therapy with interferon and ribavirin is the treatment of choice for established recurrent hepatitis C. To evaluate the efficacy and safety of the combination of pegylated interferon alpha-2a and ribavirin in LT recipients with histological recurrence of hepatitis C. Seven LT recipients with chronic hepatitis C recurrence were treated with peginterferon alpha-2a with an initial intended dose of 180 microg/week and an intended dose of ribavirin 800-1000 mg/day for at least 12 months and followed-up for at least 24 weeks. Early virological response rate was 57.1%. Three patients (42.8%) had end of treatment virological response and all had also sustained viral response (SVR). Five patients had end of treatment biological response, out of which 4 had also sustained biochemical response. Three patients had both SVR and sustained biochemical response. Four patients had end of treatment histological response, out of which 3 patients had also SVR. Cytopenia was the most common adverse event: anemia (57.1%), leucopenia/neutropenia (71.4%), thrombocytopenia (42.8%). Combination of pegylated interferon and ribavirin can be safely and successfully used in liver transplant recipients.

  5. Microstructure and electrical-optical properties of cesium tungsten oxides synthesized by solvothermal reaction followed by ammonia annealing

    International Nuclear Information System (INIS)

    Liu Jingxiao; Ando, Yoshihiko; Dong Xiaoli; Shi Fei; Yin Shu; Adachi, Kenji; Chonan, Takeshi; Tanaka, Akikazu; Sato, Tsugio

    2010-01-01

    Cesium tungsten oxides (Cs x WO 3 ) were synthesized by solvothermal reactions using ethanol and 57.1 vol% ethanol aqueous solution at 200 o C for 12 h, and the effects of post annealing in ammonia atmosphere on the microstructure and electrical-optical properties were investigated. Agglomerated particles consisting of disk-like nanoparticles and nanorods of Cs x WO 3 were formed in the pure ethanol and ethanol aqueous solutions, respectively. The samples retained the original morphology and crystallinity after annealing in ammonia atmosphere up to 500 o C, while a small amount of nitrogen ion were incorporated in the lattice. The as-prepared Cs x WO 3 sample showed excellent near infrared (NIR) light shielding ability as well as high transparency in the visible light region. The electrical resistivity of the pressed pellets of the powders prepared in pure ethanol and 57.1 vol% ethanol aqueous solution greatly decreased after ammonia annealing at 500 o C, i.e., from 734 to 31.5 and 231 to 3.58 Ω cm, respectively. - Graphical abstract: Cesium tungsten oxides (Cs x WO 3 ) with different morphology were synthesized by solvothermal reaction, and the effects of post-ammonia annealing on the microstructure and electrical-optical properties were investigated.

  6. Perception of, attitudes toward, and knowledge of epilepsy among teachers and high school and college students in Sicily.

    Science.gov (United States)

    Buccheri, Teresa; Quattropani, Maria C

    2015-12-01

    The study was aimed at investigating perception of, attitudes toward, and knowledge of epilepsy among college students of the University of Messina in Sicily (Italy), high school students, and teachers from Sicily in order to structure health educational programs to remediate inadequate knowledge and stigma about epilepsy. Participants in this study consisted of 932 subjects (571 males, 361 females) aged between 13 and 63 years old (M 21.75 ± 8.7): 571 college students aged between 18 and 35 years old (M 21.54 ± 2.59), 62 teachers aged between 38 and 63 years old (M 51.18 ± 6.27), and 299 high school students aged between 13 and 19 years old (M 16.05 ± 1.67). Measures were two anonymous questionnaires to collect sociodemographic information and to assess knowledge of, attitudes toward, and perception of epilepsy. Analyses were performed with descriptive statistical analysis (mean, standard deviation, frequency counts, and percentages) and Mann-Whitney U-test nonparametric for two independent samples. This study provides general information about psychosocial aspects of epilepsy in Sicily which provides the basis for further studies and the development of interventions to eliminate prejudices against persons with epilepsy and related myths. Copyright © 2015 Elsevier Inc. All rights reserved.

  7. 49 CFR 571.206 - Standard No. 206; Door locks and door retention components.

    Science.gov (United States)

    2010-10-01

    ... be instrumented with an accelerometer and data processing system that conforms to the requirements... is parallel to the direction of test platform travel. (ii) Maintaining a minimum acceleration level... illustrated in Figure 8 to the mounting provisions of the hinge system. Hinge attitude is configured to...

  8. [Pilot study of psychiatric and social aspects of children and adolescents with fragile X syndrome].

    Science.gov (United States)

    Häßler, Frank; Gaese, Franziska; Colla, Michael; Huss, Michael; Kretschmar, Christoph; Brinkman, Marc; Peters, Helmut; Elstner, Samuel; Weirich, Steffen; Pittrow, David

    2017-03-01

    The study describes the burden of psychosocial risks of mental illnesses and the ways in which children and adolescents with fragile X syndrome (FRX) can be treated. Data from a sample of 34 patients with FRX younger than 18 years stemming from a prospective multicenter (n = 11) registry study (EXPLAIN) were analyzed with regard to psychosocial burden and Treatment. One third of all participants reported having relatives who suffer from FRX. The majority of participants were suffering themselves from one kind or another mental or neurological problems. Younger participants (therapies and occupational therapies (more than once a month). In our sample, 96.3 % of the younger patients and more than 57.1 % of the older patients were still living with their parents. Patients with FRX often suffer from additional neurological and mental disorders. For that reason, they should be diagnosed and treated early on.

  9. Prevalence and causative agents of superficial mycoses in a textile factory in Adana, Turkey.

    Science.gov (United States)

    Celik, E; Ilkit, M; Tanir, F

    2003-09-01

    This study was carried out in a textile factory settled in the city center of Adana, Turkey. The workers were evaluated for the presence of superficial mycoses and the interaction of their working environment or working condition. A total of 431 textile workers were included in the study, with a male to female ratio of 378 (87.7%) to 53 (12.3%) and an age range of 19-52 (mean: 33.7 +/- 6.8). Direct examination and/or culture revealed superficial mycoses in 73 (16.9%) workers, among them 56 (76.7%) were classified as dermatophytoses, 8 (11.0%) as Pityriasis versicolor while in nine (12.3%) of the cases, no causative agent could be determined. Trichophyton rubrum (57.1%) and T. mentagrophytes (42.9%) were the two species isolated on culture. This study emphasized that textile workers should be admitted as a risk group for superficial mycoses, especially tinea pedis.

  10. The impact of cataract surgery on activities and time-use: results from a longitudinal study in Kenya, Bangladesh and the Philippines.

    Directory of Open Access Journals (Sweden)

    Sarah Polack

    Full Text Available BACKGROUND: Cataract is the leading cause of blindness in the world, and blindness from cataract is particularly common in low-income countries. The aim of this study is to explore the impact of cataract surgery on daily activities and time-use in Kenya, Bangladesh and the Philippines. METHODS/PRINCIPAL FINDINGS: A multi-centre intervention study was conducted in three countries. Time-use data were collected through interview from cases aged >or=50 years with visually impairing cataract (VA or=6/18. Cases were offered free/subsidized cataract surgery. Approximately one year later participants were re-interviewed about time-use. At baseline across the three countries there were 651 cases and 571 controls. Fifty-five percent of cases accepted surgery. Response rate at follow up was 84% (303 out of 361 for operated cases, and 80% (459 out of 571 for controls. At baseline, cases were less likely to carry out and spent less time on productive activities (paid and non-paid work and spent more time in "inactivity" compared to controls. Approximately one year after cataract surgery, operated cases were more likely to undertake productive activities compared to baseline (Kenya from 55% to 88%; Bangladesh 60% to 95% and Philippines 81% to 94%, p<0.001 and mean time spent on productive activities increased by one-two hours in each setting (p<0.001. Time spent in "inactivity" in Kenya and Bangladesh decreased by approximately two hours (p<0.001. Frequency of reported assistance with activities was more than halved in each setting (p<0.001. CONCLUSIONS/SIGNIFICANCE: The empirical evidence provided by this study of increased time spent on productive activities, reduced time in inactivity and reduced assistance following cataract surgery among older adults in low-income settings has positive implications for well-being and inclusion, and supports arguments of economic benefit at the household level from cataract surgery.

  11. Goats reinfected with Toxoplasma gondii: loss of viable prolificacy and gross revenue

    Directory of Open Access Journals (Sweden)

    H. M. Silva

    2015-10-01

    Full Text Available ABSTRACTWe determined the reproductive parameters and clinical disorders in pregnant goats infected and reinfected with Toxoplasma gondii, and posteriorly the loss of gross revenue due to congenital toxoplasmosis was estimated. Of the 25 non-pregnant females negative for T. gondii, 20 were orally inoculated (ME 49 strain and of these, 15 pregnant females chronically infected were orally reinoculated (VEG strain with T. gondii oocysts. Five groups were formed (n=5: GI, GII and GIII (reinoculations at 40, 80 and 120 days of gestation, respectively, GIV (inoculation and GV (no inoculation. Clinical and serological exams were performed on days 0 (prior to inoculation, 3, 6 9, 15 and 21 and every 7 days post-inoculation. Exams were also performed on day 3 and every 7 days post-reinoculation. Reproductive management was performed on all females and initiated when the females infected displayed IgG titers IFAT<1,024. From the average prolificacy indexes of each experimental group were estimated: total production of kilograms of live weight (total kg LW of goats for slaughter, gross revenue and loss of gross revenue in U.S. dollars (US$, designed for a herd of 1,000 matrices. The unviable prolificacy indexes were 0.8 (GI, 1.2 (GII and 0.2 (GIII. Clinical disorders affected 57.1% (GI, 75.0% (GII and 16.7% (GIII of the offspring of goats reinfected with T. gondii. Congenital toxoplasmosis in goats reinfected resulted in the loss of 26.5% of gross revenues, being GI (US$ 10,577.60 or 57.1% and GII (US$ 12,693.12 or 60% holders of the highest values and percentages of economic losses. It was found that congenital toxoplasmosis reinfection cause clinical disorders in goats chronically infected with T. gondii and their offspring with birth of unviable animals and loss of gross revenue, at different stages of pregnancy (40, 80 and 120 days of gestation, being in the initial and intermediate stages of pregnancy the largest estimates of these losses.

  12. High Resolution Computed Tomography in Asthma 

    Directory of Open Access Journals (Sweden)

    Nabil Maradny

    2012-03-01

    Full Text Available  Objectives: High-resolution computed tomography (HRCT can detect the structural abnormalities in asthma. This study attempts to correlate these abnormalities with clinical and pulmonary function test (PFT data.Methods: Consecutive stable asthma patients attending Mubarak Al Kabeer Hospital, Kuwait, were subjected to HRCT during a six month period from July 2004 to December 2004, after initial evaluation and PFT.Results: Of the 28 cases, sixteen (57.1�20had moderate, 6 (21.4�20had mild and 6 (21.4�20had severe persistent asthma. Thirteen (46.4�20patients had asthma for 1 to 5 years and 12 (42.9�20were having asthma for >10 years. Bronchial wall thickening (57.1� bronchiectasis (28.6� mucoid impaction (17.9� mosaic attenuation (10.7� air trapping (78.6�20and plate like atelectasis (21.4�20were noted. Bronchial wall thickening (p=0.044 and bronchiectasis (p=0.063 were most prevalent in males. Ten (35.7�20patients exhibited mild, 9 (32.1�20had moderate and 3 (10.7�20had severe air trapping. The difference in Hounsfield units between expiratory and inspiratory slices (air trapping when correlated with percent-predicted FEV1 in right upper (r=0.25;p=0.30, left upper (r=0.20; p=0.41, right mid (r=0.15; p=0.53, left mid (r=-0.04; p=0.60, right lower (r=0.04; p=0.86 and left lower zones (r=-0.13; p=0.58 showed no relation. The same when correlated as above with the percent predicted FEF 25-75 did not show any significant association. The presence of air trapping was compared with sex (p=0.640, nationality (p=1.000, disease duration (p=1.000 and severity of symptoms (p=0.581.Conclusion: Abnormal HRCT findings are common in asthma; however, air trapping when present was not related to the duration or severity of the illness or to the FEV1.

  13. Segmental dependent transport of low permeability compounds along the small intestine due to P-glycoprotein: the role of efflux transport in the oral absorption of BCS class III drugs.

    Science.gov (United States)

    Dahan, Arik; Amidon, Gordon L

    2009-01-01

    The purpose of this study was to investigate the role of P-gp efflux in the in vivo intestinal absorption process of BCS class III P-gp substrates, i.e. high-solubility low-permeability drugs. The in vivo permeability of two H (2)-antagonists, cimetidine and famotidine, was determined by the single-pass intestinal perfusion model in different regions of the rat small intestine, in the presence or absence of the P-gp inhibitor verapamil. The apical to basolateral (AP-BL) and the BL-AP transport of the compounds in the presence or absence of various efflux transporters inhibitors (verapamil, erythromycin, quinidine, MK-571 and fumitremorgin C) was investigated across Caco-2 cell monolayers. P-gp expression levels in the different intestinal segments were confirmed by immunoblotting. Cimetidine and famotidine exhibited segmental dependent permeability through the gut wall, with decreased P(eff) in the distal ileum in comparison to the proximal regions of the intestine. Coperfusion of verapamil with the drugs significantly increased the permeability in the ileum, while no significant change in the jejunal permeability was observed. Both drugs exhibited significantly greater BL-AP than AP-BL Caco-2 permeability, indicative of net mucosal secretion. Concentration dependent decrease of this secretion was obtained by the P-gp inhibitors verapamil, erythromycin and quinidine, while no effect was evident by the MRP2 inhibitor MK-571 and the BCRP inhibitor FTC, indicating that P-gp is the transporter mediates the intestinal efflux of cimetidine and famotidine. P-gp levels throughout the intestine were inversely related to the in vivo permeability of the drugs from the different segments. The data demonstrate that for these high-solubility low-permeability P-gp substrates, P-gp limits in vivo intestinal absorption in the distal segments of the small intestine; however P-gp plays a minimal role in the proximal intestinal segments due to significant lower P-gp expression levels

  14. The use of selenium-enriched alga Scenedesmus quadricauda in a chicken diet

    Czech Academy of Sciences Publication Activity Database

    Skřivan, M.; Skřivanová, V.; Dlouhá, G.; Brányiková, Irena; Zachleder, Vilém; Vítová, Milada

    2010-01-01

    Roč. 55, č. 12 (2010), s. 565-571 ISSN 1212-1819 R&D Projects: GA MŠk(CZ) EUREKA No. OE0906; GA ČR GA525/09/0102; GA MŠk OE0906 Grant - others:Ministerstvo zemědělství ČR(CZ) MZE0002701404 Institutional research plan: CEZ:AV0Z50200510 Keywords : alga * selenium * Scendesmus Subject RIV: EE - Microbiology, Virology Impact factor: 1.190, year: 2010

  15. Design Compliance Matrices to ANSI and OSHA

    International Nuclear Information System (INIS)

    BENDIXSEN, R.B.

    2000-01-01

    U.S. Department of Energy Letter 98-SFD-028 requested Fluor Daniel Hanford, Inc. to provide clarifications as to compliance with ANSI 57.1, 57.2, 57.9, and 29 CFR 1910.179 (OSHA), in the form of an item-by-item compliance matrix, for the CSB. This Supporting Document contains Fluor Daniel, Inc.'s response for use by Fluor Daniel Hanford, Inc. regarding the clarifications requested by the U.S. Department of Energy

  16. Exploring the venom of the forest cobra snake: Toxicovenomics and antivenom profiling of Naja melanoleuca

    DEFF Research Database (Denmark)

    Lauridsen, Line P.; Laustsen, Andreas Hougaard; Lomonte, Bruno

    2017-01-01

    A toxicovenomic analysis of the venom of the forest cobra, N. melanoleuca, was performed, revealing the presence of a total of 52 proteins by proteomics analysis. The most abundant proteins belong to the three-finger toxins (3FTx) (57.1 wt%), which includes post-synaptically acting α-neurotoxins........ This toxicovenomic study identified the 3FTx group of α-neurotoxins in the venom of N. melanoleuca as the relevant targets to be neutralized....

  17. HD 161306: a radiatively interacting Be binary?

    Czech Academy of Sciences Publication Activity Database

    Koubský, Pavel; Kotková, Lenka; Kraus, Michaela; Yang, S.; Šlechta, Miroslav; Harmanec, P.; Wolf, M.; Votruba, Viktor; Kubát, Jiří; Kubátová, Brankica; Niemczura, E.; Škoda, Petr

    2014-01-01

    Roč. 567, July (2014), A57/1-A57/4 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GA14-21373S; GA MŠk LG14026 Grant - others:ESA(XE) ESA- PECS project no. 98058; GA ČR(CZ) GAP209/10/0715 Program:GA Institutional support: RVO:67985815 Keywords : binaries: spectroscopic * stars: emission-line * Be: stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

  18. Cholesterol esterification and atherogenic index of plasma correlate with lipoprotein size and findings on coronary angiography

    Czech Academy of Sciences Publication Activity Database

    Dobiášová, Milada; Frohlich, J.; Šedová, Michaela; Cheung, M. C.; Brown, B.G.

    2011-01-01

    Roč. 52, č. 3 (2011), s. 566-571 ISSN 0022-2275 R&D Projects: GA MZd(CZ) NR8328; GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z10300504 Keywords : fractional esterification rate (FERHDL). * log(TG/HDL-Cholesterol) * AIP * biomarkers of cardiovascular risk * lipoprotein particle size * HDL- Atherosclerosis Treatment Study (HATS) Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 5.559, year: 2011

  19. Complete genome sequence of cyanobacterium Nostoc sp. NIES-3756, a potentially useful strain for phytochrome-based bioengineering.

    Science.gov (United States)

    Hirose, Yuu; Fujisawa, Takatomo; Ohtsubo, Yoshiyuki; Katayama, Mitsunori; Misawa, Naomi; Wakazuki, Sachiko; Shimura, Yohei; Nakamura, Yasukazu; Kawachi, Masanobu; Yoshikawa, Hirofumi; Eki, Toshihiko; Kanesaki, Yu

    2016-01-20

    To explore the diverse photoreceptors of cyanobacteria, we isolated Nostoc sp. strain NIES-3756 from soil at Mimomi-Park, Chiba, Japan, and determined its complete genome sequence. The Genome consists of one chromosome and two plasmids (total 6,987,571 bp containing no gaps). The NIES-3756 strain carries 7 phytochrome and 12 cyanobacteriochrome genes, which will facilitate the studies of phytochrome-based bioengineering. Copyright © 2015. Published by Elsevier B.V.

  20. Crosstalk between mTORC1 and cAMP Signaling

    Science.gov (United States)

    2016-09-01

    whether bidirectional inhibition of trafficking be- tween the endoplasmic reticulum (ER) and Golgi would affect Gln-induced activation of mTORC1 (23). We...Shimizu N, Matsumoto K, Itoh M, Ishitani T. 2012. NLK positively regulates Wnt/β-catenin signalling by phosphorylating LEF1 in neural progenitor...L, Pan D, Edgar BA. 2003. Rheb promotes cell growth as a component of the insulin/ TOR signalling network . Nat Cell Biol 5: 566–571. Sengupta S