Nitrogen fixation by the Azolla-Anabaena azollae symbiosis
International Nuclear Information System (INIS)
Becking, J.H.
1985-01-01
A concise outline is presented on the main characteristics of the Azolla association in relation to tropical wetland rice cultivation and the nitrogen economy of paddy soils. Due to the presence of a nitrogen fixing cyanobiont occurring in a special leaf cavity of the Azolla leaf, the water fern Azolla can grow in a nitrogen-deficient environment and is able to contribute considerably to the nitrogen status of the soil. An experimental set-up is presented for how the nitrogen-fixing capacity of Azolla plants can be measured in the field by means of the acetylene reduction assay using a rather simple glass vessel. A comparison was made between 15 N 2 fixation by Azolla and acetylene reduction of Azolla plants under identical conditions
Directory of Open Access Journals (Sweden)
A. Raras
2017-02-01
Full Text Available Penelitian bertujuan untuk mengkaji pengaruh penggunaan tepung Azolla microphylla fermentasi terhadap performans ayam kampung persilangan. Materi penelitian adalah 80 ekor ayam kampung umur 5 minggu, ayam kampung ini persilangan antara ayam kampung keturunan Bangkok dan Lohman 202 dari peternakan rakyat Temanggung dengan bobot badan 469,80 ± 38 gram (CV = 3,33%. Bahan pakan yang digunakan yaitu jagung, bungkil kedelai, tepung ikan, pollard, bekatul, CaCO3, premix dan tepung azolla fermentasi. Fermentasi azolla menggunakan larutan EM4 dengan perbandingan 3 gram : 10 ml. Perlakuan pakan T0 (ransum basal tanpa tepung azolla fermentasi, T1 (ransum mengandung tepung azolla fermentasi 10%, T2 (ransum mengandung tepung azolla fermentasi 15% dan T3 (ransum mengandung tepung azolla fermentasi 20%. Kandungan protein pakan 17% dan energi metabolis 2800 kkal/kg. Penelitian menggunakan Rancangan Acak Lengkap (RAL dengan 4 perlakuan dan 4 ulangan. Parameter yang diamati adalah konsumsi ransum, pertambahan bobot badan dan konversi ransum. Data dianalisis dengan analisis ragam. Hasil penelitian menunjukkan bahwa perlakuan penggunaan tepung azolla terfermentasi berpengaruh nyata (P<0,05 terhadap konsumsi pakan dan pertambahan bobot badan, sedangkan hasil penelitian perlakuan penggunaan azolla terfermentasi tidak berpengaruh nyata (P<0,05 terhadap konversi pakan. Kesimpulan dari penelitian ini adalah pemberian tepung azolla terfermentasi dapat meningkatkan konsumsi pakan dan pertambahan bobot badan pada perlakuan T2, sedangkan untuk konversi pakan pada perlakuan penggunaan tepung azolla terfermentasi menurun.
Chen, Jian; Zheng, Wei-wen; Xu, Guo-zhong; Song, Tie-ying; Tang, Long-fei
2002-01-01
Symbiotic Anabeana azollae and its host plant Anabeana-free Azolla were isolated from 16 Azolla accessions representing different Azolla species or geographic origins.DNA polymorphic fragments were obtained by simultaneous RAPD amplification of both symbiont and host. The UPGMA clusters of Anabeana azollae and its host Azolla were established separately based on Dice coefficient caculation and a coordinated relationship was shown between Anabeana azollae and its Azolla host along both individual genetic divergence,but this genetic homology was reduced among different strains within Azolla species while the obvious mutants of Anabeana azollae were detected in some Azolla tested strains collected from different geographic area in the same host species.
An ecophysiological study of the Azolla filiculoides- Anabaena azollae association
van Kempen, Monique; Smolders, Fons; Speelman, Eveline; Reichart, Gert Jan; Barke, Judith; Brinkhuis, Henk; Lotter, Andy; Roelofs, Jan
2010-05-01
The long term effects of salinity stress on the growth, nutrient content and amino acid composition of the Azolla filiculoides - Anabaena azollae association was studied in a laboratory experiment. It was demonstrated that the symbiosis could tolerate salt stress up to 90 mM NaCl, even after a 100 day period of preconditioning at salt concentrations that were 30 mM NaCl lower. In the 120 mM NaCl treatment the Azolla filiculoides survived, but hardly any new biomass was produced. It was shown that during the experiment, A. filiculoides became increasingly efficient in excluding salt ions from the plant tissue and was thus able to increase its salt tolerance. The amino acid analysis revealed that the naturally occurring high glutamine concentration in the plants was strongly reduced at salt concentrations of 120 mM NaCl and higher. This was the result of the reduced nitrogenase activity at these salt concentrations, as was demonstrated in an acetylene reduction assay. We suggest that the high glutamine concentration in the plants might play a role in the osmoregulatory response against salt stress, enabling growth of the A. filiculoides -Anabaena azollae association up to 90 mM NaCl. In a mesocosm experiment it furthermore was demonstrated that Azolla might manipulate its own microenvironment when grown at elevated salt concentration (up to ~50 mmol•L-1) by promoting salinity stratification, especially when it has formed a dense cover at the water surface. Beside salt stress, we also studied the growth of Azolla filiculoides in response to elevated atmospheric carbon dioxide concentration, in combination with different light intensities and different pH of the nutrient solution. The results demonstrated that as compared to the control (ambient pCO2 concentrations), Azolla filiculoides was able to produce twice as much biomass at carbon dioxide concentrations that were five times as high as the ambient pCO2 concentration. However, it was also shown that this
Biological control of Azolla filiculoides in South Africa with the Azolla specialist Stenopelmus rufinasus has been highly successful. However, field surveys showed that the agent utilized another Azolla species, thought to be the native Azolla pinnata subsp. africana, which contradicted host specif...
DIVERSITY AND HOST SPECIFICITY OF AZOLLA CYANOBIONTS(1).
Papaefthimiou, Dimitra; Van Hove, Charles; Lejeune, André; Rasmussen, Ulla; Wilmotte, Annick
2008-02-01
A unique, hereditary symbiosis exists between the water fern Azolla and cyanobacteria that reside within a cavity in the dorsal leaf-lobe of the plant. This association has been studied extensively, and questions have frequently been raised regarding the number and diversity of cyanobionts (cyanobacterial symbionts) among the different Azolla strains and species. In this work, denaturating gradient gel electrophoresis (DGGE) and a clone library based on the 16S rRNA gene were used to study the genetic diversity and host specificity of the cyanobionts in 35 Azolla strains covering a wide taxonomic and geographic range. DNA was extracted directly from the cyanobacterial packets, isolated after enzymatic digestion of the Azolla leaves. Our results indicated the existence of different cyanobiont strains among Azolla species, and diversity within a single Azolla species, independent of the geographic origin of the host. Furthermore, the cyanobiont exhibited host-species specificity and showed most divergence between the two sections of genus Azolla, Azolla and Rhizosperma. These findings are in agreement with the recent redefinition of the taxon Azolla cristata within the section Azolla. With regard to the taxonomic status of the cyanobiont, the genus Anabaena of the Nostocaceae family was identified as the closest relative by this work. © 2008 Phycological Society of America.
Azolla-Anabaena Relationship 1
Meeks, John C.; Steinberg, Nisan A.; Enderlin, Carol S.; Joseph, Cecillia M.; Peters, Gerald A.
1987-01-01
The major radioactive products of the fixation of [13N]N2 by Azolla caroliniana Willd.-Anabaena azollae Stras. were ammonium, glutamine, and glutamate, plus a small amount of alanine. Ammonium accounted for 70 and 32% of the total radioactivity recovered after fixation for 1 and 10 minutes, respectively. The presence of a substantial pool of [13N]N2-derived 13NH4+ after longer incubation periods was attributed to the spatial separation between the site of N2-fixation (Anabaena) and a second, major site of assimilation (Azolla). Initially, glutamine was the most highly radioactive organic product formed from [13N]N2, but after 10 minutes of fixation glutamate had 1.5 times more radiolabel than glutamine. These kinetics of radiolabeling, along with the effects of inhibitors of glutamine synthetase and glutamate synthase on assimilation of exogenous and [13N]N2-derived 13NH4+, indicate that ammonium assimilation occurred by the glutamate synthase cycle and that glutamate dehydrogenase played little or no role in the synthesis of glutamate by Azolla-Anabaena. PMID:16665538
Hydrogen uptake by Azolla-Anabaena
International Nuclear Information System (INIS)
Ruschel, A.P.; Freitas, J.R. de; Silva, P.M.
1984-01-01
The hydrogen uptake in the Azolla-Anabaena system is studied. Tritium is used as tracer. Plants are incubated under different atmosphere composition: a) Air + 3 H 2 ; b) Air + CO 2 + 3 H 2 + CO; c) Air + 3 H 2 + CO; d) Air + CO 2 + 3 H 2 + CO to study the pathway of absorbed hydrogen in the Azolla - Anabaena system. Azolla-Anabaena showed greater hydrogen uptake under argonium atmosphere than under air. Carbon monoxide decreased hydrogen uptake. There are evidences of recycling of the hydrogen evolved through notrogenease. (Author) [pt
Azolla domestication towards a biobased economy?
Brouwer, Paul; Bräutigam, Andrea; Külahoglu, Canan; Tazelaar, Anne O E; Kurz, Samantha; Nierop, Klaas G J; van der Werf, Adrie; Weber, Andreas P M; Schluepmann, Henriette
2014-05-01
Due to its phenomenal growth requiring neither nitrogen fertilizer nor arable land and its biomass composition, the mosquito fern Azolla is a candidate crop to yield food, fuels and chemicals sustainably. To advance Azolla domestication, we research its dissemination, storage and transcriptome. Methods for dissemination, cross-fertilization and cryopreservation of the symbiosis Azolla filiculoides-Nostoc azollae are tested based on the fern spores. To study molecular processes in Azolla including spore induction, a database of 37 649 unigenes from RNAseq of microsporocarps, megasporocarps and sporophytes was assembled, then validated. Spores obtained year-round germinated in vitro within 26 d. In vitro fertilization rates reached 25%. Cryopreservation permitted storage for at least 7 months. The unigene database entirely covered central metabolism and to a large degree covered cellular processes and regulatory networks. Analysis of genes engaged in transition to sexual reproduction revealed a FLOWERING LOCUS T-like protein in ferns with special features induced in sporulating Azolla fronds. Although domestication of a fern-cyanobacteria symbiosis may seem a daunting task, we conclude that the time is ripe and that results generated will serve to more widely access biochemicals in fern biomass for a biobased economy. No claim to original European Union works. New Phytologist © 2014 New Phytologist Trust.
Research on some functions of Azolla in CELSS system
Liu, Xiaofeng; Min, Chen; Xia-shi, Liu; Chungchu, Liu
This article detailed the possibility of using Azolla in CELSS system, the characters of Azolla; the experiments on using Azolla as O 2-releasing plant to provide O 2 for human in airtight chamber; using Azolla as an important biological part for urine solution purification was also introduced.
Azolla domestication towards a biobased economy?
Brouwer, Paul; Brautigam, A.; Kulahoglu, C.; Tazelaar, A.O.E.; Kurz, S.; Nierop, K.G.J.; Werf, van der A.K.; Weber, A.P.M.; Schluepmann, H.
2014-01-01
Due to its phenomenal growth requiring neither nitrogen fertilizer nor arable land and its biomass composition, the mosquito fern Azolla is a candidate crop to yield food, fuels and chemicals sustainably. To advance Azolla domestication, we research its dissemination, storage and transcriptome.
Azolla domestication towards a biobased economy?
Brouwer, Paul; Bräutigam, A.; Külahoglu, C.; Tazelaar, A.O.E.; Kurz, S.; Nierop, K.G.J.; van der Werf, A.; Weber, A.P.M.; Schlupmann, Henriette
Due to its phenomenal growth requiring neither nitrogen fertilizer nor arable land and its biomass composition, the mosquito fern Azolla is a candidate crop to yield food, fuels and chemicals sustainably. To advance Azolla domestication, we research its dissemination, storage and transcriptome.
Stratigraphy and paleoenvironment of the Danish Eocene Azolla event
Heilmann-Clausen, Claus; Beyer, Claus; Snowball, Ian
2010-05-01
Spores (massulae and megaspores) of the freshwater fern Azolla are recorded in several Danish Eocene outcrops and boreholes. The Azolla-bearing interval is 0.5 - ca. 3 m thick and occurs within the L2 Bed, a unit in the lower part of the hemipelagic, bathyal Lillebælt Clay Formation deposited in the central and eastern parts of the North Sea Basin. Intervals of organic-rich clay, usually including two distinctive, black sapropels, are present in the lower part of Bed L2, indicating a generally reduced oxygen content in the bottom waters during this time, with at least two episodes of severe, basinwide stagnation. The oxygen-deficit points to reduced circulation and/or enhanced marine productivity in the North Sea Basin. Azolla occurs in the upper part of this mainly organic-rich interval. The frequency of Azolla spores relative to marine dinoflagellate cysts fluctuates within the interval. The Azolla interval has previously been correlated to levels near the Ypresian/Lutetian transition in Belgium, based on dinoflagellate stratigraphy. Calibration of a new magnetostratigraphic study of the lower Lillebælt Clay with the dinoflagellate biostratigraphy suggests that Bed L2 spans the upper part of Chron 22r, C22n and lower part of C21r. The Azolla pulse spans the upper part of C22n and lowermost part of C21r. The combined bio-magnetostratigraphy from Denmark allows a detailed comparison with published data from the northern part of the Norwegian-Greenland Sea (ODP Hole 913B). The correlation confirms earlier assumptions, which were based on biostratigraphy alone, that the marine Azolla pulse in the two areas, and therefore probably over the whole Norwegian-Greenland Sea - North Sea region, is of the same age. An ongoing palynological study of the L2 Bed has so far revealed no indication for freshwater episodes or brackish waters in the basin during the Azolla pulse, except perhaps for Azolla itself. It is, therefore, suggested that the Azolla spores were transported
Use of azolla as a nitrogen source of lowland rice
International Nuclear Information System (INIS)
Sisworo, E.L.; Widjang, H.S.; Havid, S.; Hendratno; Soleh, S.; Goesworo, S.
1991-01-01
A four years experiment has been carried out to study possibility of using azolla as a nitrogen source for lowland rice. The work done in the first year, experiments were conducted in the wet season (WS) and the dry season (DS) of 1984/1985, was evaluate weather azolla could really increase rice yield. In the second year, experiments done in the WS and DS of 1985/1986, N-derived from azolla (N-dfA) and N-derived from urea (N-dfU) in rice plan were determined. The third year work done in the WS and DS of 1986/1987 was conducted to see what extend azolla could be applied in the terms of kg N/ha as a N-source for rice. While the last year was devoted to study the N-balance of azolla and urea, which was done in the DS of 1988/1989. Results of the experiments show that azolla has the same ability as urea to increase rice azolla interacted with urea. By increasing the azolla level N recovery in rice will decrease. The same phenomena was also found with urea. Another interesting fact is that an azolla cover in the rice field could promote N-uptake from urea. (author). 8 refs, 15 tabs
ANALISIS BEBERAPA UNSUR KIMIA KOMPOS Azolla mycrophylla
Directory of Open Access Journals (Sweden)
Sri Utami Lestari
2018-02-01
Full Text Available The most consumed part of the plants is the leaf part so that the fertilizer provided should contain high nitrogen (N. The nature of the N fertilizer is volatile and when the rainy season there can be washing. When plants deficienci nutrients shows symtoms of yellowing leaves so that the application of N fertilizer to the plant must remain unfulfilled. Azolla is a usable alternative. Azolla has a high N nutrient content because it is symbiotic with anabaena in binding to free nitrogen in the air. The purpose of this study was to determine the chemical composition (pH,N,P,K Azolla mycrophylla. The experiment was conducted experimentally with the first stage of composting azolla after it was done chemical analysis in the laboratory. The result of this research can be concluded that chemical analysis of Azolla mycrophylla cpmpost is as follows :pH 7,17, N 2,57%, P 0,34%, K 0,03%.
Mosquito larval productivity in rice-fields infested with Azolla in Mvomero District, Tanzania.
Mwingira, V S; Mayala, B K; Senkoro, K P; Rumisha, S F; Shayo, E H; Mlozi, M R S; Mboera, L E G
2009-01-01
Azolla (Salviniales: Azollaceae) is known to reduce oviposition and adult emergence of a number of mosquito species. Several species of Azolla are reportedly indigenous to Tanzania. However, the potential of Azolla as a biocontrol agent against malaria mosquitoes has not been evaluated in the country. This cross-sectional study was carried out to assess mosquito larval productivity in irrigated rice-fields infested with Azolla in Mvomero District, Tanzania. A systematic larval sampling covering all open water bodies along designed transect was carried in rice-fields. Larval density was estimated by dipping water bodies with or without Azolla. The degree of Azolla coverage was categorized as 0%, 80%. Larvae densities were categorised as low ( or = 500/m2) productivity. A total of 120 water bodies were surveyed and 105 (87.5%) had Azolla microphyla and A. pinnata at varying degrees of coverage. Of the total 105 water bodies with Azolla, 80 (76.2%) had a green Azolla mat, and 25 (23.8%) a brown Azolla mat. Eighty-eight (73.3%) of the sites were infested with anophelines and 109 (90.8%) with culicine larvae. Seventy percent of all water bodies contained anophelines and culicines in sympatric breeding, while 20.8% and 3.3% had only culicines and anophelines, respectively. The majority (82%) of mosquito breeding sites were found in area with Azolla substrate. Mosquito larva productivity was low in sites with highest (>80%) Azolla coverage. Seventy-two (81.8%) of the anopheline and 90 (82.6%) culicine breeding sites were infested with Azolla. Water bodies infested with green Azolla were more productive than those covered by brown coloured Azolla substrates for both culicines (13%) and anophelines (8%). Of the 1537 field collected larvae that hatched to adult stage, 646 (42.03%) were Anopheles gambiae s.l., 42 (2.73%) were An. funestus and 769 (50.03%) were Culex quinquefasciatus. These findings suggest that the mosquito productivity is low when the Azolla coverage is high
Directory of Open Access Journals (Sweden)
Erna Yuniati
2013-12-01
Full Text Available The research aims at determining the influence of azolla compost and effective microorganism (EM application on the production of King Grass at the 1st and the 2nd cuttings at Sumbersekar field laboratory, Faculty of Animal Husbandry Brawijaya University for four months. The Randomized Block Factorial design was applied with two factors. The first factor was EM4 consists of E1 (EM4 addition and E0 (without EM4. The second factor was the dosage of fertilizer consists of A100 (100% azolla + 0% urea, A75 (75% azolla + 25% urea, A50 (50% azolla + 50% urea, A25 (25% azolla + 75% urea and A0 (0% azolla + 100% urea. The parameters observed comprised the number of tillers, plant height, dry matter (DM leaf production, organic matter (OM content, crude protein (CP content. The study indicates that there were interaction (P<0.05 between EM4 and fertilizer (azolla dosage on plant height, total OM, total CP, DM leaf production, DM stem production, total DM production, and total CP production at the first cutting. Then, at the second cutting there were interaction (P<0.05 among treatments on the number of tillers, total OM, total CP, DM leaf pro-duction, total DM production, and total CP. At the first cutting, the highest values of plant height, leaf OM, stem OM, leaf CP, stem CP, OM production were 86.39%, 92.40%, 7.85%, and 3.89% respectively found at ElA25. Furthermore, at the second cutting the best treatment were ElA25 in which the value of leaf CP content and total DM content were 8.08% and 4.64 kg/plot respectively. The leaf DM production and stem OM content at the first cutting were higher than those at the second cutting. It can be concluded that azolla can substitute the role of urea by 25%.
Azolla--a model organism for plant genomic studies.
Qiu, Yin-Long; Yu, Jun
2003-02-01
The aquatic ferns of the genus Azolla are nitrogen-fixing plants that have great potentials in agricultural production and environmental conservation. Azolla in many aspects is qualified to serve as a model organism for genomic studies because of its importance in agriculture, its unique position in plant evolution, its symbiotic relationship with the N2-fixing cyanobacterium, Anabaena azollae, and its moderate-sized genome. The goals of this genome project are not only to understand the biology of the Azolla genome to promote its applications in biological research and agriculture practice but also to gain critical insights about evolution of plant genomes. Together with the strategic and technical improvement as well as cost reduction of DNA sequencing, the deciphering of their genetic code is imminent.
Mosquito larval productivity in rice-fields infested with Azolla in ...
African Journals Online (AJOL)
Abstract: Azolla (Salviniales: Azollaceae) is known to reduce oviposition and adult emergence of a number of mosquito species. Several species of Azolla are reportedly indigenous to Tanzania. However, the potential of Azolla as a biocontrol agent against malaria mosquitoes has not been evaluated in the country.
PENGARUH DOSIS P DALAM FOSFAT ALAM PADA PENINGKATAN BIOMASA Azolla microphylla Kaulfuss
Directory of Open Access Journals (Sweden)
Mahmudah Hamawi
2015-12-01
Full Text Available Azolla microphylla is one of the green resources fertilizer, adding natural P respectively will increase the biomass including. The on time embedding of azolla are able to provide nutrition to the plants such as rice especially N. The experiment was conducted in Desember 2nd , 2006 - April 5th , 2007 in Tegalgondo, Karangploso, Malang, East Java ( 550 m up sea level. The experiment applied Randomized Block Design (RBD under two factors, dose and embedding time with three replications. The doses were applied are P0 = 0 kg ha-1; P1 = 25 kg P ha-1; P2 = 50 kg P ha-1; and P3 = 75 kg P ha-1 . The embedding times were a day before planting, 50 % azolla in 14, 28 and 24 days after planting, 50 % azolla in 21 and 49 days after planting, and 50 % azolla in 35 day after planting. The parameters of observation were wet weigh of azolla; N, P , K contents before and after treatments and azolla decompositions. The result showed 75 kg P ha-1 with interaction of azolla embedding, was the most effective dose to increased azolla biomass.
Directory of Open Access Journals (Sweden)
M Gharavi Baigi
2016-05-01
Full Text Available In order to evaluate the yield and yield components of rice (Oryza sativa L. cv. Tarom Hashemi in integrated rice, duck and Azolla, an experiment was conducted at the Research Farm of Sari University of Agricultural Sciences and Natural Resources during 2012. Experiment was arranged in split plot based on a randomized complete block design with three replications. The number of ducks as main plots at four levels (0, 400, 800 and 1200 ducks.ha-1 and Nitrogen source as sub plots at four levels (without Azolla and nitrogen, Azolla, Azolla+nitrogen and nitrogen were the treatments. Analysis of variance showed highly significant differences for the number of ducks, Azolla+nitrogen and their interaction effects of plant height, number of tillers.plant-1, number of panicle.plant-1, number of grains.panicle-1, panicle weight, panicle dry weight and grain yield. The results revealed that the highest values of plant height (133 cm, number of tillers (38 tillers.plant-1, number of panicle (24 numbers.plant-1, number of grains (171 numbers.panicle-1, panicle weight (23 g, panicle dry weight (13 g and grain yield (4 t.ha-1 were recorded in 1200 duck pieces per hectare while treated with Azolla (500 g.m-2 and nitrogen (50 kg.ha-1. In conclusion, results of the current experiment showed that increasing of duck number from 400 to 1200 pieces.ha-1 along with Azolla and nitrogen could enhance the yield and yield components of rice (Tarom Hashemi cultivar.
Lead accumulation in the aquatic fern Azolla filiculoides.
Oren Benaroya, Rony; Tzin, Vered; Tel-Or, Elisha; Zamski, Eli
2004-01-01
In this study, we characterized lead (Pb2+) accumulation and storage by the aquatic fern Azolla filiculoides. Lead precipitates were detected in the vacuoles of mesophyll cells of Azolla plants cultured for 6 d in rich growth medium containing 20 mg l(-1) Pb2+. Energy dispersive spectroscopy (EDS) analysis of the relative element content of leaves collected from these plants revealed a 100% increase in the levels of P, S, Na and Ca and a 40% decrease in Mg and Cl compared to the untreated plants. Both Azolla whole plants and isolated apoplasts were incubated for 6 d in 20 mg l(-1) Pb2+. Lead content in the whole plant composed 0.37%, 2.3% and 1.8% of the dry weight after 2, 4 and 6 d of growth, respectively, while the isolated Azolla apoplast contained 0.125%, 1.22% and 1.4% Pb2+, respectively. Lead content in Azolla whole plant increase by 200%, 100% and 22% after 2, 4 and 6 d of growth, respectively, when compared to Azolla apoplast. Dark, electron dense deposits of lead were observed in light and transmission electron microscope in leaf cells treated with lead. All the observed lead deposits were localized in vacuoles while larger lead deposits were found in mature leaves than in young leaves. No lead deposits were found in cells of the cyanobiont Anabaena when the plants were exposed to similar conditions. Activity and content of V-H+-ATPase were studied in Azolla plants grown in the presence of 20, 40 and 80 mg l(-1) of lead for a period of 4 d. Activity of V-H+-ATPase was increased by 190%, 210% and 220%, respectively, but the content of V-H+-ATPase was reduced by all lead concentrations. Copyright 2004 Elsevier SAS
Singh, Satya S; Singh, Santosh K; Mishra, Arun K
2008-01-01
To study the regulation of Na(+) ion by combined-N sources in Azolla pinnata-Anabaena azollae, Na(+) influx, intracellular Na(+) and Na(+) efflux were investigated in the presence of different N-sources (N(2), NH(4)(+), NO(3)(-) and urea) and various NaCl concentrations. Sodium influx by Azolla pinnata fronds was minimum in the presence of NO(3)(-). Almost identical levels of intracellular sodium, although less than N(2) and NH(4)(+) incubated fronds were observed in the presence of NO(3)(-) and urea. Efflux of sodium was minimum in urea and NO(3)(-) grown fronds. A low residual sodium was observed in the fronds incubated in NO(3)(-) and urea supplemented media. Results suggest that nitrate and urea curtailed the entry of sodium, reduced salt toxicity maximally by maintaining the minimum level of sodium and also conserved energy due to slow influx and efflux of Na(+) within the fronds during salt shock and the process of adaptation.
Response of nitrogen-fixing water fern Azolla biofertilization to rice crop.
Bhuvaneshwari, K; Singh, Pawan Kumar
2015-08-01
The water fern Azolla harbors nitrogen-fixing cyanobacterium Anabaena azollae as symbiont in its dorsal leaves and is known as potent N 2 fixer. Present investigation was carried out to study the influence of fresh Azolla when used as basal incorporation in soil and as dual cropped with rice variety Mahsoori separately and together with and without chemical nitrogen fertilizer in pots kept under net house conditions. Results showed that use of Azolla as basal or dual or basal plus dual influenced the rice crop positively where use of fern as basal plus dual was superior and served the nitrogen requirement of rice. There was marked increase in plant height, number of effective tillers, dry mass and nitrogen content of rice plants with the use of Azolla and N-fertilizers alone and other combinations. The use of Azolla also increased organic matter and potassium contents of the soil.
The Eocene Arctic Azolla bloom: environmental conditions, productivity and carbon drawdown.
Speelman, E N; Van Kempen, M M L; Barke, J; Brinkhuis, H; Reichart, G J; Smolders, A J P; Roelofs, J G M; Sangiorgi, F; de Leeuw, J W; Lotter, A F; Sinninghe Damsté, J S
2009-03-01
Enormous quantities of the free-floating freshwater fern Azolla grew and reproduced in situ in the Arctic Ocean during the middle Eocene, as was demonstrated by microscopic analysis of microlaminated sediments recovered from the Lomonosov Ridge during Integrated Ocean Drilling Program (IODP) Expedition 302. The timing of the Azolla phase (approximately 48.5 Ma) coincides with the earliest signs of onset of the transition from a greenhouse towards the modern icehouse Earth. The sustained growth of Azolla, currently ranking among the fastest growing plants on Earth, in a major anoxic oceanic basin may have contributed to decreasing atmospheric pCO2 levels via burial of Azolla-derived organic matter. The consequences of these enormous Azolla blooms for regional and global nutrient and carbon cycles are still largely unknown. Cultivation experiments have been set up to investigate the influence of elevated pCO2 on Azolla growth, showing a marked increase in Azolla productivity under elevated (760 and 1910 ppm) pCO2 conditions. The combined results of organic carbon, sulphur, nitrogen content and 15N and 13C measurements of sediments from the Azolla interval illustrate the potential contribution of nitrogen fixation in a euxinic stratified Eocene Arctic. Flux calculations were used to quantitatively reconstruct the potential storage of carbon (0.9-3.5 10(18) gC) in the Arctic during the Azolla interval. It is estimated that storing 0.9 10(18) to 3.5 10(18) g carbon would result in a 55 to 470 ppm drawdown of pCO2 under Eocene conditions, indicating that the Arctic Azolla blooms may have had a significant effect on global atmospheric pCO2 levels through enhanced burial of organic matter.
Aquatic plant Azolla as the universal feedstock for biofuel production.
Miranda, Ana F; Biswas, Bijoy; Ramkumar, Narasimhan; Singh, Rawel; Kumar, Jitendra; James, Anton; Roddick, Felicity; Lal, Banwari; Subudhi, Sanjukta; Bhaskar, Thallada; Mouradov, Aidyn
2016-01-01
The quest for sustainable production of renewable and cheap biofuels has triggered an intensive search for domestication of the next generation of bioenergy crops. Aquatic plants which can rapidly colonize wetlands are attracting attention because of their ability to grow in wastewaters and produce large amounts of biomass. Representatives of Azolla species are some of the fastest growing plants, producing substantial biomass when growing in contaminated water and natural ecosystems. Together with their evolutional symbiont, the cyanobacterium Anabaena azollae, Azolla biomass has a unique chemical composition accumulating in each leaf including three major types of bioenergy molecules: cellulose/hemicellulose, starch and lipids, resembling combinations of terrestrial bioenergy crops and microalgae. The growth of Azolla filiculoides in synthetic wastewater led up to 25, 69, 24 and 40 % reduction of NH 4 -N, NO 3 -N, PO 4 -P and selenium, respectively, after 5 days of treatment. This led to a 2.6-fold reduction in toxicity of the treated wastewater to shrimps, common inhabitants of wetlands. Two Azolla species, Azolla filiculoides and Azolla pinnata, were used as feedstock for the production of a range of functional hydrocarbons through hydrothermal liquefaction, bio-hydrogen and bio-ethanol. Given the high annual productivity of Azolla, hydrothermal liquefaction can lead to the theoretical production of 20.2 t/ha-year of bio-oil and 48 t/ha-year of bio-char. The ethanol production from Azolla filiculoides, 11.7 × 10 3 L/ha-year, is close to that from corn stover (13.3 × 10 3 L/ha-year), but higher than from miscanthus (2.3 × 10 3 L/ha-year) and woody plants, such as willow (0.3 × 10 3 L/ha-year) and poplar (1.3 × 10 3 L/ha-year). With a high C/N ratio, fermentation of Azolla biomass generates 2.2 mol/mol glucose/xylose of hydrogen, making this species a competitive feedstock for hydrogen production compared with other bioenergy crops
Orbitally-forced Azolla blooms and middle Eocene Arctic hydrology; clues from palynology
Barke, Judith; Abels, Hemmo A.; Sangiorgi, Francesca; Greenwood, David R.; Sweet, Arthur R.; Donders, Timme; Lotter, Andre F.; Reichart, Gert-Jan; Brinkhuis, Henk
2010-05-01
The presence of high abundances of the freshwater fern Azolla in the early Middle Eocene central Arctic Ocean sediments recovered from the Lomonosov Ridge during IODP Expedition 302, have been related to the presence of a substantial freshwater cap. Azolla massulae, belonging to the newly described Eocene species Azolla arctica Collinson et al., have been found over at least a ~4 m-thick interval. There are strong indications that Azolla has bloomed and reproduced in situ in the Arctic Ocean for several hundreds of thousands of years. Possible causes for the sudden demise of Azolla at ~48.1 Ma include salinity changes due to evolving oceanic connections or sea-level change. Distinct cyclic fluctuation in the Azolla massulae abundances have previously been related to orbitally forced climate changes. In this study, we evaluate the possible underlying forcing mechanisms for these freshwater cycles and for the eventual demise of Azolla in an integrated palynological and cyclostratigraphical approach. Our results show two clear periodicities of ~1.3 and ~0.7 m in all major aquatic and terrestrial palynomorph associations, which we can relate to obliquity (41 ka) and precession (~21 ka), respectively. Cycles in the abundances of Azolla, freshwater-tolerant dinoflagellate cysts, and swamp vegetation pollen show co-variability in the obliquity domain. Their strong correlation suggests periods of enhanced rainfall and runoff during Azolla blooms, possibly associated with increased summer season length and insolation during obliquity maxima. Cycles in the angiosperm pollen record are in anti-phase with the Azolla cycles. We interpret this pattern as edaphically drier conditions on land and reduced associated runoff during Azolla lows, possibly corresponding to obliquity minima. The precession signal is distinctly weaker than that for obliquity, and is mainly detectable in the cold-temperate Larix and bisaccate conifer pollen abundances, which is interpreted as a response to
GEVREK, Mithat Nuri
2015-01-01
u çalışmada bazı azolla (Azolla anabaena L.) genotiplerinin Akdeniz-Ege kıyı kuşağına adaptasyonunun belirlenmesi amaçlanmıştır. Araştırma 20022003 ve 2003-2004 yıllarında Ege Üniversitesi Ziraat Fakültesi’nin Menemen
Studies on Using Azolla for O2-Supplementation and Its Test
Liu, C.-C.; Liu, X.-S.; Chen, M.; Bian, Z.-L.
Establishment of Controlling Ecological Life Safety System (CELSS) is a key technical part in the study on manned station. In order to meet the requirement of long-term out-earth man-carrying flight, it is necessary to build plant-based O2-supplying CELSS. It also possesses the possibility to contribute the realization of mankind dream to live in out-earth planets. Using the physiological reaction of organisms, this system settled the problem in food supply, O2 and water recycle, the regeneration and utilization of CO2 and life residues, thus guarantee the spacemen the health, safety and efficient work when they are far from earth and arrived the space where human is difficult to life in. Azolla as a plant that possesses high growing speed, short growing cycle, high photosynthesis and O2-releasing capacity, and can be artificially grow in multi-layer facilities, it is hopeful to be an important biological part in CELSS for it's the function in O2 production and to be a part of fresh vegetable as well as CO2 absorption. This paper described the study in Azolla as a plant for supplementary O2 supply in future space station flight. The "Azolla-dog" controlling tight system was firstly established in order to determine the regulation of O2-CO2 variation and balance using different weights of dogs with different Azolla growing areas. The further studies included the development of air-tight cabinets where "Azolla-human" airtight experiments were conducted, and the relationship between Azolla-growing area and O2 requirement by human was analyzed. Based on these works, the further experiment on supplementary O2-supply of Azolla-human system was conducted in demonstration cabin for environmental controlling and life security. The O2-supplying amount of Azolla was further gained, and it will provide the experimental basis to probe optimum condition to grow Azolla in space and human-machine combining experiment, also to lay a basis for Azolla as a biological part to enter
Phytoremediation potential of aquatic macrophyte, Azolla.
Sood, Anjuli; Uniyal, Perm L; Prasanna, Radha; Ahluwalia, Amrik S
2012-03-01
Aquatic macrophytes play an important role in the structural and functional aspects of aquatic ecosystems by altering water movement regimes, providing shelter to fish and aquatic invertebrates, serving as a food source, and altering water quality by regulating oxygen balance, nutrient cycles, and accumulating heavy metals. The ability to hyperaccumulate heavy metals makes them interesting research candidates, especially for the treatment of industrial effluents and sewage waste water. The use of aquatic macrophytes, such as Azolla with hyper accumulating ability is known to be an environmentally friendly option to restore polluted aquatic resources. The present review highlights the phytoaccumulation potential of macrophytes with emphasis on utilization of Azolla as a promising candidate for phytoremediation. The impact of uptake of heavy metals on morphology and metabolic processes of Azolla has also been discussed for a better understanding and utilization of this symbiotic association in the field of phytoremediation.
Kollah, Bharati; Patra, Ashok Kumar; Mohanty, Santosh Ranjan
2016-03-01
This review addresses the perspectives of Azolla as a multifaceted aquatic resource to ensure ecosystem sustainability. Nitrogen fixing potential of cyanobacterial symbiont varies between 30 and 60 kg N ha(-1) which designates Azolla as an important biological N source for agriculture and animal industry. Azolla exhibits high bioremediation potential for Cd, Cr, Cu, and Zn. Azolla mitigates greenhouse gas emission from agriculture. In flooded rice ecosystem, Azolla dual cropping decreased CH4 emission by 40 % than did urea alone and also stimulated CH4 oxidation. This review highlighted integrated approach using Azolla that offers enormous public health, environmental, and cost benefits.
Removal of contaminants in a paper mill effluent by Azolla caroliniana
Directory of Open Access Journals (Sweden)
D. Sivakumar
2015-09-01
Full Text Available This study was focused on removal of various parameters in paper mill effluent using a method called bioremediation by Azolla caroliniana. The experimental investigations have been carried out using Azolla caroliniana for conducting the sorption study with various dilution ratios (2, 4, 6, 8, and 10, pH (3, 4, 5, 6, 7, 8 and 9 and biomass (200, 400, 600, 800 and 1000 g. The maximum removal percentage of TDS, BOD and COD in a paper mill effluent was obtained at the optimum dilution ratio of 6, pH of 8 and biomass of 800 g. The results of this study indicated that the maximum removal percentage of TDS, BOD and COD in a paper mill effluent was 82.3 %, 88.6 % and 79.1 % respectively. Also, the study focused on uptake of TDS, BOD and COD in paper mill effluent by Azolla caroliniana through bioaccumulation factor and translocation factor. The results of bioaccumulation factor revealed that TDS, BOD and COD in paper mill effluent were adsorbed by Azolla caroliniana. The results of translocation factor revealed that the roots of Azolla caroliniana translocate the TDS, BOD and COD in a paper mill effluent to the shoots of Azolla caroliniana. From the results, this study concluded that bioremediation by Azolla caroliniana could be effectively used for removing TDS, BOD and COD in a paper mill effluent. This study also suggested that Azolla caroliniana may be used for removing various contaminants, not only from paper mill effluent, but also from any other industrial effluents.
Climatic conditions governing extensive Azolla bloom during the Middle Eocene
Dekker, Rolande; Speelman, Eveline N.; Barke, Judith; Konijnendijk, Tiuri; Sinninge Damste, Jaap S.; Reichart, Gert-Jan
2010-05-01
Enormous amounts of intact mega- and microspores from the free floating aquatic fern Azolla were found in sediments recovered during Integrated Ocean Drilling Program expedition 302, indicating that Azolla grew and reproduced in situ in the Eocene Arctic Ocean. In general, the Early/Middle Eocene is characterized by enhanced greenhouse conditions with elevated sea surface temperatures (SSTs) in the Arctic (~10°C), while tropical sea surface temperatures (SSTs) were only a little warmer than today (with a mean annual temperature (MAT) of 32-34 °C) (Pearson et al., 2007). The consequently reduced temperature gradient between the equator and the poles and the presence of freshwater at the North Pole as indicated by the presence of the freshwater fern Azolla (Brinkhuis et al., 2006) provide important boundary conditions for understanding the hydrological cycle and latent heat transport during this interval. Here we reconstruct variations in SST and mean annual air temperature using the TEX86 and MBT temperature proxies for the Azolla interval. Sediments from around the Arctic Basin have been analyzed, including samples from Alaska, the Mackenzie Basin, Greenland (IODP core 913b), and Denmark. Furthermore, a high resolution sea surface temperature record for the Azolla interval has been constructed from sediment samples from the Lomonosov Ridge, showing a cyclic signal. Model experiments have shown that the here confirmed low equator-to-pole temperature gradient modulated the hydrological cycle. Since the growth of Azolla is restricted to low salinity conditions, changes in the hydrological cycle are proposed to coincide with the cyclic occurrence of Azolla throughout the interval. To confirm the overlapping presence of high quantities of Azolla and increased precipitation, changes in the hydrogen cycle are reconstructed by creating a high resolution hydrogen isotope record throughout the interval. By performing compound specific analyses (δD) on terrestrial derived
CHANGES IN SOIL CHEMICAL PROPERTIES OF ORGANIC PADDY FIELD WITH AZOLLA APPLICATION
Directory of Open Access Journals (Sweden)
Jauhari Syamsiyah
2016-12-01
Full Text Available The use of organic fertilizer is a way to improve soil fertility. Azolla can be used as organic fertilizer. This study aims to determine the effect of Azolla (Azolla mycrophylla. L on some soil chemical properties on organic paddy field. The field experiments used factorial complete randomized block design of three factors, namely Azolla (0 and 2 tons/ha, Manure (0 and 10 tons/ha and Rice Varieties (Mira1, Mentik Wangi and Merah Putih, with three times replication. Using Azolla on an organic paddy field does not significantly increase the levels of soil N, organic C, Cation Exchange Capacity and soil pH. However Azolla’s influence on soil available P is significant.
Influence of azolla on rice growth treated with and without N fertilizer
International Nuclear Information System (INIS)
Sisworo, E.L.; Sisworo, W.H.; Hendratno; Rasyid, H.; Solahuddin, S.; Partohardjono, S.
1987-01-01
Influence of azolla on rice growth treated with and without fertilizer. An experiment to investigate the influence of azolla on growth of rice treated with and without N fertilizer has been carried out in the rainy season 1984/1985 at the Muara Experimental Station, Bogota. Rice variety used in this experiment was Atomita I. Eight treatments employed in this experiment were treatments without azolla and N fertilizer, with azolla alone, with N fertilizer alone, and a combination of azolla and N fertilizer used was urea labelled with 5% 15 N atom excess. Parameters observed were: dry weight, total-N and N-derived from fertilizer in rough grain, straw and plant. Data from this experiment indicated that azolla was able to produce similar yield of rough grain, straw and plant with those produced by N fertilizer applied at a rate of 90 kg N/ha. These data were much higher compared to N fertilizer applied at a rate of 30 and 60 kg N/ha. The same trend was found in yield of N. It turned out that apparently azolla is effective to increase rice production. (author). 3 figs., 8 refs
Masood, Amjad; Zeeshan, M; Abraham, G
2008-06-01
Effect of ultravilolet-B (0.4 Wm(-2)) irradiation on growth, flavonoid content, lipid peroxidation, proline accumulation and activities of superoxide dismutase and peroxidase was comparatively analysed in Azolla pinnata and Azolla filiculoides. Growth measured as increment in dry weight reduced considerably due to all UV-B treatments. However, the reduction was found to be severe in A. filiculoides as compared to A. pinnata. The level of UV-absorbing compound flavonoids increased significantly in A. pinnata plants whereas only a slight increase in the flavonoid content was observed in A. filiculoides. UV-B exposure led to enhanced production of malondialdehyde (MDA) and electrolyte leakage in A. filiculoides than A. pinnata. Proline accumulation also showed a similar trend. Marked differences in the activity of antioxidant enzymes such as superoxide dismutase (SOD) and peroxidase (POD) was noticed in both the plants exposed to UV-B. Our comparative studies indicate A. pinnata to be better tolerant to UV-B as compared with A. filiculoides which appears to be sensitive.
Fertilizer effect Azolla - Anabaena in maize (Zea mays L.
Directory of Open Access Journals (Sweden)
Aldás-Jarrín Juan Carlos
2016-11-01
Full Text Available The deterioration of natural resources in agricultural activities, has motivated the search for new alternatives to enrich the soil with macro and micro nutrients sustainably, for the benefit of future generations, just as you think about the conservation and maintenance of water, avoiding eutrophication problems by the accumulation of fertilizers (nitrates and nitrites leached and deposited in natural sources, for this purpose they have been measured several agro ecological options that provide proper nutrition and a delicate ecological balance; in this investigation at field level in maize cultivation and different states it applied dose of azolla as a natural source of nitrogen to enrich the soil in the canton Cevallos, Tungurahua province. Anabaena floors of the town, based on the state of azolla and the level established for such preparation, the states of azolla. Six mixtures were prepared substrates azolla studied were: Dry A1 and A2 in the fresh state; the doses were established in relation to the volume of azolla against soil volume used: (0.5: 1 (0.75: 1 and (1: 1. The data collected were plant height and percentage of nitrogen in dry matter at 15, 30, 60 and 90 days. All this in order to establish the amount of nitrogen contributed by azolla as biofertilizer in growing corn. The best results were presented at the A1D3 (azolla dry-Dose 1: 1 treatment given plant height 15.02 cm at 15 days, 35.88 cm 30 days, 53.22 cm 60 66.12 days and 90 days; to 0.54% nitrogen percentage at 15 days, 0.90% at 30 days, 1.68% at 60 days and 2.08% after 90 days. In conclusion, the use of Azolla as a bio-fertilizer rich in nitrogen is feasible, as has been demonstrated in this research that the corn plant benefits from the contribution of this material, improving sustainable agricultural practices. It is recommended to expand this research in the same crop or other commercially important crops until the end of its production cycle, to report the results of
Comparison of biomass productivity and nitrogen fixing potential of Azolla SPP
Energy Technology Data Exchange (ETDEWEB)
Arora, A.; Singh, P.K. [Indian Agricultural Research Inst., New Delhi (India)
2003-03-01
Study was conducted on six different Azolla species, available in the germplasm collection of NCCUBGA, IARI, New Delhi namely A. filiculoides, A. mexicana, A. microphylla, A. pinnata, A. rubra and A. caroliniana in a polyhouse to assess their growth potential by determining their maximal biomass productivity, doubling time and relative growth rates. Their nitrogen fixing potential was assessed by acetylene reduction assay. Among them Azolla microphylla gave highest biomass production and relative growth rate followed by Azolla caroliniana. Both these had high nitrogenase activity also. Peak nitrogenase activity of these strains was found on 14th day of growth and it declined on further incubation. Azolla microphylla and Azolla rubra were more tolerant to salinity than others. On the other hand Azolla pinnata, which is endemic species found in India, exhibited low biomass production, relative growth rate and lower nitrogenase activity compared to other species. It was unable to sustain growth in saline medium. Under polyhouse conditions, A. microphylla was found to perform better than other cultures in terms of biomass productivity, N fixing ability and salt tolerance. Hence it is taken up for mass production.(author)
Population Dynamics of Biota on the Roots of Azolla microphylla Kaulfuss
Directory of Open Access Journals (Sweden)
NITA ETIKAWATI
2000-01-01
Full Text Available Azolla was a special fern that their associations with Anabaena azollae able to fix free nitrogen from air, to produce protein. Although by the ages, biota diversity those habits on the roots of Azolla increased and effected to protein concentration. The research was to find out population dynamics of biota on the roots of Azolla microphylla Kaulfuss and the growth peak. This study used Completely Randomized Design with 10 kinds of biota, i.e. bacteria, Fungi, Actinomycetes, Protozoa, Alga, Crustacean, Rotifers, Coelenterate, Insect and Molluscs, and it was used 3 replications. Research was conducted within 4 weeks and the populations of biota were observed every week. Data were statistically analyzed using Analysis Variant and Duncan’s Multiple Range Test. The population dynamics of biota on the roots of Azolla microphylla Kaulfuss were influenced on its quantity and composition, and the growth peak is done in 2nd week.
Ray, Thomas B.; Mayne, Berger C.; Toia, Robert E.; Peters, Gerald A.
1979-01-01
Photosynthesis in the Azolla-Anabaena association was characterized with respect to photorespiration, early products of photosynthesis, and action spectra. Photorespiration as evidenced by an O2 inhibition of photosynthesis and an O2-dependent CO2 compensation concentration was found to occur in the association, and endophyte-free fronds, but not in the endophytic Anabaena. Analysis of the early products of photosynthesis indicated that both the fern and cyanobacterium fix CO2 via the Calvin cycle. The isolated endophytic Anabaena did not release significant amounts of amino acids synthesized from recently fixed carbon. The action spectra for photosynthesis in the Azolla-Anabaena association indicated that the maximum quantum yield is between 650 and 670 nanometers, while in the endophyte the maximum is between 580 and 640 nanometers. Although the endophytic cyanobacterium is photosynthetically competent, any contribution it makes to photosynthesis in the intact association was not apparent in the action spectrum. PMID:16661055
Pig-duck-fish-azolla integration in La Union, Philippines
Gavina, L.D.
1994-01-01
Three studies on pig-duck-fish-azolla integration were conducted simultaneously in La Union, Philippines. Growth performance of pigs and ducks as affected by different levels of azolla meal in their feed, and that of tilapia (Oreochromis niloticus) under varying stocking rates are presented and discussed.
Azolla filiculoides Nitrogenase Activity Decrease Induced by Inoculation with Chlamydomonas sp. †
Habte, Mitiku
1986-01-01
Experiments were conducted to determine the influence of Chlamydomonas sp. on nitrogen fixation (C2H2 → C2H4) in Azolla filiculoides and on the nitrogen fixation and growth of free-living Anabaena azollae 2B organisms. Inoculation of azolla medium with Chlamydomonas sp. was associated with decreased nitrogenase activity in A. filiculoides and with increases in the density of a fungal population identified as Acremonium sp. Subsequent inoculation of azolla medium with this fungus was also accompanied by a significant decrease in nitrogenase activity of A. filiculoides. However, the extent of depression of nitrogenase activity was significantly higher when azolla medium was inoculated with Chlamydomonas sp. than when it was inoculated with Acremonium sp. Inoculation of nitrogen-free Stanier medium with either Acremonium sp. or Chlamydomonas sp. did not adversely affect the growth or nitrogenase activity of free-living A. azollae. Decreased nitrogenase activity in A. filiculoides is apparently related to the adverse influence of the green alga and the fungus on the macrosymbiont. The mechanisms that might be involved are discussed. PMID:16347211
Efficacy of oxygen-supplying capacity of Azolla in a controlled life support system
Chen, Min; Deng, Sufang; Yang, Youquan; Huang, Yibing; Liu, Chongchu
2012-02-01
Azolla shows high growth and propagation rates, strong photosynthetic O2-releasing ability and high nutritional value. It is suitable as a salad vegetable and can be cultured on a multi-layered wet bed. Hence, it possesses potential as a fresh vegetable, and to release O2 and absorb CO2 in a Controlled Ecological Life Support System in space. In this study, we investigated the O2-providing characteristics of Azolla in a closed chamber under manned, controlled conditions to lay a foundation for use of Azolla as a biological component in ground simulation experiments for space applications. A closed test chamber, representing a Controlled Ecological Life Support System including an Azolla wet-culture device, was built to measure the changes in atmospheric O2 and CO2 concentrations inside the chamber in the presence of coexisting Azolla, fish and men. The amount of O2 consumed by fish was 0.0805-0.0831 L kg-1 h-1 and the level of CO2 emission was 0.0705-0.0736 L kg-1 h-1; O2 consumption by the two trial volunteers was 19.71 L h-1 and the volume of respiration-released CO2 was 18.90 L h-1. Under 7000-8000 Lx artificial light and Azolla wet-culture conditions, human and fish respiration and Azolla photosynthesis were complementary, thus the atmospheric O2 and CO2 concentrations inside chamber were maintained in equilibrium. The increase in atmospheric CO2 concentration in the closed chamber enhanced the net photosynthesis efficiency of the Azolla colony. This study showed that Azolla has strong photosynthetic O2-releasing ability, which equilibrates the O2 and CO2 concentrations inside the chamber in favor of human survival and verifies the potential of Azolla for space applications.
Understanding nutrient exchange between Azolla and its symbiont, Nostoc
Eily, Ariana
2017-01-01
This is an in-depth look at the research I am doing for my doctoral degree at Duke University, investigating the exchange of nutrients between the aquatic fern genus, Azolla, and its cyanobacterial symbiont, Nostoc azollae. All of the illustrations and microscopy images within this presentation are my own.
Rai, Vandna; Sharma, Naveen Kumar; Rai, Ashwani K
2006-09-01
Salinity, at a concentration of 10 mM NaCl affected the growth of Azolla pinnata-Anabaena azollae association and became lethal at 40 mM. Plants exposed up to 30 mM NaCl exhibited longer roots than the control, especially during the beginning of incubation. Average root number in plants exposed to 10 and 20 mM NaCl remained almost the same as in control. A further rise in NaCl concentration to 30 mM reduced the root number, and roots shed off at 40 mM NaCl. Presence of NaCl in the nutrient solution increased the cellular Na+ of the intact association exhibiting differential accumulation by individual partners, while it reduced the cellular Ca2+ level. However, cellular K+ content did not show significant change. Cellular Na+ based on fresh weight of respective individual partners (host tissues and cyanobiont) remained higher in the host tissues than the cyanobiont, while reverse was true for K+ and Ca2+ contents. The contribution of A. azollae in the total cellular ion content of the association was a little because of meagre contribution of the cyanobiont mass (19-21%). High salt sensitivity of Azolla-Anabaena complex is due to an inability of the association to maintain low Na+ and high Ca2+ cellular level.
The omnipresent water fern Azolla caroliniana does not contain lignin
Nierop, K.G.J.; Speelman, E.N.; Leeuw, J.W. de; Reichart, G.-J.
2011-01-01
Several studies have reported the presence of large amounts of lignin in ubiquitously occurring species of the freshwater fern Azolla. Molecular analysis using flash pyrolysis and thermally assisted hydrolysis and methylation shows, however, that neither the leaves nor the roots of Azolla contain
Effect of inoculating blue-green algae and Azolla on rice yield
International Nuclear Information System (INIS)
Kulasooriya, S.A.
1985-01-01
Nitrogen fixing blue-green algae (BGA) and the Azolla-Anaebaena symbiosis are potential alternative sources of nitrogen for lowland rice production. A survey of the literature shows that on the average, when BGA inoculation is effective, a rice yield increase of 14% (450 kg grain ha -1 ) has been observed. However, in Sri Lanka no significant increases in grain yield have been observed due to BGA inoculation. Azolla inoculation in broadcast, transplanted, and avenue transplanted rice gave yield increases of 12, 22 and 48%, and was equivalent to 55 to 80 kg N ha -1 as urea. Azolla was observed to reduce weed growth by 53%. Azolla is easier to establish in rice fields since it can be easily recognized with the naked eye, however, BGA are better able to withstand periods of desiccation which occur in rain-fed rice production. Most algalization experiments have been performed on a ''black box'' basis where only the final grain yield has been measured. Isotope experiments can play a vital role in understanding the processes by which BGA and Azolla increase rice yields. (author)
Localization and toxic effects of cadmium, copper, and uranium in Azolla
International Nuclear Information System (INIS)
Sela, M.; Tel-Or, E.; Fritz, E.; Huttermann, A.
1988-01-01
The storage and distribution of copper, cadmium, and uranium and their effects on ionic contents in roots and shoots of Azolla filiculoides has been studied by x-ray microanalysis. The relative content of copper was eightfold higher in the root than in the shoot, suggesting low mobility of this metal in Azolla plant. Cadmium relative content in the shoot was similar to its content in the root, hence its mobility was relatively high. The absence of significant uranium quantities in the shoot and its relative high content in the root suggest the immobility of this metal from Azolla root. Cadmium formed precipitates with phosphate and calcium in xylem cells of the shoot bundle and caused a two- to threefold increase in the content of phosphate in the root. Uranium in roots and cadmium in shoots were associated with calcium. All three treatments caused losses of potassium, chloride, and magnesium from Azolla roots. Accumulation of heavy metals in Azolla and their mobility from the root to the shoot can be correlated with damage caused by the loss of essential nutrients
Localization and toxic effects of cadmium, copper, and uranium in azolla.
Sela, M; Tel-Or, E; Fritz, E; Huttermann, A
1988-09-01
The storage and distribution of copper, cadmium, and uranium and their effects on ionic contents in roots and shoots of Azolla filiculoides has been studied by x-ray microanalysis. The relative content of copper was eightfold higher in the root than in the shoot, suggesting low mobility of this metal in Azolla plant. Cadmium relative content in the shoot was similar to its content in the root, hence its mobility was relatively high. The absence of significant uranium quantities in the shoot and its relative high content in the root suggest the immobility of this metal from Azolla root. Cadmium formed precipitates with phosphate and calcium in xylem cells of the shoot bundle and caused a two- to threefold increase in the content of phosphate in the root. Uranium in roots and cadmium in shoots were associated with calcium. All three treatments caused losses of potassium, chloride, and magnesium from Azolla roots. Accumulation of heavy metals in Azolla and their mobility from the root to the shoot can be correlated with damage caused by the loss of essential nutrients.
Aspects of nitrogen and carbon interchange in the Azolla-Anabaena symbiosis
International Nuclear Information System (INIS)
Peters, G.A.; Kaplan, D.; Meeks, J.C.; Buzby, K.M.; Marsh, B.H.; Corbin, J.L.
1985-01-01
The free-floating aquatic pteridophytes in the genus Azolla contain an N 2 -fixing cyanobacterium, Anabaena azollae, as a symbiont. Six extant species usually are recognized. In each species the symbiotic Anabaena can provide the total N requirement of the association via N 2 fixation and the Azolla sporophytes are capable of prolific vegetative reproduction in the absence of a combined N source. While vegetative reproduction and growth is more common, sexual reproduction occurs and presumably provides a means for survival during unfavorable environmental conditions. Azolla is heterosporous, producing both megasporocarps and microsporocarps on the same plant. Species demarcation is based primarily upon the morphology of these structures. Anabaena filaments are partitioned into both types of sporocarps during their development. The endophyte within the megasporocarp provides an inoculum for the developing sporophyte, maintaining the symbiosis. This report is restricted to studies conducted with the vegetatively propagated Azolla caroliniana - Anabaena azollae symbiosis grown on medium without combined N. It focuses on recent approaches to further elucidate aspects of host-endophyte interaction and incorporates analyses of soluble amino acids and ammonium, assays of ammonia assimilating enzymes, the use of [ 13 N]N 2 and the analysis of soluble sugars as well as 14 CO 2 -pulse chase studies. For orientation purposes the results are preceded by a description of the symbiosis. 39 references, 3 figures, 3 tables
Putra, Dwi Firmansyah; Soenaryo, Soenaryo; Tyasmoro, Setyono Yudo
2013-01-01
Jagung manis sangat responsif terhadap pupuk N, agar kebutuhan N terpenuhi dan memberikan nilai tambah dapat menyuburkan tanah tanpa menurunkan produktifitas jagung manis, maka diperlukan penyeimbang berupa pupuk organik yang memiliki kandungan N tinggi. Pupuk organik potensial yang memiliki kandungan N tinggi yaitu Azolla. Azolla dapat ditemukan dalam 3 bentuk yaitu Azolla segar, Azolla kering dan kompos Azolla. Penelitian ini bertujuan untuk mengetahui pengaruh aplikasi Azolla segar, Azolla...
The potential of the fresh-water fern Azolla in aquatic farming systems
Bijl, Peter K.; Werf, vd, Adrie; Schluepmann, Henriette; Reichart, Gert-Jan; Brouwer, Paul; Nierop, Klaas G. J.; Hellgardt, Klaus; Brinkhuis, Henk
2014-05-01
With aquatic farming systems a new avenue in agriculture is explored, in which the competition with conventional arable land is avoided. The aquatic, ubiquitous, floating fern Azolla is not yet widely explored as potential crop in such farming systems, despite its high potential because it grows in many natural systems under low-light intensities, has an enormous annual yield, and has special biomass qualities for applications in food, feed and specialty chemical industries. But, what makes Azolla particularly interesting as cost-effective crop is its capability to take up atmospheric nitrogen through symbiosis with nitrogen-fixing bacteria Anabaena azollae. This makes Azolla independent of nitrogen fertilization. In order to explore the potential of Azolla as a crop for a suite of applications, we have assembled a team of expertise: AZOFAST, consisting of agricultural engineers, plant physiologists, chemical engineers and organic chemists. Our growth experiments reveal high annual production yields with constant harvest. We are developing a germination and spore collecting/preservation protocol as a first step to domestication. Finally we have explored the biomass quality of different species of extant Azolla. We performed organic chemical analyses on lipid and tannin extracts, and quantified yields of specific compounds within these fractions. In our presentation we will present some of our results to show the potential of Azolla as a new, sustainable aquatic crop serving all kinds of industrial streams from protein feed to platform chemicals.
Study on O2-supplying characteristics of Azolla in Controlled Ecological Life Support System
Chen, Min; Deng, Sufang; Yang, Youquang; Huang, Yibing; Liu, Zhongzhu
Azolla has high growth and propagation rate, strong photosynthetic O2-releasing ability and rich nutrient value. It is able to be used as salad-type vegetable, and can also be cultured on wet bed in multi-layer condition. Hence, it possesses a potential functioning as providing O2, fresh vegetable and absorbing CO2 for Controlled Ecological Life Support System in space. In this study, we try to make clear the O2-providing characteristics of Azolla in controlled close chamber under manned condition in order to lay a foundation for Azolla as a biological component in the next ground simulated experiment and space application. A closed test cham-ber of Controlled Ecological Life Support System and Azolla wet-culturing devices were built to measure the changes of atmospheric O2-CO2 concentration inside chamber under "Azolla-fish -men" coexisting condition. The results showed that, the amount of O2 consumption is 80.49 83.07 ml/h per kilogram fish, the amount of CO2 emissions is 70.49 73.56 ml/(kg • h); O2 consumption of trial volunteers is 19.71 L/h, the volume of respiration release CO2 18.90 L/h .Artificial light intensity of Azolla wet culture under 70009000 Lx, people respiration and Azolla photosynthesis complemented each other, the atmospheric O2-CO2 concentration inside chamber maintained equilibration. Elevated atmospheric CO2 concentrations in close chamber have obvious effects on enhancing Azolla net photosynthesis efficiency. This shows that Azolla has strong photosynthetic O2-releasing ability, which equilibrates the O2-CO2 concentration inside chamber in favor of human survival, and then verifies the prospect of Azolla in space application.
van der Burgh, J.; Collinson, M.E.; van Konijnenburg-van Cittert, J.H.A.; Barke, J.; Brinkhuis, H.
2013-01-01
Three new species of the freshwater fern Azolla are described from Eocene marine deposits of the Arctic and Nordic seas, bringing the total number of species now documented from these areas to five. Azolla arctica Collinson et al., Azolla jutlandica Collinson et al., Azolla nova sp. nov. and Azolla
International Nuclear Information System (INIS)
Watanabe, Iwao.
1991-01-01
The primary aim of the expert mission was to provide advice on the use of nuclear techniques to study rice-azolla-fish culture. Results of the work performed so far show that basal application of azolla gives similar or better yields of rice than basal application of urea. Fish productivity was also found to be significantly higher when azolla is present. 2 tabs
Pengaruh Biomassa Azolla Terhadap Status Logam Berat Timbal (Pb) Pada Tanah
Abror, Muhammad; Sabrina, Teuku; Hidayat, Benny
2013-01-01
Research on title the effect of Pb-Polluted azolla biomass on polluted on lead heavy metal status at polluted and unpolluted soil with Pb aimed to evaluate the potency of Pb-polluted azolla biomass on the availability of Pb in soil. The experiment design was factorial randomized block design with 2 factors and 3 replications. First factor was Pb-polluted azolla biomass with 3 treatments 0 g/kg, 15 g/kg and 30g/kg, second factor was Pb application with 3 treatments 0 ppm/kg, 150 ppm/kg, and 3...
van Kempen, Monique M L; Smolders, Alfons J P; Lamers, Leon P M; Roelofs, Jan G M
2012-01-01
In order to understand the physicochemical mechanisms that could explain the massive growth of Azolla arctica in the Eocene Arctic Ocean, we carried out a laboratory experiment in which we studied the interacting effects of rain and wind on the development of salinity stratification, both in the presence and in the absence of a dense Azolla cover. Additionally, we carried out a mesocosm experiment to get a better understanding of the nutrient cycling within and beneath a dense Azolla cover in both freshwater and brackish water environments. Here we show that Azolla is able to create a windproof, small-scale salinity gradient in brackish waters, which allows for efficient recycling of nutrients. We suggest that this mechanism ensures the maintenance of a large standing biomass in which additional input of nutrients ultimately result in a further expansion of an Azolla cover. As such, it may not only explain the extent of the Azolla event during the Eocene, but also the absence of intact vegetative Azolla remains and the relatively low burial efficiency of organic carbon during this interval.
Directory of Open Access Journals (Sweden)
Monique M L van Kempen
Full Text Available In order to understand the physicochemical mechanisms that could explain the massive growth of Azolla arctica in the Eocene Arctic Ocean, we carried out a laboratory experiment in which we studied the interacting effects of rain and wind on the development of salinity stratification, both in the presence and in the absence of a dense Azolla cover. Additionally, we carried out a mesocosm experiment to get a better understanding of the nutrient cycling within and beneath a dense Azolla cover in both freshwater and brackish water environments. Here we show that Azolla is able to create a windproof, small-scale salinity gradient in brackish waters, which allows for efficient recycling of nutrients. We suggest that this mechanism ensures the maintenance of a large standing biomass in which additional input of nutrients ultimately result in a further expansion of an Azolla cover. As such, it may not only explain the extent of the Azolla event during the Eocene, but also the absence of intact vegetative Azolla remains and the relatively low burial efficiency of organic carbon during this interval.
Microcosm investigation on phytoremediation of Cr using Azolla pinnata.
Rai, Prabhat Kumar
2010-01-01
The extent of Chromium (Cr) pollution in Singrauli industrial region, India was assessed and phytoremediation capacity of a small water fern, Azolla pinnata R.BR (Azollaceae) was observed to purify waters polluted by Cr under microcosm condition. Azolla pinnata endemic to India is a potential hyper-accumulator of heavy metals. During 13 days of the experiment the fern was grown in the aqueous medium containing Cr3+ and CrO4(2-) ions, each in a concentration 0.5, 1.0, and 3.0 mg L(-1). The presence of these ions caused a + 3.1 to -37.5% inhibition of Azolla pinnata growth in comparison to the control. After 13 days of the experiment, metal contents in the solution was decreased up to 70% (CrO4(2-) 3.0 mg L(-1) treatment) to 88% (CrO4(2-) 0.5 mg L(-1) treatment). In the Azolla pinnata tissues, the concentration of couple of the ionic forms of Cr under investigation ranged from 415 to 1095 mg kg(-1) dry mass (dm); the highest level being found for Cr (III) containing solution.
Huda, M. Syahrial; Widaryanto, Eko; Nugroho, Agung
2016-01-01
Wortel termasuk jenis sayuran umbi yang bernilai ekonomis penting di dunia. Salah satu factor budidaya wortel adalah tanah yang tidak hanya sebagai media akar tanaman namun sebagai media tanaman dapat menyerap nutrisi, air dan oksigen. Salah satu peranan bahan organik adalah memperbaiki sifat fisik tanah. Azolla (Azolla pinnata) ialah tumbuhan paku air yang dapat dimanfaatkan sebagai bahan organik untuk memperbaiki agregat tanah. Tujuan penelitian ini untuk dapat mengetahui pengaruh dosis kom...
The optimum energy harvest efficiency of nitrogen fixing hydrophyte: Azolla pinnata
Energy Technology Data Exchange (ETDEWEB)
Tennakone, K. (Institute of Fundamental Studies, Kandy (LK) Ruhuna Univ., Matara (LK). Dept. of Physics); Punchihewa, S.; Jayasuriya, A.C. (Institute of Fundamental Studies, Kandy (LK))
1989-01-01
Azolla is a nitrogen fixing hydrophyte that can be cultivated in absence of nitrogenous fertilizer. It is found that when biomass is continuously harvested from a culture of Azolla, solar energy can be converted at an optimum efficiency of 1.1%. (author).
Effects of atmospheric SO[sub 2] on Azolla and Anabaena symbiosis
Energy Technology Data Exchange (ETDEWEB)
Hur, J.-S.; Wellburn, A.R. (Division of Biological Sciences, Institute of Environmental and Biological Sciences, Lancaster Univ., Lancaster (United Kingdom))
1993-01-01
The water fern Azolla pinnata R. Br. was fumigated for 1 week with either 25, 50 or 100 nl l[sup -1] SO[sub 2]. The symbiosis of Azolla with Anabaena azollae (spp.) was severely damaged by atmospheric SO[sub 2] even at the lowest concentration studied showing significant reductions in growth, reduction of C[sub 2]H[sub 2], NH[sub 3] assimilation, protein synthesis, and heterocyst development. These disturbances appear to be mainly responsible for the extreme sensitivity of this fern to atmospheric SO[sub 2]. Changes in violaxanthin/antheraxanthin and epoxylutein/lutein ratios also indicate that free radical products are induced by atmospheric SO[sub 2]. These results suggest that the Azolla-Anabeana symbiotic system is a very responsive and reliable lower plant model to study the detailed effects of total sulfur deposition upon the balances between various important plant metabolic processes.
Mishra, A K; Singh, Satya S
2006-09-01
Protection from salt stress was observed in the terms of yield (fresh and dry weight, chlorophyll and protein) and nitrogenase activity. Azollapinnata appeared highly sensitive to 40 mM external NaCl stress. Fronds of Azolla unable to grow beyond a concentration of 30 mM NaCl and accordingly death was recorded at 40 mM NaCl on the 6th day of incubation. Yield was inhibited by various levels of NaCl (0, 10, 20 and 30 mM). Addition of combined-N to the growth medium protected the association partially from salt toxicity. Among the N-sources (NO3-, NH4+ and urea) tried, urea mitigated the salt-induced toxicity most efficiently. Reduction in nitrogenase activity was observed when intact Azolla was grown in nutrient medium either supplemented with different levels of NaCl or combined nitrogen. Only NO3- (5 mM) protected the enzymatic activity from salt toxicity while other concentrations of ammonium, nitrate and urea slowed down the salt-induced inhibition of enzyme activity in Azolla-Anabaena association. These results suggested that an optimum protection from salt stress could be obtained by using a combination of combined nitrogen sources. The reason for this protection might be due to the availability of combined nitrogen to the association, nitrogen is only available through the biological nitrogen fixation which is the most sensitive to salt stress.
Jasmonic and salicylic acid response in the fern Azolla filiculoides and its cyanobiont.
de Vries, Sophie; de Vries, Jan; Teschke, Hendrik; von Dahlen, Janina K; Rose, Laura E; Gould, Sven B
2018-01-03
Plants sense and respond to microbes utilizing a multilayered signalling cascade. In seed plants, the phytohormones jasmonic and salicylic acid (JA and SA) are key denominators of how plants respond to certain microbes. Their interplay is especially well-known for tipping the scales in plants' strategies of dealing with phytopathogens. In non-angiosperm lineages, the interplay is less well understood, but current data indicate that it is intertwined to a lesser extent and the canonical JA/SA antagonism appears to be absent. Here, we used the water fern Azolla filiculoides to gain insights into the fern's JA/SA signalling and the molecular communication with its unique nitrogen fixing cyanobiont Nostoc azollae, which the fern inherits both during sexual and vegetative reproduction. By mining large-scale sequencing data, we demonstrate that Azolla has most of the genetic repertoire to produce and sense JA and SA. Using qRT-PCR on the identified biosynthesis and signalling marker genes, we show that Azolla is responsive to exogenously applied SA. Furthermore, exogenous SA application influenced the abundance and gene expression of Azolla's cyanobiont. Our data provide a framework for JA/SA signalling in ferns and suggest that SA might be involved in Azolla's communication with its vertically inherited cyanobiont. © 2018 John Wiley & Sons Ltd.
Brouwer, Paul; Bräutigam, Andrea; Buijs, Valerie A.; Tazelaar, Anne O.E.; van der Werf, Adrie; Schlüter, Urte; Reichart, Gert-Jan; Bolger, Anthony; Usadel, Björn; Weber, Andreas P.M.; Schluepmann, Henriette
2017-01-01
Sustainable agriculture demands reduced input of man-made nitrogen (N) fertilizer, yet N2 fixation limits the productivity of crops with heterotrophic diazotrophic bacterial symbionts. We investigated floating ferns from the genus Azolla that host phototrophic diazotrophic Nostoc azollae in leaf
Liu, Jingna; Xu, Heshui; Jiang, Ying; Zhang, Kai; Hu, Yuegao; Zeng, Zhaohai
2017-01-01
Azolla caroliniana Willd. is widely used as a green manure accompanying rice, but its ecological importance remains unclear, except for its ability to fix nitrogen in association with cyanobacteria. To investigate the impacts of Azolla cultivation on methane emissions and environmental variables in paddy fields, we performed this study on the plain of Dongting Lake, China, in 2014. The results showed that the dual cropping of Azolla significantly suppressed the methane emissions from paddies, likely due to the increase in redox potential in the root region and dissolved oxygen concentration at the soil-water interface. Furthermore, the floodwater pH decreased in association with Azolla cultivation, which is also a factor significantly correlated with the decrease in methane emissions. An increase in methanotrophic bacteria population (pmoA gene copies) and a reduction in methanogenic archaea (16S rRNA gene copies) were observed in association with Azolla growth. During rice cultivation period, dual cropping of Azolla also intensified increasing trend of 1/Simpson of methanogens and significantly decreased species richness (Chao 1) and species diversity (1/Simpson, 1/D) of methanotrophs. These results clearly demonstrate the suppression of CH4 emissions by culturing Azolla and show the environmental and microbial responses in paddy soil under Azolla cultivation.
The pore of the leaf cavity of Azolla species: teat cell differentiation and cell wall projections.
Veys, P; Lejeune, A; Van Hove, C
2002-02-01
The differentiation of the specialized secretory teat cells of the leaf cavity pore of Azolla species was investigated at the ultrastructural level with emphasis on their peculiar cell wall projections. The results indicated that the projections are formed as soon as the teat cells complete their differentiation and that their production is principally associated with changes in endoplasmic reticulum profiles. The number of projections increases with the teat cell age and is stimulated under salt and P deficiency stresses. Salt stress also promotes their emergence on Azolla species that under normal conditions do not produce projections. Cytochemical tests on different Azolla species showed that the projection composition is almost identical: proteins, acidic polysaccharides, and pectin are always detected. This study revealed that Azolla teat cell projections differ fundamentally from other types of hitherto described cell wall projections that are considered as remnant structures from cell separation. In contrast, in Azolla teat cells projections are actively produced and compounds are excreted by an exocytotic mechanism. The possible role of the projections in the symbiosis of Azolla spp. with Anabaena azollae is discussed.
Localization and Toxic Effects of Cadmium, Copper, and Uranium in Azolla1
Sela, Mordechai; Tel-Or, Elisha; Fritz, Eberhardt; Huttermann, Aloys
1988-01-01
The storage and distribution of copper, cadmium, and uranium and their effects on ionic contents in roots and shoots of Azolla filiculoides has been studied by x-ray microanalysis. The relative content of copper was eightfold higher in the root than in the shoot, suggesting low mobility of this metal in Azolla plant. Cadmium relative content in the shoot was similar to its content in the root, hence its mobility was relatively high. The absence of significant uranium quantities in the shoot and its relative high content in the root suggest the immobility of this metal from Azolla root. Cadmium formed precipitates with phosphate and calcium in xylem cells of the shoot bundle and caused a two- to threefold increase in the content of phosphate in the root. Uranium in roots and cadmium in shoots were associated with calcium. All three treatments caused losses of potassium, chloride, and magnesium from Azolla roots. Accumulation of heavy metals in Azolla and their mobility from the root to the shoot can be correlated with damage caused by the loss of essential nutrients. Images Fig. 1 Fig. 2 Fig. 5 Fig. 7 PMID:16666274
Biosorption of uranium by Azolla, SP, Brazil
International Nuclear Information System (INIS)
Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T.; Ferreira, Rafael V. de P.; Canevesi, Rafael L.S.; Silva, Edson A.
2015-01-01
Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)
Biosorption of uranium by Azolla, SP, Brazil
Energy Technology Data Exchange (ETDEWEB)
Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T., E-mail: lcvieira@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Ferreira, Rafael V. de P., E-mail: rafael@itatijuca.com [Itatijuca Biotech, Sao Paulo, SP (Brazil); Canevesi, Rafael L.S.; Silva, Edson A., E-mail: edson.silva2@unioeste.br [Universidade Estadual do Oeste Parana (UNIOESTE), Toledo, PR (Brazil)
2015-07-01
Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)
Phytodegradation potential of bisphenolA from aqueous solution by Azolla Filiculoides.
Zazouli, Mohammad Ali; Mahdavi, Yousef; Bazrafshan, Edris; Balarak, Davoud
2014-01-01
Many organic hazardous pollutants such as bisphenolA (BPA) which are toxic and not easily biodegradable can concerns for environmental pollution worldwide. The objective of this study was to examine whether Azolla Filiculoides is able to remove BPA from aqueous solutions. In this study, the Azolla with different biomass (0.3, 0.6, 0.9, 1.2 g) has been cultured in solution that was contained 5, 10, 25 and 50 ppm BPA. Samples were collected every 2 days from all of containers. The analytical determination of BPA was performed by using of DR4000 uv-visible at λmax = 276 nm. The results indicated that Azolla has high ability to remove BPA from aqueous solutions. The BPA removal was 60-90%. The removal efficiency is increasing with decreasing of BPA concentration and increasing of biomass amount and vice versa. The removal efficiency was more than 90% when BPA concentration was 5 ppm and amount of biomass was 0.9gr. It is concluded that Azolla able remove BPA by Phytodegradation from the aqueous solutions. Since conventional methods of BPA removal need to high cost and energy, phytoremediation by Azolla as a natural treatment system can decrease those issues and it can be a useful and beneficial method to removal of BPA.
The cyanobiont in an Azolla fern is neither Anabaena nor Nostoc.
Baker, Judith A; Entsch, Barrie; McKay, David B
2003-12-05
The cyanobacterial symbionts in the fern Azolla have generally been ascribed to either the Anabaena or Nostoc genera. By using comparisons of the sequences of the phycocyanin intergenic spacer and a fragment of the 16S rRNA, we found that the cyanobiont from an Azolla belongs to neither of these genera.
Die beiden Azolla-arten des Niederländischen Pleistozäns
Florschütz, F.
1938-01-01
Die erste Mitteilung über die Möglichkeit des Vorkommens fossiler Azolla im niederländischen Boden rührt von J. LORIé her, der im Jahre 1905 bei der Beschreibung von Bohrproben die Entdeckung von Makrosporangien von Azolla filiculoides Lam. in einer dünnen Torfschicht unter Vogelenzang erwähnte
Energy Technology Data Exchange (ETDEWEB)
Prada A-Buylla, J.; Sanchez Crespo, R.; Verdigo Althofer, M. [Confederacion Hidrografica del Guadina. Ciudad Real (Spain)
1999-07-01
During the period 1993-95, the presence of Azolla ferns was observed in the air/water interface along several kilometres of the river Guadina in both Spain and Portugal. This fern is symbiotically associated with the cyano-bacteria Anabaena azollae that is capable of fixing atmospheric nitrogen, which can lead to vegetable growth and eutrophication. At the same time, the cyanobacteria may generate biotoxins, in which case a study is made of the hepatotoxins forming a family of 53 related cyclic peptides. Those consisting of seven aminoacids receive the name of microcystines, while formed by five aminoacids arc called nodulaincs. Chromatography was used to determine the presence of these peptides in the water from six sampling points. Microcystine-LR was found at concentrations of around 0.3 g/l at three points. (Author) 5 refs.
The potential of the aquatic water fern Azolla within a biobased economy
Nierop, Klaas G. J.; Jongerius, Anna L.; Bijl, Peter K.; Bruijnincx, Pieter C. A.; Klein Gebbink, Robertus J. M.; Reichart, Gert-Jan
2014-05-01
Azolla is a free-floating freshwater fern capable of fixing atmospheric carbon dioxide and nitrogen, the latter of which through its symbiosis with the cyanobacteria Anabaena azollae. It is currently ranked among the fastest growing plants on Earth and occurs in both tropical and temperate freshwater ecosystems. Therefore, it is non-directly competitive with food crops. In addition, Azolla does not require inorganic fertilizers, which makes it a potential and unique source of biomass for the sustainable production of fuels and chemicals that are currently derived from fossil (fuel) sources. The biochemical composition of Azolla allows the production of biofuel or biobased chemicals that are of interest to the chemical industry. Of Azolla, two extractable groups of compounds are of particular interest, i.e. the polyphenols (condensed tannins and ester-bound caffeic acid) and the lipids. The antioxidant property of polyphenols and their application to the treatment of cancer, diabetes and cardiovascular diseases has further contributed to the growth of the polyphenol market. In addition, they can be chemically transformed into aromatic platform and specialty chemicals. The composition of the lipid fraction of Azolla is characterized by highly specific compounds consisting of C26-C36 carbon chains all bearing a ω20-hydroxy group. Such compounds produce an oil fraction upon hydrous pyrolysis, or, alternatively, are well suited to be converted to e.g. various specialty chemicals that are hardly available from both natural sources. Indeed, upon chemical conversion these lipids may yield components for fuels, plastics, cosmetics, and lubricants. Another group of interesting compounds within the lipid group are the polyunsaturated fatty acids (PUFAs). The demand for PUFAs has witnessed a significant increase over the last three years, particularly due to their benefits as cholesterol lowering agents. Here we will present some of the thermal and chemical conversions of the
Use of multivitamin, acidifier and Azolla in the diet of broiler chickens.
Islam, M A; Nishibori, M
2017-05-01
The experiments were carried out to measure the effect of multivitamin, acidifier and Azolla on growth performance, profitability and lipid profiles of blood of broiler chickens to produce safe and cost effective broilers. In experiment 1, 240 day-old Cobb-500 broiler chicks were fed diets; D 1 (control), D 2 (D 1 with 1 mL multivitamin/liter water), D 3 (D 1 with 1 mL acidifier/liter water), D 4 (D 1 with 1 mL multivitamin and 2 mL acidifier/liter water) having 3 replications in each, and 20 chicks/replication. In experiment 2, 150 day-old Cobb-500 broiler chicks were fed diets; T 1 (control), T 2 (5% Azolla in the diet), T 3 (7% Azolla in the diet) and T 4 (T 1 with 1 mL multivitamin and 1 mL acidifier/liter water) having 3 replications in each, and 20 chicks/replication in control, and 10 chicks/replication in the remaining dietary treatment groups for 35 days. In experiment 1, the highest live weight was observed in D 4 (p0.05). The lowest feed conversion ratio (FCR) (p0.05). However, evidently but not significantly, the highest net profit was obtained in D 2 followed by D 4 , D 1 , and D 3 , respectively. In experiment 2, the highest live weight (p0.05). In conclusion, Azolla and acidifier reduced lipid profiles of broiler chickens. Considering net profit and lipid profiles, 5% Azolla may be the suitable dietary group for producing safe and profitable broilers. However, more studies are needed to confirm this study prior to suggesting using Azolla in the poultry industry.
The Eocene Arctic Azolla phenomenon: species composition, temporal range and geographic extent.
Collinson, Margaret; Barke, Judith; van der Burgh, Johan; van Konijnenburg-van Cittert, Johanna; Pearce, Martin; Bujak, Jonathan; Brinkhuis, Henk
2010-05-01
Azolla is a free-floating freshwater fern that is renowned for its rapid vegetative spread and invasive biology, being one of the world's fastest growing aquatic macrophytes. Two species of this plant have been shown to have bloomed and reproduced in enormous numbers in the latest Early to earliest Middle Eocene of the Arctic Ocean and North Sea based on samples from IODP cores from the Lomonosov Ridge (Arctic) and from outcrops in Denmark (Collinson et al 2009 a,b Review of Palaeobotany and Palynology 155,1-14; and doi:10.1016/j.revpalbo.2009.12.001). To determine the geographic and temporal extent of this Azolla phenomenon, and the spatial distribution of the different species, we have examined samples from 15 additional sites using material from ODP cores and commercial exploration wells. The sites range from the Sub-Arctic (Northern Alaska and Canadian Beaufort Mackenzie Basin) to the Nordic Seas (Norwegian-Greenland Sea and North Sea Basin). Our data show that the Azolla phenomenon involved at least three species. These are distinguished by characters of the megaspore apparatus (e.g. megaspore wall, floats, filosum) and the microspore massulae (e.g. glochidia fluke tips). The Lomonosov Ridge (Arctic) and Danish occurrences are monotypic but in other sites more than one species co-existed. The attachment to one another and the co-occurrence of megaspore apparatus and microspore massulae, combined with evidence that these spores were shed at the fully mature stage of their life cycle, shows that the Azolla remains were not transported over long distances, a fact which could not be assumed from isolated massula fragments alone. Our evidence, therefore, shows that Azolla plants grew on the ocean surfaces for approximately 1.2 million years (from 49.3 to 48.1 Ma) and that the Azolla phenomenon covered the area from Denmark northwards across the North Sea Basin and the whole of the Arctic and Nordic seas. Apparently, early Middle Eocene Northern Hemisphere middle
Genetic diversity among and within cultured cyanobionts of diverse species of Azolla.
Sood, A; Prasanna, R; Prasanna, B M; Singh, P K
2008-01-01
The cyanobionts isolated from 10 Azolla accessions belonging to 6 species (Azolla mexicana, A. microphylla, A. rubra, A. caroliniana, A. filiculoides, A. pinnata) were cultured under laboratory conditions and analyzed on the basis of whole cell protein profiles and molecular marker dataset generated using repeat sequence primers (STRR(mod) and HipTG). The biochemical and molecular marker profiles of the cyanobionts were compared with those of the free-living cyanobacteria and symbiotic Nostoc strains from Anthoceros sp., Cycas sp. and Gunnera monoika. Cluster analysis revealed the genetic diversity among the selected strains, and identified 3 distinct clusters. Group 1 included cyanobionts from all the 10 accessions of Azolla, group 2 comprised all the symbiotic Nostoc strains, while group 3 included the free-living cyanobacteria belonging to the genera Nostoc and Anabaena. The interrelationships among the Azolla cyanobionts were further revealed by principal component analysis. Cyanobionts from A. caroliniana-A. microphylla grouped together while cyanobionts associated with A. mexicana-A. filiculoides along with A. pinnata formed another group. A. rubra cyanobionts had intermediate relationship with both the subgroups. This is the first study analyzing the diversity existing among the cultured cyanobionts of diverse Azolla species through the use of biochemical and molecular profiles and also the genetic distinctness of these free-living cyanobionts as compared to cyanobacterial strains of the genera Anabaena and Nostoc.
Lipid Yield and Composition of Azolla filiculoides and the Implications for Biodiesel Production
Brouwer, Paul; Werf, van der Adrie; Schluepmann, Henriette; Reichart, Gert Jan; Nierop, Klaas G.J.
2016-01-01
The aquatic fern Azolla is one of the fastest-growing nitrogen-fixing plants on Earth and therefore considered as a potential source of biomass for bioenergy production. The lipid fraction from Azolla filiculoides was analyzed to investigate whether it suited biodiesel production. Since the
Lipid yield and composition of Azolla filiculoides and the implications for biodiesel production
Brouwer, Paul; van der Werf, Adrie; Schluepmann, Henriette; Reichart, Gert Jan; Nierop, Klaas G J
The aquatic fern Azolla is one of the fastest-growing nitrogen-fixing plants on Earth and therefore considered as a potential source of biomass for bioenergy production. The lipid fraction from Azolla filiculoides was analyzed to investigate whether it suited biodiesel production. Since the
Use of multivitamin, acidifier and Azolla in the diet of broiler chickens
Directory of Open Access Journals (Sweden)
M. A. Islam
2017-05-01
Full Text Available Objective The experiments were carried out to measure the effect of multivitamin, acidifier and Azolla on growth performance, profitability and lipid profiles of blood of broiler chickens to produce safe and cost effective broilers. Methods In experiment 1, 240 day-old Cobb-500 broiler chicks were fed diets; D1 (control, D2 (D1 with 1 mL multivitamin/liter water, D3 (D1 with 1 mL acidifier/liter water, D4 (D1 with 1 mL multivitamin and 2 mL acidifier/liter water having 3 replications in each, and 20 chicks/replication. In experiment 2, 150 day-old Cobb-500 broiler chicks were fed diets; T1 (control, T2 (5% Azolla in the diet, T3 (7% Azolla in the diet and T4 (T1 with 1 mL multivitamin and 1 mL acidifier/liter water having 3 replications in each, and 20 chicks/replication in control, and 10 chicks/replication in the remaining dietary treatment groups for 35 days. Results In experiment 1, the highest live weight was observed in D4 (p0.05. The lowest feed conversion ratio (FCR (p0.05. However, evidently but not significantly, the highest net profit was obtained in D2 followed by D4, D1, and D3, respectively. In experiment 2, the highest live weight (p0.05. Conclusion In conclusion, Azolla and acidifier reduced lipid profiles of broiler chickens. Considering net profit and lipid profiles, 5% Azolla may be the suitable dietary group for producing safe and profitable broilers. However, more studies are needed to confirm this study prior to suggesting using Azolla in the poultry industry.
Breakdown of middle lamella pectin by (●) OH during rapid abscission in Azolla.
Yamada, Yoshiya; Koibuchi, Mizuki; Miyamoto, Kensuke; Ueda, Junichi; Uheda, Eiji
2015-08-01
Azolla, a small water fern, abscises its roots and branches within 30 min upon treatment with various stresses. This study was conducted to test whether, in the rapid abscission that occurs in Azolla, breakdown of wall components of abscission zone cells by (●) OH is involved. Experimentally generated (●) OH caused the rapid separation of abscission zone cells from detached roots and the rapid shedding of roots from whole plants. Electron microscopic observations revealed that (●) OH rapidly and selectively dissolved a well-developed middle lamella between abscission zone cells and resultantly caused rapid cell separation and shedding. Treatment of abscission zones of Impatiens leaf petiole with (●) OH also accelerated the separation of abscission zone cells. However, compared with that of Azolla roots, accelerative effects in Impatiens were weak. A large amount of (●) OH was cytochemically detected in abscission zone cells both of Azolla roots and of Impatiens leaf petioles. These results suggest that (●) OH is involved in the cell separation process not only in the rapid abscission in Azolla but also in the abscission of Impatiens. However, for rapid abscission to occur, a well-developed middle lamella, a unique structure, which is sensitive to the attack of (●) OH, might be needed. © 2015 John Wiley & Sons Ltd.
Application of Azolla for 2, 4, 6-Trichlorophenol (TCP Removal from Aqueous Solutions
Directory of Open Access Journals (Sweden)
Mohammad Ali Zazouli
2013-11-01
Full Text Available Background & Aims of the Study: The 2, 4, 6-Trichlorophenol (TCP is a phenolic compound which it can produce adverse effects on human and environment. Therefore, the removal of these compounds is necessary. The aim of this study is the investigation of TCP removal by using Azolla filiculoides biomass. Materials & Methods: The Azolla biomass was dried in the sunlight, and then it was crushed and sieved to particle sizes in range of 1-2 mm. Next treated with 0.1M HCl for a period of 5h. The Azolla was washed with distilled water and it was used as adsorbent. The effect of operating parameters such as pH, contact time, TCP concentration and adsorbent dose on the TCP removal efficiency was investigated. The residues concentration of TCP was measured by spectrophotometer in λ max of 296 nm. Results: In optimum condition (pH 3, contact time 120 min , adsorbent dose 10 gr/l and TCP concentration 10 ppm, Azolla was able to remove 95% of TCP from aqueous solutions. The equilibrium data follows the Langmuir isotherm and the proper kinetic model is pseudo-second model. Conclusions: Adsorption process by Azolla filiculoides is an efficient method for removal of 2, 4, 6-Trichlorophenol from aqueous solutions.
Zhang, Xin; Lin, Ai-Jun; Zhao, Fang-Jie; Xu, Guo-Zhong; Duan, Gui-Lan; Zhu, Yong-Guan
2008-12-01
This study investigates As accumulation and tolerance of the aquatic fern Azolla. Fifty strains of Azolla showed a large variation in As accumulation. The highest- and lowest-accumulating ferns among the 50 strains were chosen for further investigations. Azolla caroliniana accumulated two times more As than Azolla filiculoides owing to a higher influx velocity for arsenate. A. filiculoides was more resistant to external arsenate due to a lower uptake. Both strains showed a similar degree of tolerance to internal As. Arsenate and arsenite were the dominant As species in both Azolla strains, with methylated As species accounting for Azolla in paddy fields to reduce As transfer from soil and water to rice should be further evaluated.
Improving soil fertility through Azolla application in low land rice: A review
Directory of Open Access Journals (Sweden)
Purushottam Subedi
2015-04-01
Full Text Available The continuous usages of chemical fertilizers have harmful effects on soil organic matter reserves, soil health and environmental safety. The use of Bio-fertilizers like Azolla not only increases the rice productivity but also improves the long term soil fertility. Azolla is a fast growing aquatic pteridophyte which fixes atmospheric Nitrogen by forming a symbiotic association with the Blue-Green Algae, Anabaena azollae. Azolla is an efficient Nitrogen fixer. It is grown in lowland rice fields because flooded habitat is suitable for it. Under favorable field condition, it fixes atmospheric nitrogen at a rate exceeding that of the Legume-Rhizobium symbiotic relationship. It increases the rice yield equivalent to that produced by 30-60 kg N/ha. As green manure in water logged soil, it enhances the rapid mineralization of nitrogen. It reduces the NH3 volatilization losses through its influence on floodwater pH that leads to the conservation of urea-N in the system to improve the efficiency of N fertilizers. It significantly improves the physical and chemical properties of the soil including improvement in soil microbial activities. It helps in addition of Organic Matter and release of cations such as Magnesium, Calcium and Sodium. The total N, available P and exchangeable K in the soil and N-uptake by rice can be improved. Therefore, Azolla application is considered as a good practice for sustaining soil fertility and crop productivity irrespective of some limitations.
Rakhshaee, Roohan
2015-11-01
Fe0 nano particles (FNPs) were connected to the cell wall of the dead and living Azolla filicoloides as an aquatic fern, individually. FNPs mean size was decreased due to the stabilization, especially using the living one. It was compared the results of X-ray photoelectron spectroscopy (XPS), saturation magnetization (Ms), zeta potential (ZP) and thermal analysis (DSC and TGA) of the dead and living Azolla connected to FNPs, and also the findings of potentiometric titration (PT) of the cell wall's pectin of the dead and living Azolla. It was confirmed (by XRD and XPS) that Fe0 nano particles when were connected to the living Azolla did not produce Fe3O4 due to oxidation unlike the bare FNPs and the connected form to the dead Azolla, by reason of the more stabilization (more surface protection) of nano iron particles after connecting to the living Azolla. To adsorb methylene blue by these agents at the optimum pre-treatment pH 10 and adsorption pH 8, the parameters of equilibrium sorption, rate constant of second-order sorption and activation energy were obtained as: living Azolla-FNPs > dead Azolla-FNPs > FNPs > dead Azolla, while, their thermodynamic parameters (ΔG°, ΔH° and ΔS°) had the reverse arrangement. It was also studied the various factors rule such as photoperiod and the presence of heavy metals on the living Azolla growth coupled with FNPs and its MB removal ability.
Heavy metal pollutant tolerance of Azolla pinnata
Energy Technology Data Exchange (ETDEWEB)
Sarkar, A.; Jana, S.
1986-01-01
The effects of Hg, As, Pb, Cu, Cd, and Cr (1,2 and 5 mg L/sup -1/ each) on Azolla pinnata R. Br. were analyzed. The treatments (2 and 5 mg L/sup -1/) of the heavy metal pollutants decreased Hill activity, chlorophyll, protein and dry wt, and increased tissue permeability over control values. The effects were most pronounced with the treatment of 5 mg L/sup -1/. The harmful effects of the metals were, in general, found by the treatments in the order: Cd > Hg > Cu > As > Pb > Cr. There was no significant change in these parameters at 1 mg L/sup -1/ of the metals over control. Thus Azolla pinnata shows tolerance to the heavy metals tested up to 1 mg L/sup -1/ each.
Aquatic Fern (Azolla Sp.) Assisted Synthesis of Gold Nanoparticles
Jha, Anal K.; Prasad, K.
2016-02-01
Aquatic pteridophyte (Azolla sp.) was taken to assess its potential to synthesize the metal (Au) nanoparticles. The synthesized particles were characterized using X-ray, UV-visible, scanning and transmission electron microscopy analyses. Nanoparticles almost spherical in shape having the sizes of 5-17nm are found. UV-visible study revealed the surface plasmon resonance at 538nm. Responsible phytochemicals for the transformation were principally phenolics, tannins, anthraquinone glycosides and sugars present abundantly in the plant thereby bestowing it adaptive prodigality. Also, the use of Azolla sp. for the synthesis of gold nanoparticles offers the benefit of eco-friendliness.
Brouwer, Paul; Bräutigam, Andrea; Buijs, Valerie A; Tazelaar, Anne O E; van der Werf, Adrie; Schlüter, Urte; Reichart, Gert-Jan; Bolger, Anthony; Usadel, Björn; Weber, Andreas P M; Schluepmann, Henriette
2017-01-01
Sustainable agriculture demands reduced input of man-made nitrogen (N) fertilizer, yet N 2 fixation limits the productivity of crops with heterotrophic diazotrophic bacterial symbionts. We investigated floating ferns from the genus Azolla that host phototrophic diazotrophic Nostoc azollae in leaf pockets and belong to the fastest growing plants. Experimental production reported here demonstrated N-fertilizer independent production of nitrogen-rich biomass with an annual yield potential per ha of 1200 kg -1 N fixed and 35 t dry biomass. 15 N 2 fixation peaked at noon, reaching 0.4 mg N g -1 dry weight h -1 . Azolla ferns therefore merit consideration as protein crops in spite of the fact that little is known about the fern's physiology to enable domestication. To gain an understanding of their nitrogen physiology, analyses of fern diel transcript profiles under differing nitrogen fertilizer regimes were combined with microscopic observations. Results established that the ferns adapted to the phototrophic N 2 -fixing symbionts N. azollae by (1) adjusting metabolically to nightly absence of N supply using responses ancestral to ferns and seed plants; (2) developing a specialized xylem-rich vasculature surrounding the leaf-pocket organ; (3) responding to N-supply by controlling transcripts of genes mediating nutrient transport, allocation and vasculature development. Unlike other non-seed plants, the Azolla fern clock is shown to contain both the morning and evening loops; the evening loop is known to control rhythmic gene expression in the vasculature of seed plants and therefore may have evolved along with the vasculature in the ancestor of ferns and seed plants.
Dry weight and N-uptake by rice plants fertilized with azolla and N-15 enriched urea
International Nuclear Information System (INIS)
Abdel-Monem, M.; Gadalla, A.M.; Abbady, Kh.
1994-01-01
Integrated soil fertility management is essential if soil productivity is to be sustained or improved. In view the recently high cost of N-fertilizers, interest was generated in using Azolla in rice fields. A greenhouse experiment was conducted to study the fate of N-15 labelled urea to rice with or without Azolla application, also to examine the effect of the soil moisture regime at the time of urea application on nitrogen recovery. The results indicated that addition of urea to dry soil gave more than 20% of the rice dry matter as compared to the urea application to wet soil which was also reflected on the N-uptake by the rice. Also N-15 recovery by plant was increased from 22% to 41% when urea was applied to wet and dry soil respectively. At the same time N-losses dropped from 62% to 29%. Addition of Azolla to rice provided rice with 63% of the nitrogen provided by urea, this may be attributed not only to N-fixation by Azolla, but also to its role in reducing the N-losses. Application of Azolla reduced the losses of applied nitrogen from 45.5% to 22.5%. Thus, integration between Azolla and urea is valuable in N-fixation as well as inhibiting nitrogen losses. 2 tabs
TRATAMIENTO DE EFLUENTES PISCÍCOLAS (TILAPIA ROJA EN LAGUNAS CON Azolla pinnata
Directory of Open Access Journals (Sweden)
GUILLERMO CHAUX F
2013-12-01
Full Text Available Los sistemas con plantas acuáticas flotantes son una alternativa económicamente sostenible para el tratamiento de efluentes piscícolas. Se evaluó a escala piloto el desempeñ,o de un sistema de lagunas con Azolla pinnata en serie para el tratamiento de efluentes de cría de tilapia roja durante el proceso de levante y engorde. El sistema construido en la piscícola La Yunga (Popayán, Colombia consistió en dos líneas de cinco lagunas en serie; la primera con A. pinnata y la segunda sin la planta acuática; cada laguna se operó con un tiempo de detención de un día. La evaluación se realizó en época seca. La producción de Azolla fresca osciló entre 42 y 87 g/m2.d y el contenido de proteína entre 18,5% y 20,4%. Las eficiencias de remoción obtenidas en las líneas (con Azolla, sin Azolla fueron respectivamente: 56% y 46% DBO5; 49% y 26% DQO; 56% y 33% SST; 28% y 36% N-NTK; -108% y 23% N-NH4+; 64% y 34% fósforo total, mostrando superioridad del sistema con Azolla. Con solo tres lagunas en serie plantadas con A. pinnata se alcanzan las eficiencias máximas obtenidas en la remoción de DBO5, DQO, SST y fósforo total.
Miranda, Ana F; Liu, Zhiqian; Rochfort, Simone; Mouradov, Aidyn
2018-03-01
The aquatic plant Azolla became increasingly popular as bioenergy feedstock because of its high growth rate, production of biomass with high levels of biofuel-producing molecules and ability to grow on marginal lands. In this study, we analysed the contribution of all organs of Azolla to the total yield of lipids at vegetative and reproductive stages and in response to stress. Triacylglycerol-containing lipid droplets were detected in all (vegetative and reproductive) organs with the highest level in the male microsporocarps and microspores. As a result, significantly higher total yields of lipids were detected in Azolla filiculoides and Azolla pinnata at the reproductive stage. Starving changed the yield and composition of the fatty acid as a result of re-direction of carbon flow from fatty acid to anthocyanin pathways. The composition of lipids, in regard the length and degree of unsaturation of fatty acids, in Azolla meets most of the important requirements for biodiesel standards. The ability of Azolla to grow on wastewaters, along with their high productivity rate, makes it an attractive feedstock for the production of biofuels. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Immunocytochemical localization of nitrogenase in bacteria symbiotically associated with Azolla spp.
Lindblad, P; Bergman, B; Nierzwicki-Bauer, S A
1991-01-01
In situ immunogold labeling and transmission electron microscopy were used to detect nitrogenase in bacteria (bactobionts) symbiotically associated with leaf cavities of Azolla caroliniana and Azolla filiculoides. In A. caroliniana, the Fe protein of the nitrogenase complex was detected in a subset of the distinct bactobiont types present in leaf cavities of all ages. Similar results were obtained for the bactobionts of A. filiculoides with antisera against both the Fe and MoFe subunits of nitrogenase. Images PMID:1785936
N-Urea Efficiency In Lowland Rice Applied With Azolla
International Nuclear Information System (INIS)
Rasjid, Havid; Sisworo, E.L.; Wemay, Y.; Sisworo, W.H.
2000-01-01
Two N-fertilizer experiments have been conducted using urea tablet and prill urea combined with Azolla application. Twelve treatments have been tested using 2 rice varieties namely Atomita-4 and IR-64. To enable the determination of N-urea efficiency 15 N labelled urea was used. The experiments were conducted in the dry and wet season (DS and WS) 1994/1995 at the experimental station, pusaka negara, Subang West Java. Data obtained from the two experiments showed that the highest N-urea efficiency was found in Atomita-4 applied with urea-tablet (DS=46,1%, WS= 35,8%). Letting the Azolla grow during one lowland rice growth period could increase the N-urea prill efficiency (±5%) compared when no azolla was applied. Apparently Atomita-4 could use N-urea more efficiently compared to IR-64, showing higher grain yield (atomita-4 DS=6.2 ton ha -1 WS=5.9 ton ha -1 ) vs IR-64 (DS=5.8 ton ha -1 , WS=5.3 ton ha -1 ). Decreasing the levels of TSP not influence to the urea efficiency at the DS and WS
Energy Technology Data Exchange (ETDEWEB)
Zhang Xin [State Key Lab of Urban and ONAL Ecology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Lin Aijun [Department of Environmental Science and Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Zhao Fangjie [Soil Science Department, Rothamsted Research, Hertfordshire AL5 2JQ (United Kingdom); Xu Guozhong [Agricultural Ecology Institute, Fujian Academy of Agricultural Sciences, Fuzhou 350013 (China); Duan Guilan [State Key Lab of Urban and ONAL Ecology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Zhu Yongguan [State Key Lab of Urban and ONAL Ecology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361003 (China)], E-mail: ygzhu@rcees.ac.cn
2008-12-15
This study investigates As accumulation and tolerance of the aquatic fern Azolla. Fifty strains of Azolla showed a large variation in As accumulation. The highest- and lowest-accumulating ferns among the 50 strains were chosen for further investigations. Azolla caroliniana accumulated two times more As than Azolla filiculoides owing to a higher influx velocity for arsenate. A. filiculoides was more resistant to external arsenate due to a lower uptake. Both strains showed a similar degree of tolerance to internal As. Arsenate and arsenite were the dominant As species in both Azolla strains, with methlyated As species accounting for <5% of the total As. A. filiculoides had a higher proportion of arsenite than A. caroliniana. Both strains effluxed more arsenate than arsenite, and the amount of As efflux was proportional to the amount of As accumulation. The potential of growing Azolla in paddy fields to reduce As transfer from soil and water to rice should be further evaluated. - Arsenic accumulation and efflux differ between strains of the aquatic fern Azolla.
International Nuclear Information System (INIS)
Zhang Xin; Lin Aijun; Zhao Fangjie; Xu Guozhong; Duan Guilan; Zhu Yongguan
2008-01-01
This study investigates As accumulation and tolerance of the aquatic fern Azolla. Fifty strains of Azolla showed a large variation in As accumulation. The highest- and lowest-accumulating ferns among the 50 strains were chosen for further investigations. Azolla caroliniana accumulated two times more As than Azolla filiculoides owing to a higher influx velocity for arsenate. A. filiculoides was more resistant to external arsenate due to a lower uptake. Both strains showed a similar degree of tolerance to internal As. Arsenate and arsenite were the dominant As species in both Azolla strains, with methlyated As species accounting for <5% of the total As. A. filiculoides had a higher proportion of arsenite than A. caroliniana. Both strains effluxed more arsenate than arsenite, and the amount of As efflux was proportional to the amount of As accumulation. The potential of growing Azolla in paddy fields to reduce As transfer from soil and water to rice should be further evaluated. - Arsenic accumulation and efflux differ between strains of the aquatic fern Azolla
Directory of Open Access Journals (Sweden)
Weiguo Cheng
2015-01-01
Full Text Available Organic farming uses alternatives to agricultural chemicals such as synthetic fertilizers and pesticides. The primary challenge in organic rice farming is controlling weeds without using herbicides and improving rice yield without chemical fertilizers. In our previous paper entitled as combined use of Azolla and loach suppressed weed Monochoria vaginalis and increased rice yield without agrochemicals, we reported the first year rice growth season results from an in situ container experiment. The experiment was designed with 4 treatments—control (with neither Azolla nor loach, Azolla (Azolla alone, loach (loach alone, and Az+Lo (combined Azolla and loach—with 3 replications each. The first year results showed that combined use of Azolla and loach was successful in weed suppression and increase in rice yield in 2012. In this paper, we report the second year results from the continuous container experiment in 2013. M.vaginalis emergences were very low in second year rice growth season on all treatments. Compared first year, the rice yields decreased in second year on all treatments due to different weather condition and with or without organic soybean oil cake application between two rice growth seasons. The second year results also showed the raising loach had a stronger effect to increase tiller and panicle numbers, and spikelet number per panicle, then improve rice yields to 2.3 times than control. The Azolla residues left from first year have weaker effect on rice growth and yield, but increase soil organic matter accumulation at second year. The two years study indicated that combined use of Azolla and loach can meet two of the greatest challenges in organic rice production: providing effective weed control and improving rice nutrition without agrochemicals.
Plazinski, Jacek; Zheng, Qi; Taylor, Rona; Croft, Lynn; Rolfe, Barry G.; Gunning, Brian E. S.
1990-01-01
Twenty-two isolates of Anabaena azollae derived from seven Azolla species from various geographic and ecological sources were characterized by DNA-DNA hybridization. Cloned DNA fragments derived from the genomic sequences of three different A. azollae isolates were used to detect restriction fragment length polymorphism among all symbiotic anabaenas. DNA clones were radiolabeled and hybridized against southern blot transfers of genomic DNAs of different isolates of A. azollae digested with restriction endonucleases. Eight DNA probes were selected to identify the Anabaena strains tested. Two were strain specific and hybridized only to A. azollae strains isolated from Azolla microphylla or Azolla caroliniana. One DNA probe was section specific (hybridized only to anabaenas isolated from Azolla ferns representing the section Euazolla), and five other probes gave finer discrimination among anabaenas representing various ecotypes of Azolla species. These cloned genomic DNA probes identified 11 different genotypes of A. azollae isolates. These included three endosymbiotic genotypes within Azolla filiculoides species and two genotypes within both A. caroliniana and Azolla pinnata endosymbionts. Although we were not able to discriminate among anabaenas extracted from different ecotypes of Azolla nilotica, Azolla mexicina, Azolla rubra and Azolla microphylla species, each of the endosymbionts was easily identified as a unique genotype. When total DNA isolated from free-living Anabaena sp. strain PCC7120 was screened, none of the genomic DNA probes gave detectable positive hybridization. Total DNA of Nostoc cycas PCC7422 hybridized with six of eight genomic DNA fragments. These data imply that the dominant symbiotic organism in association with Azolla spp. is more closely related to Nostoc spp. than to free-living Anabaena spp. Images PMID:16348182
Altered Nitrogenous Pools Induced by the Azolla-Anabaena Azolla Symbiosis
Newton, Jack W.; Cavins, James F.
1976-01-01
The free amino acid and ammonia pools of Azolla caroliniana were analyzed by quantitative column chromatography on columns capable of separating all of the nitrogenous constituents normally found in physiological fluids. Comparisons were made of plants containing symbiotic algae and grown on nitrogen-free media, plants grown on media containing nitrate, and algae-free plants also grown on nitrate media. The major feature of the data was a very high level of intracellular ammonia found in plants which contain N2-fixing algal symbionts. In addition to the more usual amino acids, serine and cystathionine were found in the free amino acid pool. PMID:16659770
Ghorbanzadeh Mashkani, Saeid; Tajer Mohammad Ghazvini, Parisa
2009-03-01
The presence of Cs and Sr in culture medium of Azolla filiculoides caused about 27.4% and 46.3% inhibition of biomass growth, respectively, in comparison to A. filiculoides control weight which had not metals. Biosorption batch experiments were conducted to determine the Cs and Sr binding ability of native biomass and chemically modified biosorbents derived from Azolla namely ferrocyanide Azolla sorbents type 1 and type 2 (FAS1 and FAS2) and hydrogen peroxide Azolla sorbent (HAS). The best Cs and Sr removal results were obtained when A. filiculoides was treated by 2M MgCl(2) and 30ml H(2)O(2) 8mM at pH 7 for 12h and it was then washed by NaOH solution at pH 10.5 for 6h. Pretreatment of Azolla have been suggested to modify the surface characteristics which could improve biosorption process. The binding of Cs and Sr on the cell wall of Azolla was studied with micro-PIXE and FT-IR.
Separation of abscission zone cells in detached Azolla roots depends on apoplastic pH.
Fukuda, Kazuma; Yamada, Yoshiya; Miyamoto, Kensuke; Ueda, Junichi; Uheda, Eiji
2013-01-01
In studies on the mechanism of cell separation during abscission, little attention has been paid to the apoplastic environment. We found that the apoplastic pH surrounding abscission zone cells in detached roots of the water fern Azolla plays a major role in cell separation. Abscission zone cells of detached Azolla roots were separated rapidly in a buffer at neutral pH and slowly in a buffer at pH below 4.0. However, cell separation rarely occurred at pH 5.0-5.5. Light and electron microscopy revealed that cell separation was caused by a degradation of the middle lamella between abscission zone cells at both pH values, neutral and below 4.0. Low temperature and papain treatment inhibited cell separation. Enzyme(s) in the cell wall of the abscission zone cells might be involved in the degradation of the pectin of the middle lamella and the resultant, pH-dependent cell separation. By contrast, in Phaseolus leaf petioles, unlike Azolla roots, cell separation was slow and increased only at acidic pH. The rapid cell separation, as observed in Azolla roots at neutral pH, did not occur. Indirect immunofluorescence microscopy, using anti-pectin monoclonal antibodies, revealed that the cell wall pectins of the abscission zone cells of Azolla roots and Phaseolus leaf petioles looked similar and changed similarly during cell separation. Thus, the pH-related differences in cell separation mechanisms of Azolla and Phaseolus might not be due to differences in cell wall pectin, but to differences in cell wall-located enzymatic activities responsible for the degradation of pectic substances. A possible enzyme system is discussed. Copyright © 2012 Elsevier GmbH. All rights reserved.
Sap, Merel; Speelman, Eveline N.; Lewan, Michael D.; Sinninghe Damsté, Jaap S.; Reichart, Gert-Jan
2010-05-01
Enormous blooms of the free-floating freshwater fern Azolla occurred within the Arctic Basin during an extended period of ~1.2 Ma during the middle Eocene (Brinkhuis et al. 2006; Speelman et al., GB, 2009). The sustained growth of Azolla, currently ranking among the fastest growing plants on Earth, in a major anoxic basin may have substantially contributed to decreasing atmospheric CO2 levels by burial of Azolla-derived organic matter. Speelman et al. (OG, 2009) reported biomarkers for Azolla (1,w20 C32 - C36 diols, structurally related C29 ω20,ω21 diols, C29 1,20,21 triols, C29 dihydroxy fatty acids as well as a series of wax esters containing these mono- and dihydroxy lipids), which can be used to reconstruct palaeo-environmental conditions. Here we assess the thermal stability of these compounds, to extend their biomarker potential. We specifically focused on the thermal stability of the Azolla biomarkers using hydrous pyrolysis in order to determine which burial conditions allow reconstruction of past occurrences of Azolla. In addition, hydrous pyrolysis was also performed on samples from the Eocene Arctic Ocean (ACEX core), to test if and how the biomarkers change under higher temperatures and pressures in situ. During hydrous pyrolysis, the biomass was heated under high pressure at temperatures ranging between 220 and 365°C for 72 hours. Four experiments were also run using different durations to explore the kinetics of biomarker degradation at specific temperatures. First results indicate that the Azolla specific diols are still present at 220°C, while the corresponding wax esters are already absent. At 300°C all Azolla specific biomarkers are destroyed. More specific determination of the different biomarkers' stability and kinetics would potentially allow the reconstruction of the temperature and pressure history of Azolla deposits. Literature: • Brinkhuis, H., Schouten, S., Collinson, M. E., Sluijs, A., Sinninghe Damste, J. S., Dickens, G. R., Huber
International Nuclear Information System (INIS)
Sah, R.N.; Goyal, S.S.; Rains, D.W.; Paige, D.F.
1989-01-01
An isotopic dilution method that overcomes the drawbacks of commonly used methods for measuring N 2 fixation by aquatic N‐fixers such as Azolla pinnata‐Anabaena azollae association (Azolla) is presented. The method was compared with 15 N2 gas (while maintaining CO 2 ) and the difference methods of measuring N 2 fixation. The isotopic dilution method was used for two conditions: a. For 15 N‐free growth medium, Azolla was pre‐enriched with 15 N, and N 2 fixation was determined by measuring the dilution of 15 N in the tissue. b. For the growth medium containing N, N2 fixation was determined by providing 15 N enriched ammonium sulfate in the growth medium and measuring 15 N to 14 N ratio in the tissue. An airtight chamber, necessary for 15 N 2 gas and acetylene reduction methods, was not representative of the growing environment of Azolla. Temperature in the airtight chamber was far from uniform and CO 2 was rapidly depleted. The isotopic dilution method is simpler, relatively inexpensive, subject to fewer errors and applicable to more diverse conditions, and yet was as accurate as 15 N2‐gas method. (author)
Coeval Eocene blooms of the freshwater fern Azolla in and around Arctic and Nordic seas
Barke, J.; Burgh, A.H.P. van der; Konijnenburg-van Cittert, J.H.A. van; Collinson, M.E.; Pearce, M.A.; Bujak, J.; Heilman-Clausen, C.; Lotter, A.F.; Speelman, E.N.; Kempen, M.M.L. van; Reichart, G.-J.; Brinkhuis, H.
2012-01-01
For a short time interval (c. 1.2 Myr) during the early middle Eocene (~ 49 Myr), the central Arctic Ocean was episodically densely covered by the freshwater fern Azolla, implying sustained freshening of surface waters. Coeval Azolla fossils in neighboring Nordic seas were thought to have been
DEFF Research Database (Denmark)
Liu, Jingna; Xu, Heshui; Jiang, Ying
2017-01-01
Azolla caroliniana Willd. is widely used as a green manure accompanying rice, but its ecological importance remains unclear, except for its ability to fix nitrogen in association with cyanobacteria. To investigate the impacts of Azolla cultivation on methane emissions and environmental variables...... in paddy fields, we performed this study on the plain of Dongting Lake, China, in 2014. The results showed that the dual cropping of Azolla significantly suppressed the methane emissions from paddies, likely due to the increase in redox potential in the root region and dissolved oxygen concentration...... at the soil-water interface. Furthermore, the floodwater pH decreased in association with Azolla cultivation, which is also a factor significantly correlated with the decrease in methane emissions. An increase in methanotrophic bacteria population (pmoA gene copies) and a reduction in methanogenic archaea (16...
Carlozzi, Pietro; Padovani, Giulia
2016-05-01
This study has investigated the potential of an Azolla-Anabaena symbiosis, a marriage between the cyanobacterium Anabaena azollae and the aquatic fern (Azolla), to remove ammonia from freshwater fish breeding areas. Experiments were carried out under artificial light of 20, 70, and 140 μmol m(-2) s(-1). We investigated three different water temperatures for the growing Azolla, ranging from sub-optimal to optimal temperatures (15, 22, and 28 °C). The capability of Azolla to remove ammonia from wastewater was demonstrated, and the highest ammonia concentration tolerated by the symbiosis between Azolla-anabaena without any toxic effect on the aquatic ferns was ascertained. The shortest time taken to remove ammonia from wastes, 2.5 cm deep and at 28 °C, was 40 min. The ammonia removal rate (A RR) was both light and temperature dependent and the highest rate (6.394 h(-1)) was attained at light intensity of 140 μmol m(-2) s(-1) and at a temperature of 28 °C; the lowest (0.947 h(-1)) was achieved at 20 μmol m(-2) s(-1) and 15 °C. The depth of the fish-wastewater pool also affected the A RR with the relation between A RR and the depth being a hyperbolic function.
Energy Technology Data Exchange (ETDEWEB)
Rakhshaee, Roohan, E-mail: roohan_rakhshaee@guilan.ac.ir
2015-11-30
Highlights: • The novel living and dead bio–nano couples were prepared. • Living Azolla was more effective stabilizer for nano particles. • Increasing stabilization increased methylene blue (MB) adsorption. • The portion of Fe{sup 0} NPs had the main rule to determine kinetic model to adsorb MB. • It was studied the various factors rule on the living Azolla growth and MB removal. - Abstract: Fe{sup 0} nano particles (FNPs) were connected to the cell wall of the dead and living Azolla filicoloides as an aquatic fern, individually. FNPs mean size was decreased due to the stabilization, especially using the living one. It was compared the results of X-ray photoelectron spectroscopy (XPS), saturation magnetization (Ms), zeta potential (ZP) and thermal analysis (DSC and TGA) of the dead and living Azolla connected to FNPs, and also the findings of potentiometric titration (PT) of the cell wall's pectin of the dead and living Azolla. It was confirmed (by XRD and XPS) that Fe{sup 0} nano particles when were connected to the living Azolla did not produce Fe{sub 3}O{sub 4} due to oxidation unlike the bare FNPs and the connected form to the dead Azolla, by reason of the more stabilization (more surface protection) of nano iron particles after connecting to the living Azolla. To adsorb methylene blue by these agents at the optimum pre-treatment pH 10 and adsorption pH 8, the parameters of equilibrium sorption, rate constant of second-order sorption and activation energy were obtained as: living Azolla–FNPs > dead Azolla–FNPs > FNPs > dead Azolla, while, their thermodynamic parameters (ΔG°, ΔH° and ΔS°) had the reverse arrangement. It was also studied the various factors rule such as photoperiod and the presence of heavy metals on the living Azolla growth coupled with FNPs and its MB removal ability.
Effects of different combinations of Hoagland's solution and Azolla ...
African Journals Online (AJOL)
ALAN
2013-04-17
Apr 17, 2013 ... hydroponic cultures containing different compositions of hydroponic solutions were evaluated in ... (Hoagland's solution minus N solution excluding Azolla; ..... nutrient deficiencies on photosynthesis and respiration in spinach.
Shukla, Mayank; Bhattacharyya, Amitav; Shukla, Pankaj Kumar; Roy, Debashis; Yadav, Brijesh; Sirohi, Rajneesh
2018-04-01
In the recent past,few studies have been carried out in chicken to assess the effect of Azolla meal and raw Azolla feeding on the performance of chicken. If turkeys effectively use unconventional feedstuffs like Azolla without reducing the performance, it will increase the profitability of turkey business. Hence, a study was carried out to evaluate the effect of dried Azolla pinnata vis-a-vis raw Azolla as choice feeding on the growth, feed conversion ratio (FCR), blood biochemical attributes, and immune competence traits of growing turkeys under intensive system. A total of 72, 8-week-old grower turkey poults of black variety were randomly distributed into three dietary treatments having three replicates each with eight birds. The birds of the control group (T1) were fed a basal diet (CP - 19.71% and ME - 2789.79 Kcal/kg), while the other group (T2) and choice-feeding group (T3) were fed 5% of basal diet replaced by dry Azolla powder on DM basis and ad libitumAzolla along with basal diet, respectively. There was no significant difference among the different groups in the average weekly weight gain during the entire experiment. FCR was significantly better (pdiet may improve FCR without any adverse effect on blood biochemical attributes and immune competence traits.
Acharya, Parag; Mohanty, G P; Pradhan, C R; Mishra, S K; Beura, N C; Moharana, B
2015-11-01
The objective of this study was to investigate the dietary advantages of inclusion of unconventional nutrient source, i.e., Azolla in the basal diet of White Pekin broilers. All ducklings were randomly distributed into three treatment groups with three replicates each and each replicate having 12 ducklings and were reared in deep litter system. Groups were subjected to three dietary treatments such as G1: Basal diet, G2: Basal diet + 5% fresh Azolla of basal diet, G3: Basal diet + 10% fresh Azolla of basal diet. During experimental period, parameters, such as bodyweight, bodyweight gain, feed consumption,feed conversion ratio(FCR), and economic of production,wererecorded. The result showed that body weights in every week, except the 5(th) week, did not differ significantly between groups. However, no significant difference was observed between the groups in any week in terms of absolute body weight gain and feed consumption. As regard to FCR, the 10% Azolla group (G3) showed the best feed efficiency followed by the 5% Azolla group (G2) and the control group (G1). On the basis of profit/bird or profit/kg live weight, each of the Azolla-fed group showed a higher economic efficiency than the control. From the experiment, it was concluded that Azollaat 5 or 10% level can be included in the diet to economize the White Pekin broiler farming, and it can be great impetus to poultry farming to include unconventional nutrient source as a dietary supplement.
Directory of Open Access Journals (Sweden)
Raja W.
2012-11-01
Full Text Available This paper is the first in a series reporting a study on the effects of different concentrations of insecticide, Endosulfan (0-600ppm was premeditated on 5th day after insecticide exposure with respect to growth rate, pigment composition and photosynthetic activity of Azolla microphylla under laboratory conditions which become non-target organism in the rice fields. Endosulfan inhibited the relative growth rate, pigment content and photosynthetic O2 evolution. Phycocyanin was main target followed by carotenoid and total chlorophyll. Significant increase in pigment, flavonoid and Anthocyanin was noticed after six days of treatment. In contrast to the photosynthetic activity, the rate of respiration in Azolla microphylla was increased significantly. Our results show that Endosulfan at normally recommended field rates and intervals are seldom deleterious to the beneficial and Eco friendly Azolla microphylla and their activities and thus in turn suppress plant growth and development. Phytotoxity of Azolla microphylla can be minimized by restrictions on application, timing, method and rate of application.
Directory of Open Access Journals (Sweden)
B. Gangadhar
2015-12-01
Full Text Available An experiment of 75 days duration was conducted in fertilized outdoor circular cement tanks (1,000 L with soil base for evaluating the growth and survival of Labeo fimbriatus fry fed with pelleted feed containing varied levels of dried azolla (Azolla pinnata. The Control feed contained 45% groundnut oilcake plus 45% rice bran and 10% finger millet flour added as binder for pelleting. Dried azolla powder was incorporated into the feed at 10, 20, 30 and 40% levels, replacing the groundnut cake and rice bran proportionately. L. fimbriatus (mean length 2.42 cm fry were stocked in all the tanks at 30 m−3. The fish were fed 10% of body weight during the first month, followed by 7% during the second month and 5% during the last 15 days. Incorporation of azolla did not affect (p > 0.05 the water quality, growth and survival of fingerlings at harvest. Incorporation of azolla in the diet reduced the cost of feed (Rs. per 100 g biomass; Rs: Indian rupee, INR; 1 INR ≈ 0.015 EUR from 3.35 to 2.53, with a cost saving of 24.48%. The study indicated the possibility of incorporating azolla in diets of L. fimbriatus up to 40% during fry-to-fingerling rearing, resulting in savings on feed cost.
Yadav, Ravindra Kumar; Tripathi, Keshawanand; Ramteke, Pramod Wasudeo; Varghese, Eldho; Abraham, Gerard
2016-09-01
Freshly separated cyanobionts of Azolla microphylla and Azolla caroliniana plants exposed to salinity showed decline in the cellular constituents such as chlorophyll (23.1 and 38.9%) and protein (12.9 and 19.3%). However, an increase in the carotenoid and sugar content was observed. Exposure to salinity stress reduced the heterocyst frequency (35.4 and 57.2%) and nitrogenase activity (37.7 and 46.3%) of the cyanobionts. Increase in the activity of antioxidant enzymes such as super oxide dismutase (50.6 and 11.5%), ascorbate peroxidase (63.7 and 57.9%), catalase (94.2 and 22.5%) as well as non-enzymatic antioxidant proline (18.8 and 13.3%) was also observed in response to salinity. The cyanobionts exhibited significant increase in the intracellular Na(+) level and reduced intracellular K(+)/Na(+) and Ca(2+)/Na(+) ratio in response to salinity. The results demonstrate the adverse impact of salinity on the freshly separated cyanobionts as similar to free living cyanobacteria. These results may be helpful in the critical evaluation of salinity tolerance mechanism of the cyanobiont and its interaction with the host. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Gebhardt, J S; Nierzwicki-Bauer, S A
1991-01-01
Symbiotically associated cyanobacteria from Azolla mexicana and Azolla pinnata were isolated and cultured in a free-living state. Morphological analyses revealed differences between the free-living isolates and their symbiotic counterparts, as did restriction fragment length polymorphism (RFLP) analyses with both single-copy glnA and rbcS gene probes and a multicopy psbA gene probe. RFLP analyses with Anabaena sp. strain PCC 7120 nifD excision element probes, including an xisA gene probe, detected homologous sequences in DNA extracted from the free-living isolates. Sequences homologous to these probes were not detected in DNA from the symbiotically associated cyanobacteria. These analyses indicated that the isolates were not identical to the major cyanobacterial symbiont species residing in leaf cavities of Azolla spp. Nevertheless, striking similarities between several free-living isolates were observed. In every instance, the isolate from A. pinnata displayed banding patterns virtually identical to those of free-living cultures previously isolated from Azolla caroliniana and Azolla filiculoides. These results suggest the ubiquitous presence of a culturable minor cyanobacterial symbiont in at least three species of Azolla. Images PMID:1685078
Growth performance and phytoremediation ability of Azolla pinnata ...
African Journals Online (AJOL)
ADOWIE PERE
Growth performance and phytoremediation ability of Azolla pinnata in produced water ... Toxicity symptoms of produced water on the plant include chlorosis, frond ... easily to various conditions and can tolerate a wide ... The aquatic macrophyte used for this experiment was .... the Kathloni oilfield in northeast India.
Sulandjari; Yunindanova, M. B.
2018-03-01
Black rice is a local rice variety that contains a high level of anthocyanin pigment. Anthocyanin has been reported to be very effective in reducing cholesterol levels as well as cancer cell invasion. One of the main problems in rice cultivation is lack of water. System of Rice Intensification (SRI) has shown to be able to increase rice productivity by increasing the number of tillers. This system is known as a water-efficient cultivation. Other rice cultivation barrier is related to the use of nitrogen fertilizer. One of replacement of nitrogen fertilizer is by adding azolla. The objective of this research was identifying growth and yield of organic black rice with intermittent irrigation and application of azolla. The plant material used was black rice Cempo variety from Sleman, Yogyakarta. This experiment utilized 4 dosages of azolla as the first treatment: 100 gm-2, 200 gm-2 and 400 gm-2. The second treatment was water supply consisted of continuous flooded 2 cm; flooded 2 cm every 3 days; flooded 2 cm every 6 days. The results depicted that the application of azolla was able to increase the growth of black rice. Azolla of 200 gm-2 and 400 gm-2 and intermittent 3 days to 6 days generated higher dry grain, anthocyanin and antioxidant. Azolla 200 gm-2 with intermittent irrigation 3 days could be a good combination to improve plant growth, yield and properties of local black rice.
Polyamine-Induced Rapid Root Abscission in Azolla pinnata.
Gurung, Sushma; Cohen, Michael F; Fukuto, Jon; Yamasaki, Hideo
2012-01-01
Floating ferns of the genus Azolla detach their roots under stress conditions, a unique adaptive response termed rapid root abscission. We found that Azolla pinnata plants exhibited dose-dependent rapid root abscission in response to the polyamines spermidine and spermine after a substantial time lag (>20 min). The duration of the time lag decreased in response to high pH and high temperature whereas high light intensity increased the time lag and markedly lowered the rate of abscission. The oxidation products of polyamines, 1,3-diaminopropane, β-alanine and hydrogen peroxide all failed to initiate root abscission, and hydroxyethyl hydrazine, an inhibitor of polyamine oxidase, did not inhibit spermine-induced root abscission. Exposure of A. pinnata to the polyamines did not result in detectable release of NO and did not affect nitrite-dependent NO production. The finding of polyamine-induced rapid root abscission provides a facile assay for further study of the mode of action of polyamines in plant stress responses.
Pyrolysis of azolla, sargassum tenerrimum and water hyacinth for production of bio-oil.
Biswas, Bijoy; Singh, Rawel; Krishna, Bhavya B; Kumar, Jitendra; Bhaskar, Thallada
2017-10-01
Pyrolysis of azolla, sargassum tenerrimum and water hyacinth were carried out in a fixed-bed reactor at different temperatures in the range of 300-450°C in the presence of nitrogen (inert atmosphere). The objective of this study is to understand the effect of compositional changes of various aquatic biomass samples on product distribution and nature of products during slow pyrolysis. The maximum liquid product yield of azolla, sargassum tenerrimum and water hyacinth (38.5, 43.4 and 24.6wt.% respectively) obtained at 400, 450 and 400°C. Detailed analysis of the bio-oil and bio-char was investigated using 1 H NMR, FT-IR, and XRD. The characterization of bio-oil showed a high percentage of aliphatic functional groups and presence of phenolic, ketones and nitrogen-containing group. The characterization results showed that the bio-oil obtained from azolla, sargassum tenerrimum and water hyacinth can be potentially valuable as a fuel and chemicals. Copyright © 2017 Elsevier Ltd. All rights reserved.
Nitrogen and azolla response on growth of rice plant of Mitra-I variety with SRI method
International Nuclear Information System (INIS)
Nurmayulis; Putra Utama; Dewi Firnia; Hasnan Yani; Ania Citraresmini
2011-01-01
The research was conducted in Cisadap, Bunter Village, District of Sukadana, Ciamis Regency, West Java Province from January to May 2011. This study was carried out to know the response of growth of rice plant which was fertilized by nitrogen fertilizer and Azolla michrophylla using the system of rice intensification. This research used five dozes of nitrogen fertilizer (0 %, 25 %, 50 %, 75 %, 100 %) from N 92 kg ha -1 as a recommended nitrogen fertilizer (urea 200 kg ha -1 ), and also 1,13 ton ha -1 Azolla michrophylla. The result obtained from this research showed that the application of N fertilizer at 50 % of the recommend dose (100 kg ha -1 ) with adding Azolla at a rate of 1.13 t ha -1 gave good result in the terms of plant height at 2-6 weeks after planting and number of tillers at 2-7 weeks after planting. Interaction of the 50 % N fertilizer from the recommended dose planting 1,13 t ha -1 give the highest dry weight of Azolla of plants at seven weeks after planting. (author)
Directory of Open Access Journals (Sweden)
Nur Bambang Priyo Utomo
2015-03-01
Full Text Available ABSTRACTThe objective of this study was to study the effect of incubation period on the nutritional content of Azolla sp. meal fermented by Trichoderma harzianum, and its optimum supplementation level in the feed of tilapia Oreochromis sp. In incubation period treatments, fermentation of Azolla meal was performed in two, six, eight, and ten days (AF2, AF6, AF8, AF10 using Trichoderma harzianum as the fermentor. The fish used in this study was tilapia Oreochromis sp. with an average weight of 10.59±1.29 g. The design of the feeding treatments was repeletting commercial feed with Azolla leaves by with different supplementation levels, i.e. 0% (A/control, 30% (B, 60% (C, and 90% (D. Faecal collection for digestibility measurement was conducted for 15 days and fish growth rate was observed for 40 days. Azolla meal fermented for two days (AF2 showed the best results among the other treatments with a crude fiber decrease of 37.19% and protein increase of 38.65%. The results of this study indicate that fermentation can increase the nutritional quality of Azolla meal and its most optimal supplementation level in the diet of tilapia is 30%.Keywords: crude fiber, Azolla sp., tilapiaABSTRAKPenelitian ini bertujuan untuk mengetahui pengaruh lama waktu fermentasi daun mata lele Azolla sp. menggunakan kapang Trichoderma harzianum serta dosis optimal dalam pakan ikan nila Oreochromis sp. Proses fermentasi tepung daun mata lele dilakukan selama dua, enam, delapan, dan sepuluh hari (AF2, AF6, AF8, AF10. Ikan uji pada penelitian ini menggunakan ikan nila Oreochromis sp. dengan bobot rata-rata 10,59±1,29 g yang ditebar sebanyak 6 ekor/akuarium berukuran 50×45×30 cm3. Sebagai pakan perlakuan yakni repeletting daun mata lele dengan pakan komersil pada tingkat suplementasi 0% (A/kontrol, 30% (B, 60% (C, dan 90% (D. Pemeliharaan ikan uji dan pengumpulan data dilakukan dengan mengumpulkan feses ikan untuk uji ketercernaan selama 15 hari dan mengamati pertumbuhan
Optimation of Nitrogen and Phosphorus in Azolla Growth as Biofertilizer
Directory of Open Access Journals (Sweden)
Hany Handajani
2013-03-01
Full Text Available Nitrogen is one of the most important minerals for living organisms. Azolla is known as a small water fern which can fix nitrogen through the symbiotic association with the blue green algae Anabaena. Experimental studies were carried out in the glass house, investigating the growth of Azolla using different levels of nitrogen and phosphorus in the media. The experiment used 12 treatments with 3 levels of nitrogen (0, 5, and 10 mg atom/L and 4 levels of phosphorus (0, 10, 20, and 30 mg atom/l in a factorial design with 3 replicates. The results show that the highest biomass for fresh weight (13.28 g, dry weight (1,126 g, and the fastest doubling time (7.71 days were found in combination of 10 mg atom/L N and 30 mg atom/L P. Meanwhile, the highest protein content was found in combination of 5 mg atom/L N and 20 mg atom/L P. After the third day heterocyst cells in Anabaena could only be found in those two combinations, but the highest heterocyst cells was found in the lower N and P combination similar to the highest protein content. Further experiment is suggested to introduce Azolla as bio-fertilizer for acid water system, such as peat land water.
Dijkhuizen, Laura W.; Brouwer, Paul; Bolhuis, Henk; Reichart, Gert Jan; Koppers, Nils; Huettel, Bruno; Bolger, Anthony M.; Li, Fay Wei; Cheng, Shifeng; Liu, Xin; Wong, Gane Ka Shu; Pryer, Kathleen; Weber, Andreas P.M.; Bräutigam, Andrea; Schluepmann, Henriette
2018-01-01
Dinitrogen fixation by Nostoc azollae residing in specialized leaf pockets supports prolific growth of the floating fern Azolla filiculoides. To evaluate contributions by further microorganisms, the A. filiculoides microbiome and nitrogen metabolism in bacteria persistently associated with Azolla
Directory of Open Access Journals (Sweden)
Ferina Rosiana
2013-03-01
Full Text Available Penelitian untuk mengetahui efek pemberian kombinasi kompos jerami dengan Azolla dan pupuk hayati majemuk terhadap peningkatan populasi bakteri penambat N dan produktivitas tanaman padi dengan teknologi IPAT-BO dilaksanakan dari bulan April hingga Juli 2012 di kebun percobaan Fakultas Pertanian, Universitas Padjadjaran, Jatinangor, dengan ketinggian + 740 m dpl. Penelitian ini menggunakan rancangan acak kelompok faktor tunggal dengan dua belas perlakuan dan tiga kali ulangan. Perlakuan terdiri dari (A tanpa kompos jerami, (B kompos jerami 2,5 ton ha-1, (C kompos jerami 5 ton ha-1, (D kompos Azolla 0,5 ton ha-1, (E kompos jerami 2,5 ton ha-1 + kompos Azolla 0,5 ton ha-1, (F kompos jerami 5 ton ha-1 + kompos Azolla 0,5 ton ha-1, (G pupuk hayati 400 g ha-1, (H kompos jerami 2,5 ton ha-1 + pupuk hayati 400 g ha-1, (I kompos jerami 5 ton ha-1 + pupuk hayati 400 g ha-1, (J kompos Azolla 0,5 ton ha-1 + pupuk hayati 400 g ha-1, (K kompos jerami 2,5 ton ha-1 + kompos Azolla 0,5 ton ha-1 + pupuk hayati 400 g ha-1, (L kompos jerami 5 ton ha-1 + kompos Azolla 0,5 ton ha-1 + pupuk hayati 400 g ha-1.Aplikasi perlakuan kompos jerami, kompos Azolla dan pupuk hayati majemuk memberikan pengaruh terhadap populasi penambat N (Azotobacter sp. dan Azospirilium sp. dan produktifitas tanaman padi. Aplikasi kompos jerami 2,5 ton ha-1 dengan pupuk hayati 400 g ha-1 memberikan hasil GKP yaitu 64,39 g tanaman-1 (6,13 ton ha-1. Kata kunci: IPAT-BO, kompos Azolla, kompos jerami, pupuk hayati.
Directory of Open Access Journals (Sweden)
Mayank Shukla
2018-04-01
Full Text Available Background and Aim: In the recent past, few studies have been carried out in chicken to assess the effect of Azolla meal and raw Azolla feeding on the performance of chicken. If turkeys effectively use unconventional feedstuffs like Azolla without reducing the performance, it will increase the profitability of turkey business. Hence, a study was carried out to evaluate the effect of dried Azolla pinnata vis-a-vis raw Azolla as choice feeding on the growth, feed conversion ratio (FCR, blood biochemical attributes, and immune competence traits of growing turkeys under intensive system. Materials and Methods: A total of 72, 8-week-old grower turkey poults of black variety were randomly distributed into three dietary treatments having three replicates each with eight birds. The birds of the control group (T1 were fed a basal diet (CP - 19.71% and ME - 2789.79 Kcal/kg, while the other group (T2 and choice-feeding group (T3 were fed 5% of basal diet replaced by dry Azolla powder on DM basis and ad libitum Azolla along with basal diet, respectively. Results: There was no significant difference among the different groups in the average weekly weight gain during the entire experiment. FCR was significantly better (p<0.05 in the choice-feeding group compared to the other two experimental groups during 8-16 weeks of age. There was no significant difference among the treatment groups in any of the blood biochemical indices except plasma uric acid, which was significantly decreased (p<0.01 in T2 compared to T1 at 16 weeks of age. HA and IgM response to 1% sheep red blood cells (log2 titer were numerically better in T2 and T3 compared to the T1. Conclusion: Thus, it may be inferred that choice feeding with Azolla, and basal diet may improve FCR without any adverse effect on blood biochemical attributes and immune competence traits.
L-Myo-inositol 1-phosphate synthase in the aquatic fern Azolla filiculoides.
Benaroya, Rony Oren; Zamski, Eli; Tel-Or, Elisha
2004-02-01
L-Myo-inositol 1-phosphate synthase (INPS EC 5.5.1.4) catalyzes the conversion of D-glucose 6-phosphate to L-myo-inositol 1-phosphate. INPS is a key enzyme involved in the biosynthesis of phytate which is a common form of stored phosphates in higher plants. The present study monitored the increase of INPS expression in Azolla filiculoides resulting from exposure to inorganic phosphates, metals and salt stress. The expression of INPS was significantly higher in Azolla plants that were grown in rich mineral growth medium than those maintained on nutritional growth medium. The expression of INPS protein and corresponding mRNA increased in plants cultured in minimal nutritional growth medium when phosphate or Zn2+, Cd2+ and NaCl were added to the growth medium. When employing rich mineral growth medium, INPS protein content increased with the addition of Zn2+, but decreased in the presence of Cd2+ and NaCl. These results indicated that accumulation of phytate in Azolla is a result of the intensified expression of INPS protein and mRNA, and its regulation may be primarily derived by the uptake of inorganic phosphate, and Zn2+, Cd2+ or NaCl.
Directory of Open Access Journals (Sweden)
Sacchi, Angelo
2007-03-01
Full Text Available We investigated the biofiltration ability of the aquatic fern Azolla to remove polyphenols and chemical oxygen demand (COD from olive mill wastewater (OMWw collected from the traditional (TS and continuous (CS extraction systems. Azolla biomass was packed into five sequential Imhoff cones and five sequential columns. In both experiments, the filtrates collected from the 5th biofilter showed a decrease in polyphenol contents: from 7650 mg l–1 to 3610 mg l–1 in TS OMWw and from 3852 mg l–1 to 1351 mg l–1 in CS OMWw. The COD contents decreased from 110200 mg L–1 to 52400 mg L–1 in TS OMWw and from 41600 mg L–1 to 2300 mg L–1 in CS OMWw. A 5:1 OMWw to Azolla-fresh-weight ratio was optimal for both polyphenol and COD removal. The biofiltration ability of alfalfa was compared with that of Azolla, but the treatment with alfalfa did not result in the reduction of COD or polyphenols.La eficacia del helecho de agua azolla para eliminar polifenoles y reducir la demanda química de oxígeno (DQO de los alpechines obtenidos en el proceso de obtención tradicional y continuo del aceite de oliva, fue investigado mediante ensayos de filtración. Cinco conos secuenciales de Imhoff y cinco columnas secuenciales se rellenaron de biomasa de Azolla. En ambos experimentos, el filtrado procedente de la quinta extracción mostró una disminución en el contenido de polifenoles de 7650 mg L–1 a 3610 mg L–1en el alpechín obtenido mediante el sistema tradicional y de 3852 mg L–1 a 1351 mg L–1en el alpechín del sistema continuo. La demanda química de oxígeno del alpechín del sistema tradicional disminuyó de 110200 mg L–1 a 52400 mg L–1 en y de 41600 mg L–1a 2300 mg L–1en el procedente del sistema continuo. Una proporción en peso 5:1 de alpechín: Azolla fue la óptima tanto para la reducción de los polifenoles como para la de la DQO. La eficiencia del tratamiento biológico con alfalfa se comparó con la obtenida con Azolla. Los
Directory of Open Access Journals (Sweden)
Mahmudah Hamawi
2016-12-01
Full Text Available The effort of growing azolla in intercroping rice will be hoped to supply a green manure for rice plants. Additing P of the phosphat rock in the field can be expected to increase the result of rice yield.The research was conducted on December 2, 2006 to April 5, 2007 at Tegalgondo Karangploso of Malang. onsidering those problems, the researcher employs the factorial group randome desigh that compose two factor by controlling as comparison tool (inorganic treatment. The first factor is P in the phosphat rock contained 4 stages. As followed Po (without P, P1 (25 kg P ha-1, P2 (50 kg P ha-1, P3 (25 kg P ha-1. The second factor is time of incorporated Azolla microphylla Kaulfuss (W, which consist 4 stage. As followed W1 (incorporated 1 day before transplanting rice, W2 (50 % the azolla biomass in the field was incorporated during 14, 28, and 42 days after transplanting rice, W3 (50 % the azolla biomass in the field was incorporated during 21, and 49 days after transplanting rice, W4 (50 % the azolla biomass in the field was incorporated during 35 days after transplanting rice. The research was replicated 3 replications. The research finding showed that phosphat rock with 25 kg of P ha-1 doses combinationed with time of incorporating the azolla biomass at 14, 28 and 42 days after transplanting rice, the result of rice would be increasing in 31,4 % and R/C value resulted 1,47. Giving phosphat rock with 25 – 75 kg P ha-1 doses increased the azolla biomass at 146,4 % until 153 % and increased the yield of rice at 21,1% until 43,8 %.
Chichilichi, Biswal; Mohanty, G P; Mishra, S K; Pradhan, C R; Behura, N C; Das, A; Behera, K
2015-09-01
The present study was conducted to evaluate the effect of partial supplementation of sun-dried Azolla as a protein source on the immunity of commercial broilers in coastal Odisha. A 180 day-old broiler chicks were distributed in six dietary treatments viz. C1: Basal diet, C2: Basal diet + enzyme, T1: Basal diet +5% protein from Azolla, T2: Basal diet + 5% protein from Azolla + enzyme, T3: Basal diet +10% protein from Azolla, and T4: Basal diet + 10% protein from Azolla + enzyme. Cutaneous basophilc hypersensitivity (CBH) and humoral immunity response were determined at the 38(th) day of age. At 42(nd) day, the weight of lymphoid organs, an antioxidant enzyme, and lipid peroxidation activity were determined. The CBH response did not differ significantly among the treated groups, but the sheep red blood cells response was significantly higher in T4. The weight of lymphoid organs or immune organs of all the treated groups did not differ significantly (p>0.05). The erythrocyte catalase level of T4 group was found to be significantly higher than rest of the treated groups except T3. It may be concluded that supplementation of Azolla at 10% of dietary protein requirement along with enzyme supplementation in an isonitrogenous diet showed a better immune response in broilers.
Directory of Open Access Journals (Sweden)
Biswal Chichilichi
2015-09-01
Full Text Available Aim: The present study was conducted to evaluate the effect of partial supplementation of sun-dried Azolla as a protein source on the immunity of commercial broilers in coastal Odisha. Materials and Methods: A 180 day-old broiler chicks were distributed in six dietary treatments viz. C1: Basal diet, C2: Basal diet + enzyme, T1: Basal diet +5% protein from Azolla, T2: Basal diet + 5% protein from Azolla + enzyme, T3: Basal diet +10% protein from Azolla, and T4: Basal diet + 10% protein from Azolla + enzyme. Cutaneous basophilc hypersensitivity (CBH and humoral immunity response were determined at the 38th day of age. At 42nd day, the weight of lymphoid organs, an antioxidant enzyme, and lipid peroxidation activity were determined. Results: The CBH response did not differ significantly among the treated groups, but the sheep red blood cells response was significantly higher in T4. The weight of lymphoid organs or immune organs of all the treated groups did not differ significantly (p>0.05. The erythrocyte catalase level of T4 group was found to be significantly higher than rest of the treated groups except T3. Conclusion: It may be concluded that supplementation of Azolla at 10% of dietary protein requirement along with enzyme supplementation in an isonitrogenous diet showed a better immune response in broilers.
Azolla as a component of the space diet during habitation on Mars
Katayama, Naomi; Yamashita, Masamichi; Kishida, Yoshiro; Liu, Chung-Chu; Watanabe, Iwao; Wada, Hidenori; Space Agriculture Task Force
We evaluate a candidate diet and specify its space agricultural requirements for habitation on Mars. Rice, soybean, sweet potato and a green-yellow vegetable have been selected as the basic vegetarian menu. The addition of silkworm pupa, loach, and Azolla to that basic menu was found to meet human nutritional requirements. Co-culture of rice, Azolla, and loach is proposed for developing bio-regenerative life support capability with high efficiency of the usage of habitation and agriculture area. Agriculture designed under the severe constraints of limited materials resources in space would make a positive contribution toward solving the food shortages and environmental problems facing humans on Earth, and may provide an effective sustainable solution for our civilization.
Rai, Prabhat Kumar
2008-01-01
The level of heavy metal pollution in Singrauli, an industrial region in India, was assessed and the phytoremediation capacity of a small water fern, Azolla pinnata R.BR (Azollaceae), was observed to purify waters polluted by two heavy metals, i.e., mercury (Hg) and cadmium (Cd) under a microcosm condition. Azolla pinnata is endemic to India and is an abundant and easy-growing free-floating water fern usually found in the rice fields, polluted ponds, and reservoirs of India. The fern was grown in 24 40-L aquariums containing Hg2+ and Cd2+ ions each in concentrations of 0.5, 1.0, and 3.0 mgL(-1) during the course of this study. The study revealed an inhibition of Azolla pinnata growth by 27.0-33.9% with the highest in the presence of Hg (II) ions at 0.5 mgL(-1) in comparison to the control After 13 days of the experiment, metal contents in the solution were decreased up to 70-94%. In the tissues of Azolla pinnata, the concentration of selected heavy metals during investigation was recorded between 310 and 740 mgKg(-1) dry mass, with the highest levelfoundfor Cd (II) treatment at 3.0 mgL(-1) containing a metal solution.
Directory of Open Access Journals (Sweden)
Lukman Amir
2014-01-01
Full Text Available DOWNLOAD PDFPenelitian ini bertujuan untuk mengetahui kadar nitogen tanah dan pertumbuhantanaman bayam yang diberi pupuk kompos Azolla. Penelitian ini menggunakan rancanganacak kelompok (RAK yang terdiri atas 2 kelompok, dimana tiap kelompok terdiri atas 4perlakuan dan 1 kontrol dengan 3 ulangan. Parameter pengamatan adalah pertumbuhantanaman bayam yang meliputi tinggi tanaman (cm, berat kering tanaman bayam (gram,kadar amonium (NH4+ dan nitrat (NO3- pada tanah serta kadar nitrat (NO3- air lindihan.Hasil penelitian menunjukkan bahwa pupuk kompos Azolla mulai berpengaruh nyataterhadap tinggi tanaman sejak pengamatan minggu ke-tiga dan berpengaruh nyata pulaterhadap berat kering tanaman bayam. Pemberian pupuk kompos Azolla berpengaruh nyataterhadap kadar amonium dan nitrat tanah masing-masing pada minggu ke dua dan mingguke dua dan ke empat. Disamping itu pemberian pupuk tersebut juga berpengaruh nyataterhadap kadar nitrat pada air lindihan.Kata kunci : Pupuk kompos Azolla, pertumbuhan tanaman bayam, nitrogen tanah
Rakhshaee, Roohan; Khosravi, Morteza; Ganji, Masoud Taghi
2006-06-30
Dead Azolla filiculoides can remove Pb(2+),Cd(2+), Ni(2+) and Zn(2+) corresponding to second-order kinetic model. The maximum adsorption capacity (Q(max)) to remove these metal ions by the alkali and CaCl(2)/MgCl(2)/NaCl (2:1:1, molar ratio) activated Azolla from 283 to 313K was 1.431-1.272, 1.173-0.990, 1.365-1.198 and 1.291-0.981mmol/g dry biomass, respectively. Q(max) to remove these heavy metals by the non-activated Azolla at the mentioned temperature range was obtained 1.131-0.977, 1.092-0.921, 1.212-0.931 and 1.103-0.923mmol/g dry biomass, respectively. In order to remove these metal ions by the activated Azolla, the enthalpy change (DeltaH) was -4.403, -4.495, -4.557 and -4.365kcal/mol and the entropy change (DeltaS) was 2.290, 1.268, 1.745 and 1.006cal/molK, respectively. While, to remove these metal ions by the non-activated Azolla, DeltaH was -3.685, -3.766, -3.967 and -3.731kcal/mol and DeltaS was 2.440, 1.265, 1.036 and 0.933cal/molK, respectively. On the other hand, the living Azolla removed these heavy metals corresponding to first-order kinetic model. It was also shown that pH, temperature and photoperiod were effective both on the rate of Azolla growth and the rate of heavy metals uptake during 10 days. It was appeared the use of Ca(NO(3))(2) increased both Azolla growth rate and the rate of heavy metals uptake while the using KNO(3) although increased Azolla growth rate but decreased the rate of heavy metals uptake.
Energy Technology Data Exchange (ETDEWEB)
Rakhshaee, Roohan [Department of Applied Chemistry, Faculty of Chemistry, Islamic Azad University, Rasht Branch, P.O. Box 41335-3516, Rasht (Iran, Islamic Republic of); Khosravi, Morteza [Department of Applied Chemistry, Faculty of Chemistry, Islamic Azad University, North Tehran Branch, P.O. Box 191367-4711, Tehran 191367-4711 (Iran, Islamic Republic of)]. E-mail: drm_khosravi@yahoo.com; Ganji, Masoud Taghi [Department of Applied Chemistry, Faculty of Chemistry, Islamic Azad University, North Tehran Branch, P.O. Box 191367-4711, Tehran 191367-4711 (Iran, Islamic Republic of)
2006-06-30
Dead Azolla filiculoides can remove Pb{sup 2+},Cd{sup 2+}, Ni{sup 2+} and Zn{sup 2+} corresponding to second-order kinetic model. The maximum adsorption capacity (Q {sub max}) to remove these metal ions by the alkali and CaCl{sub 2}/MgCl{sub 2}/NaCl (2:1:1, molar ratio) activated Azolla from 283 to 313 K was 1.431-1.272, 1.173-0.990, 1.365-1.198 and 1.291-0.981 mmol/g dry biomass, respectively. Q {sub max} to remove these heavy metals by the non-activated Azolla at the mentioned temperature range was obtained 1.131-0.977, 1.092-0.921, 1.212-0.931 and 1.103-0.923 mmol/g dry biomass, respectively. In order to remove these metal ions by the activated Azolla, the enthalpy change ({delta}H) was -4.403, -4.495, -4.557 and -4.365 kcal/mol and the entropy change ({delta}S) was 2.290, 1.268, 1.745 and 1.006 cal/mol K, respectively. While, to remove these metal ions by the non-activated Azolla, {delta}H was -3.685, -3.766, -3.967 and -3.731 kcal/mol and {delta}S was 2.440, 1.265, 1.036 and 0.933 cal/mol K, respectively. On the other hand, the living Azolla removed these heavy metals corresponding to first-order kinetic model. It was also shown that pH, temperature and photoperiod were effective both on the rate of Azolla growth and the rate of heavy metals uptake during 10 days. It was appeared the use of Ca(NO{sub 3}){sub 2} increased both Azolla growth rate and the rate of heavy metals uptake while the using KNO{sub 3} although increased Azolla growth rate but decreased the rate of heavy metals uptake.
Valorisation de Azolla spp, Moringa oleifera, son de riz, et de co ...
African Journals Online (AJOL)
SARAH
FAST)/ Université d'Abomey- .... la production de viande (Figueroa and Ly, 1990). ..... International Conference on Sustainable Food ... Azolla-Anabaena's behaviour in urban .... characteristics and consumer preference of.
International Nuclear Information System (INIS)
Hendrarti, Etty; Sopandie, Didy; Komarudin Idris; Sisworo, Elsje L
1998-01-01
The purpose of this experiment was to study the effect of an Azolla mat on rice growth, percentage of N-total, N derived from fertilizer and urea efficiency. The experiment used a factorial design which consists of 2 factors : the using of an Azolla mat and the doses of N fertilizer. The first factor comprised 2 levels, with (A1) and without an azolla mat (A0). The second factor comprised 4 levels, 0(N0), 30 (N1), 60(N2) and 90 kg N/ha(N3).Application of 15 N labeled Urea done to determine percentage N-derived from Urea efficiency , which was divided in 2 experiment series as follows : application Urea at planting (experiment I) and one month after planting (experiment II). The experiments were carried out in the green house of Agricultural Faculty of IPB and continued in the laboratory of BATAN. Parameters observed were plant height, number of tillers, number of panicles, number of grains/panicle, dry weight of grain, straw and percentage of empty grain. Result of the experiment showed that an Azolla mat, the doses of N fertilizer and interaction of both increased all the parameters observed yield, except for percentage of empathy grain, up to the dose of N fertilizer at 60 kg N/ha and decreased at the dose of N fertilizer at 90 kg N/ha. The treatment of Urea fertilizer doses resulted in a significant difference on the percentage of N- derived from Urea for both experiment, but not for the treatment of an Azolla mat and the interaction of both treatment. An azolla mat, N fertilizer and interaction of both did not result in a significantly difference on the percentage of total-N and Urea efficiency. The best treatment combination was treatment of an azolla mat and dose of Urea fertilizer of 60 kg N/ha. (author)
Khosravi, Morteza; Rakhshaee, Roohan; Ganji, Masuod Taghi
2005-12-09
Intact and treated biomass can remove heavy metals from water and wastewater. This study examined the ability of the activated, semi-intact and inactivated Azolla filiculoides (a small water fern) to remove Pb(2+), Cd(2+), Ni(2+) and Zn(2+) from the aqueous solution. The maximum uptake capacities of these metal ions using the activated Azolla filiculoides by NaOH at pH 10.5 +/- 0.2 and then CaCl(2)/MgCl(2)/NaCl with total concentration of 2 M (2:1:1 mole ratio) in the separate batch reactors were obtained about 271, 111, 71 and 60 mg/g (dry Azolla), respectively. The obtained capacities of maximum adsorption for these kinds of the pre-treated Azolla in the fixed-bed reactors (N(o)) were also very close to the values obtained for the batch reactors (Q(max)). On the other hand, it was shown that HCl, CH(3)OH, C(2)H(5)OH, FeCl(2), SrCl(2), BaCl(2) and AlCl(3) in the pre-treatment processes decreased the ability of Azolla to remove the heavy metals in comparison to the semi-intact Azolla, considerably. The kinetic studies showed that the heavy metals uptake by the activated Azolla was done more rapid than those for the semi-intact Azolla.
Dijkhuizen, Laura W; Brouwer, Paul; Bolhuis, Henk; Reichart, Gert-Jan; Koppers, Nils; Huettel, Bruno; Bolger, Anthony M; Li, Fay-Wei; Cheng, Shifeng; Liu, Xin; Wong, Gane Ka-Shu; Pryer, Kathleen; Weber, Andreas; Bräutigam, Andrea; Schluepmann, Henriette
2018-01-01
Dinitrogen fixation by Nostoc azollae residing in specialized leaf pockets supports prolific growth of the floating fern Azolla filiculoides. To evaluate contributions by further microorganisms, the A. filiculoides microbiome and nitrogen metabolism in bacteria persistently associated with Azolla ferns were characterized. A metagenomic approach was taken complemented by detection of N 2 O released and nitrogen isotope determinations of fern biomass. Ribosomal RNA genes in sequenced DNA of natural ferns, their enriched leaf pockets and water filtrate from the surrounding ditch established that bacteria of A. filiculoides differed entirely from surrounding water and revealed species of the order Rhizobiales. Analyses of seven cultivated Azolla species confirmed persistent association with Rhizobiales. Two distinct nearly full-length Rhizobiales genomes were identified in leaf-pocket-enriched samples from ditch grown A. filiculoides. Their annotation revealed genes for denitrification but not N 2 -fixation. 15 N 2 incorporation was active in ferns with N. azollae but not in ferns without. N 2 O was not detectably released from surface-sterilized ferns with the Rhizobiales. N 2 -fixing N. azollae, we conclude, dominated the microbiome of Azolla ferns. The persistent but less abundant heterotrophic Rhizobiales bacteria possibly contributed to lowering O 2 levels in leaf pockets but did not release detectable amounts of the strong greenhouse gas N 2 O. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
Arctic Ocean circulation during the anoxic Eocene Azolla event
Speelman, Eveline; Sinninghe Damsté, Jaap; März, Christian; Brumsack, Hans; Reichart, Gert-Jan
2010-05-01
The Azolla interval, as encountered in Eocene sediments from the Arctic Ocean, is characterized by organic rich sediments ( 4wt% Corg). In general, high levels of organic matter may be caused by increased productivity, i.e. extensive growth of Azolla, and/or enhanced preservation of organic matter, or a combination of both. Anoxic (bottom) water conditions, expanded oxygen minimum zones, or increased sedimentation rates all potentially increase organic matter preservation. According to plate tectonic, bathymetric, and paleogeographic reconstructions, the Arctic Ocean was a virtually isolated shallow basin, with one possible deeper connection to the Nordic Seas represented by a still shallow Fram Strait (Jakobsson et al., 2007), hampering ventilation of the Arctic Basin. During the Azolla interval surface waters freshened, while at the same time bottom waters appear to have remained saline, indicating that the Arctic was highly stratified. The restricted ventilation and stratification in concert with ongoing export of organic matter most likely resulted in the development of anoxic conditions in the lower part of the water column. Whereas the excess precipitation over evaporation maintained the freshwater lid, sustained input of Nordic Sea water is needed to keep the deeper waters saline. To which degree the Arctic Ocean exchanged with the Nordic Seas is, however, still largely unknown. Here we present a high-resolution trace metal record (ICP-MS and ICP-OES) for the expanded Early/Middle Eocene section capturing the Azolla interval from Integrated Ocean Drilling Program (IODP) Expedition 302 (ACEX) drilled on the Lomonosov Ridge, central Arctic Ocean. Euxinic conditions throughout the interval resulted in the efficient removal of redox sensitive trace metals from the water column. Using the sedimentary trace metal record we also constrained circulation in the Arctic Ocean by assessing the relative importance of trace metal input sources (i.e. fluvial, eolian, and
Alien and exotic Azolla in northern Iran | Hashemloian | African ...
African Journals Online (AJOL)
Azolla filiculoides a planktonic fern found floating on the surface of wetlands, ponds and rivers. Because of its ability to fix nitrogen through symbiotic cyanobacteria, it causes more rice production in paddy fields and is used as a green fertilizer. A. filiculoides was introduced from Philippine as a green fertilizer for rice crop to ...
Improvement Bio sorption of Heavy Metals from Industrial Wastewater Using Azolla
International Nuclear Information System (INIS)
Kotb, E.A.
2012-01-01
This study aims to improve the removal process which is vital for some heavy metals and natural radionuclides from industrial wastewater by bio sorption using living organisms with rapid growth as a trial to increase the efficient use of those organisms in the removal process is vital for the toxic elements. Bio sorption of heavy metal (Copper, Manganese, Iron, Zinc, Lead and Strontium) from industrial waste water (contaminated) with six different time periods for Azolla growth. The results indicate that Azolla plant able to on the absorption of ions of heavy elements and Sr and was up to the maximum absorption of most of the elements at a concentration of 50% of polluted water + 50% fresh water so we recommend using the plant Azolla as bio sorbent in the disposal and collection of heavy metals and radionuclides from industrial waste water and deal with it safely to humans and the environment. The results obtained confirm the ability of the fern to grow and absorb ion of heavy metal when mixed with industrial waste water and other sources of polluted water and act as bio filter. The optimum conditions for maximum removal of heavy metals were also determined. Study was conducted on recycling municipal wastewaters for cultivation of Azollamicrophylla biomass, which is used for inoculation into paddy fields as N bio fertilizer and has other applications as green manure,animal feed and bio filter.
International Nuclear Information System (INIS)
Sisworo, Elsje L.; Rasjid, Havid; Sisworo, Widjang H.; Wemay, Johannis; Djawanas, Amrin
1994-01-01
Data from three field experiments using 15 N labelled Azolla and urea as an N source have been used to determine the agronomical and physiological efficiency of the N-Azoll and N-Urea applied tolowland rice. In general physiological efficiency of N from N-sources applied was lower than the agronomical efficiency. It seems that the increase of N-rates would enhance the agronomical and physiological efficiency of N applied to lowland rice but on the other hand the efficiency of N derived from the applied N-source decreased. Azolla+inorganic N-fertilizer when applied to lowland rice could increase rice yield expresses in dry weight of grain and straw above the control plants. Applying Azolla+inorganic N-fertilizer in the farmer's field located in West Java and West Sumatera often showed higher yields compared to when applied with inorganic N-fertilizer alone although the latter has higher total N-rates. (author). 9 refs, 8 tabs, 5 figs
Investigation of Pb(II Removal from Synthetic Wastewater by Using Azolla Filiculoides Biomass
Directory of Open Access Journals (Sweden)
Davoud Balarak
2015-06-01
Full Text Available Background and Aim: Discharge of industrial wastewater containing Pb into the environment can have harmful effects in the live organisms. Therefore, Pb must be removed from polluted water using an effective method before being discharged into the environment. The purpose of the present study was to examine Pb removal using alga Azolla biomass. Materials and Methods: In this experimental study, removal of Pb(II was performed using Azolla biomass considering changes in time, pH, adsorbent dose, initial concentration of Pb and mixing speed. Experiments were performed in batch reactor in flasks on Shaker. , Atomic absorption spectrophotometry was used for Pb determination. All experiments were conducted in triplicate and the mean removal percent was reported. Finally, biosorption kinetic and equilibrium isotherms of adsorbent was investigated. Results: It was found that the higher removal efficiency of Pb occurred in pH 6 and aoptimum dsorbent dose 7 g/L. With increase in the initial concentration of Pb, removal efficincy decreased and with increasing of contact time and mixing speed,efficincy increased. Data also showed that the Langmuir isotherm and pseudo second-order kinetic are compliance. Conclusion: Azolla biomass is an efficient and low-cost adsorbent for removing of Pb (II from water and wastewater.
Application of Azolla for 2-Chlorophenol and 4-Chrorophenol Removal from Aqueous Solutions
Directory of Open Access Journals (Sweden)
Mohammad Ali Zazouli
2013-09-01
Full Text Available Background and purpose: The 2-chlorophenol (2-CP and 4-chlorophenol (4-CP are phenolic compounds which may have adverse effects on human and environment. Therefore, removing these compounds from water and wastewater is necessary. This study aims to analyze 2-CP and 4-CP removal by using Azolla filiculoides biomass. Materials & Methods: Azolla biomass was sun dried, crushed and sieved to particle sizes ranging 1-2 mm. Then it was treated with 0.1M HCl for 5h followed by washing with distilled water and it was used as adsorbent. The residues concentration of 2-CP and 4-CP was measured by spectrophotometer in λmax of 274 and 280 nm, respectively. Results: The solute removed increases as contact time rises. The equilibrium time for 2-CP and 4-CP is 90 and 75, respectively. The removal efficiency of 4-CP is more than 2-CP. An increase in initial concentration of both compounds can lead to decrease of their removal efficiency. The optimum pH to remove both compounds is 5. The equilibrium data matched best on Freundlich isotherm and the adsorption kinetic model follows pseudo-second model. Conclusion: The results indicated that Azolla is an effective adsorbent for removing 2-CP and 4-CP from water and wastewater.
Barke, J.
2010-01-01
The high abundances and cyclic distribution of remains of the freshwater fern Azolla in early middle Eocene sediments from the Arctic Ocean have previously been related to episodic surface water freshening, which was speculated to be orbitally modulated. Our integrated palynological and
Factors regulating nitrogenase activity and hydrogen evolution in Azolla-Anabaena symbiosis
Energy Technology Data Exchange (ETDEWEB)
Banerjee, M.; Kumar, A.; Kumar, H.D. (Banaras Hindu Univ., Varanasi (India). Dept. of Botany)
1989-01-01
Nitrogenase activity and H{sub 2} production capacity have been studied in intact Azolla plants. Under aerobic conditions the plants showed a C{sub 2}H{sub 2} reduction rate of 6.65 nmoles C{sub 2}H{sub 4} mg {sup -1} fresh weight in light at 48 h. Considerable activity was also present in the dark. Though H{sub 2} evolution was detected under aerobic conditions there was multifold stimulation under anaerobic conditions. There was no significant change in nitrogenase activity under anaerobic conditions. Increasing concentrations of O{sub 2} inhibited nitrogenase activity but 5% O{sub 2} proved stimulatory for H{sub 2} evolution in light. In the dark, there was a gradual stimulation in H{sub 2} evolution even up to 20% O{sub 2}. The addition of combined nitrogen sources, namely NH{sub 4}Cl or KNO{sub 3} (10 mM), resulted in complete inhibition of the C{sub 2}H{sub 2}-reduction activity within 48 h, but H{sub 2} evolution was not inhibited. Indeed, these combined nitrogen sources stimulated H{sub 2} evolution. Though nitrogenase activity was affected, the heterocyst frequency remained unaltered. Phosphate addition resulted in significant stimulation of nitrogenase and H{sub 2} evolution activity. These results suggest that nitrogenase and H{sub 2} evolution activity in Azolla are affected by a number of factors which show a differential effect on nitrogenase and H{sub 2} evolution. Furthermore, our results indicate the presence of a soluble reversible hydrogenase in Azolla. (author).
Uheda, Eiji; Maejima, Kazuhiro
2009-10-15
In the Azolla-Anabaena association, the host plant Azolla efficiently incorporates and assimilates ammonium ions that are released from the nitrogen-fixing cyanobiont, probably via glutamine synthetase (GS; EC 6.3.1.2) in hair cells, which are specialized cells protruding into the leaf cavity. In order to clarify the regulatory mechanism underlying ammonium assimilation in the Azolla-Anabaena association, Azolla plants were grown under an argon environment (Ar), in which the nitrogen-fixing activity of the cyanobiont was inhibited specifically and completely. The localization of GS in hair cells was determined by immunoelectron microscopy and quantitative analysis of immunogold labeling. Azolla plants grew healthily under Ar when nitrogen sources, such as NO(3)(-) and NH(4)(+), were provided in the growth medium. Both the number of cyanobacterial cells per leaf and the heterocyst frequency of the plants under Ar were similar to those of plants in a nitrogen environment (N(2)). In hair cells of plants grown under Ar, regardless of the type of nitrogen source provided, only weak labeling of GS was observed in the cytoplasm and in chloroplasts. In contrast, in hair cells of plants grown under N(2), abundant labeling of GS was observed in both sites. These findings indicate that specific inhibition of the nitrogen-fixing activity of the cyanobiont affects the localization of GS isoenzymes. Ammonium fixed and released by the cyanobiont could stimulate GS synthesis in hair cells. Simultaneously, the abundant GS, probably GS1, in these cells, could assimilate ammonium rapidly.
Gomes, Marcelo Pedrosa; de Brito, Júlio César Moreira; Carvalho Carneiro, Marília Mércia Lima; Ribeiro da Cunha, Mariem Rodrigues; Garcia, Queila Souza; Figueredo, Cleber Cunha
2018-01-01
We investigated the ability of the aquatic fern Azolla to take up ciprofloxacin (Cipro), as well as the effects of that antibiotic on the N-fixing process in plants grown in medium deprived (-N) or provided (+N) with nitrogen (N). Azolla was seen to accumulate Cipro at concentrations greater than 160 μg g -1 dry weight when cultivated in 3.05 mg Cipro l -1 , indicating it as a candidate for Cipro recovery from water. Although Cipro was not seen to interfere with the heterocyst/vegetative cell ratios, the antibiotic promoted changes with carbon and nitrogen metabolism in plants. Decreased photosynthesis and nitrogenase activity, and altered plant's amino acid profile, with decreases in cell N concentrations, were observed. The removal of N from the growth medium accentuated the deleterious effects of Cipro, resulting in lower photosynthesis, N-fixation, and assimilation rates, and increased hydrogen peroxide accumulation. Our results shown that Cipro may constrain the use of Azolla as a biofertilizer species due to its interference with nitrogen fixation processes. Copyright © 2017 Elsevier Ltd. All rights reserved.
Application of AzollaFiliculoides Biomass in Acid Black 1 Dye Adsorption from Aqueous Solution
Directory of Open Access Journals (Sweden)
Mohammad Ali Zazouli
2014-09-01
Full Text Available Background and purpose: The textile dyes are considered as important pollutants due to the toxicity on human and environment. Therefore, the dye removal from industrial effluents is necessary. This study evaluates the ability of Azolla for the adsorption of acid black 1 (AB1 dye from aqueous solution. Materials and Methods: This was an experimental-laboratory study. The Azolla biomass was sun dried, crushed and sieved to particle sizes in the range of 1-2 mm. Then, it treated with 0.1 M HCl for 5 h, followed by washing with distilled water, and it used as an adsorbent. The effect of study parameter was investigated, and the residues AB1 concentration was measured by DR2800 spectrophotometer at in λmax = 622 nm. Results: The results indicated that the efficiency of AB1 adsorption decreased with increased initial dye concentration. It increased with increased contact time and adsorbent. The highest adsorption efficiency was occurred at pH = 2. The equilibrium data were the best fitted on Langmuir isotherm and pseudo-second-order kinetic model. Conclusion: The Azolla could present high ability in dye removal. Therefore, it can be used as inexpensive and effective adsorbent in textile effluent treatment.
OS, Ozi Nurhasanah; Yetti, Husna; Ariani, Erlida
2015-01-01
This research aimed to look the influence of the combination of green fertilizer Azolla pinnata with guano toward the growth and production of pakchoy and to obtain the best treatment from Azolla pinnata with guano toward pakchoy. This research was conducted at the experimental farm of Farming Faculty of Riau University. This research was accomplished during 3 months that was from June to August 2014. It was carried out experimentally with Group Random Design (GRD), the treatment given which ...
Dynamics of N-NH4 +, N-NO3 -, and total soil nitrogen in paddy field with azolla and biochar
Dewi, W. S.; Wahyuningsih, G. I.; Syamsiyah, J.; Mujiyo
2018-03-01
Nitrogen (N) is one of macronutrients which is dynamic in the soil and becomes constraint factor for rice crops. The addition of nitrogen fertilizers and its absorption in paddy field causes the dynamics of nitrogen, thus declines of N absorption efficiency. The aim of this research is to know influence Azolla, biochar and different varieties application on N-NH4 +, N-NO3 -, and total soil N in paddy field. This research was conducted in a screen house located in Jumantono Laboratory, Faculty of Agriculture, Universitas Sebelas Maret (UNS) with altitude 170 m asl from April to June 2016. Treatment factors that were examined consisted of azolla (0 and 10 tons/ha), biochar (0 and 2 tons/ha), and rice varieties (Cisadane, Memberamo, Ciherang, IR64). The results of this research showed that there was no interaction between azolla, biochar and varieties. Nevertheless, azolla treatment with dose of 10 tons/ha increased soil NH4 + content (41 days after planting, DAP) by 13.4% but tend to decrease at 70 and 90 DAP. Biochar treatment with dose of 2 ton/ha increases NO3 - soil content (70 DAP) by 1.7% but decreases total N soil by 5.8% (41 DAP) and 4.7% (90 DAP). Different rice varieties generated different soil NH4 + content (41 DAP) and rice root volume. Cisadane variety can increase soil NH4 + content (41 DAP) by 52.08% and root volume by 51.80% (90 DAP) compared with Ciherang variety. Organic rice field management with azolla and biochar affects the availability of N in the soil and increase N absorption efficiency through its role in increasing rice root volume.
Orbitally forced Azolla blooms and Middle Eocene Arctic hydrology: Clues from palynology
Barke, J.; Abels, H.A.; Sangiorgi, F.; Greenwood, D.R.; Sweet, A.R.; Donders, T.; Reichart, G.-J.; Lotter, A.F.; Brinkhuis, H.
2011-01-01
The high abundances and cyclic distribution of remains of the freshwater fern Azolla in early-Middle Eocene sediments from the Arctic Ocean have previously been related to episodic surface-water freshening, which was speculated to be orbitally modulated. Our integrated palynological and
Orbitally forced Azolla blooms And Middle Eocene Arctic hydrology: Clues from palynology
Barke, J.; Abels, H.A.; Sangiorgi, F.; Greenwood, D.R.; Sweet, A.R.; Donders, T.; Reichart, G.-J.; Lotter, A.F.; Brinkhuis, H.
2011-01-01
The high abundances and cyclic distribution of remains of the freshwater fern Azolla in early-Middle Eocene sediments from the Arctic Ocean have previously been related to episodic surface-water freshening, which was speculated to be orbitally modulated. Our integrated palynological and
Alimentation des lapins ( Oryctolagus cuniculus L.) à base de Azolla ...
African Journals Online (AJOL)
Les systèmes intégrés de production constituent l'une des voies essentielles pour une agriculture durable. Cette étude a pour but d'évaluer l'effet d'une alimentation à base de Azolla filiculoïdes, Elaeis guineensis, Ipomoea aquatica et Panicum maximum sur les performances zootechniques des lapins et le potentiel nutritif ...
Limited Multiplication of Symbiotic Cyanobacteria of Azolla spp. on Artificial Media
Tang, L. F.; Watanabe, I.; Liu, C. C.
1990-01-01
We examined various media and conditions to isolate symbiotic cyanobacteria from the leaf cavities of Azolla spp. Cyanobacteria survived and multiplied to a limited extent on a medium with fructose, Casamino Acids, yeast extract, and NaNO3 under 1% O2. These cyanobacteria were antigenically identical to the endosymbionts. Images PMID:16348366
Directory of Open Access Journals (Sweden)
Karina Dufech Esteves
2008-08-01
Full Text Available The total supply of fish available for human consumption will depend more of the expansion of low trophy level fish farming than of wild-caught fish. Aquatic plants used at treatment of aquaculture wastewater have been showed like an alternative to exclusive diet feed. The aquatic fern, Azolla filiculoides is an example with high level of protein. Consequently, more research on feed requirements of herbivorous fish is required. The aim of this study was to evaluate the growth performance and feed efficiency of juvenile grass carp (Ctenopharyngodon idella fed with three different diets using low lipid feed and water fern (Azolla filiculoides. The experiment was carried out in nine (9 tanks of 300 L capacity with three fish per tank (initial body weight = 55,43g. Feeding rate was 2.5% Fish were fed on two times a day with three treatments (R= Diet/Azolla on dry weight R= 2.5; R = 5 and R= 10. The specific growth rate (SGR = 1.39%, daily growth gain (DGG = 1.06 g / day and were significantly (p A oferta de pescado para o consumo humano dependerá mais da expansão do cultivo de peixes que se alimentam dos primeiros níveis tróficos do que daqueles oriundos da pesca extrativa. Plantas aquáticas usadas em fitotratamento de efluentes de aquacultura vêm sendo referidas como uma alternativa alimentar ao uso exclusivo de rações. A Azolla filiculoides é uma pteridófita que apresenta alto nível protéico. Assim, pesquisas sobre as exigências nutricionais de espécies herbívoras são necessárias. O objetivo principal deste estudo foi avaliar o crescimento e eficiência alimentar de juvenis de carpa capim (Ctenopharyngodon idella alimentadas com três relações (R entre ração com baixo teor lipídico e a planta aquática in natura (Azolla filiculoides. O experimento foi conduzido em nove reservatórios com capacidade de 300L e três indivíduos por unidade (Peso Inicial = 53,43g. A taxa alimentar diária foi de 2,5%, dividida em duas refei
Evaluating the combined effects of pretilachlor and UV-B on two Azolla species.
Prasad, Sheo Mohan; Kumar, Sushil; Parihar, Parul; Singh, Anita; Singh, Rachana
2016-03-01
The present study assessed the comparative responses of two agronomic species of Azolla (A.microphylla and A. pinnata) exposed to man-made and natural stressors by evaluating biomass accumulation, pigments (chlorophyll a and b and carotenoid contents), photosynthetic activity and nitrogen metabolism. The study was carried out in field where two species of Azolla were cultured and treated with various concentrations (5, 10 and 20 μg ml(-1)) of herbicide; pretilachlor [2-chloro-2,6-diethyl-N-(2-propoxyethyl) acetanilide] and enhanced levels (UV-B1: ambient +2.2 kJ m(-2) day(-1) and UV-B2: ambient +4.4 kJ m(-2) day(-1)) of UV-B, alone as well as in combination. Biomass accumulation, photosynthetic pigments; chlorophyll a, b and carotenoids, photosynthetic oxygen yield and photosynthetic electron transport activities i.e. photosystem II (PS II) and photosystem I (PS I) in both the species declined with the increasing doses of pretilachlor and UV-B radiation, which further declined when applied in combination. The lower doses (5 and 10 μg ml(-1)) of pretilachlor and UV-B (UV-B1 and UV-B2) alone, damaged mainly the oxidation side of PS II, whereas higher dose (20 μg ml(-1)) of pretilachlor alone and in combination with UV-B1 and UV-B2 caused damage to PS II reaction centre and beyond this towards the reduction side. A significant enhancement in respiration was also noticed in fronds of both the Azolla species following pretilachlor and UV-B treatment, hence indicating strong damaging effect. The nitrate assimilating enzymes - nitrate reductase and nitrite reductase and ammonium assimilating enzymes - glutamine synthetase and glutamate synthase were also severely affected when treated either with pretilachlor and/or UV-B while glutamate dehydrogenase exhibited a stimulatory response. The study suggests that both the species of Azolla showed considerable damage under pretilachlor and UV-B treatments alone, however, in combination the effect was more intense. Further, in
Azolla pinnata growth performance in different water sources.
Nordiah, B; Harah, Z Muta; Sidik, B Japar; Hazma, W N Wan
2012-07-01
Azolla pinnata R.Br. growth performance experiments in different water sources were conducted from May until July 2011 at Aquaculture Research Station, Puchong, Malaysia. Four types of water sources (waste water, drain water, paddy field water and distilled water) each with different nutrient contents were used to grow and evaluate the growth performance of A. pinnata. Four water sources with different nutrient contents; waste, drain, paddy and distilled water as control were used to evaluate the growth performance of A. pinnata. Generally, irrespective of the types of water sources there were increased in plant biomass from the initial biomass (e.g., after the first week; lowest 25.2% in distilled water to highest 133.3% in drain water) and the corresponding daily growth rate (3.61% in distilled water to 19.04% in drain water). The increased in biomass although fluctuated with time was consistently higher in drain water compared to increased in biomass for other water sources. Of the four water sources, drain water with relatively higher nitrate concentration (0.035 +/- 0.003 mg L(-l)) and nitrite (0.044 +/- 0.005 mg L(-1)) and with the available phosphate (0.032 +/- 0.006 mg L(-1)) initially provided the most favourable conditions for Azolla growth and propagation. Based on BVSTEP analysis (PRIMER v5), the results indicated that a combination of more than one nutrient or multiple nutrient contents explained the observed increased in biomass of A. pinnata grown in the different water sources.
The Contribution of Azolla and Urea in Lowland Rice Growth Production for Three Consecutive Seasons
International Nuclear Information System (INIS)
E-L-Sisworo; H-Rasjid; Haryanto; Idawati
2008-01-01
Three field experiments have been carried out in three consecutive seasons namely wet season (120 days), dry season (120 days), wet season (120 days) at Pusakanegara. The purpose of this experiment is to test whether urea combined with Azolla could increase lowland rice production and soil quality. The experimental plots have a size of 20 m 2 and in each experimental plot an isotope plot was placed with a size of 1 m 2 . The isotope plots were used to apply labeled 15 N urea. Treatments conducted were lowland varieties: Atomita I (V1) and IR-64 (V2); several levels of urea and Azolla : Pu1 urea-tablets + an Azolla cover (Azc), Pu2 = urea-tablets + Azolla incorporated (Azi ), Pu3 = urea-prill + Azc , Pu4 = urea-prill + Azi; seasons : Ss 1 = wet season, Ss2 = dry season, Ss3 = wet season. The experimental design used was a factorial experiment in a Randomized Block Design, where each treatment was replicated four times. Parameters used were, dry weight of straw (St), grain (G), plant (P1 = St + G) in kg/ha; N-total percentage (% N-to) of St and G, percentage N-derived from urea + Az (% N-Pu) of St and G; percentage N-derived from soil (% N-S) of St and G; uptake of N-Pu and N-S in St, G and P1. Some results of these experiment were, N-Pu play a less important role in growth of lowland crop expressed in several parameters compared to N-soil. The form of N-urea in tablets are superior to that the form of urea in prills. For the last product of lowland rice which is grain obviously V1 (Atomita-1) is better than V2 (IR-64) expressed in t/ha. The progress of seasons showed clearly that there is an N accumulation which might be the increase of soil organic matter (SOM) and that means there is an increase in soil quality in the view point of N. (author)
The Contribution of Azolla and Urea in Lowland Rice Growth Production for Three Consecutive Seasons
Directory of Open Access Journals (Sweden)
EL. Sisworo
2008-01-01
Full Text Available Three field experiments have been carried out in three consecutive seasons namely wet season (120 days, dry season (120 days, wet season (120 days at Pusakanegara. The purpose of this experiment is to test whether urea combined with Azolla could increase lowland rice production and soil quality. The experimental plots have a size of 20 m2 and in each experimental plot an isotope plot was placed with a size of 1 m2. The isotope plots were used to apply labeled 15N urea. Treatments conducted were lowland varieties: Atomita I (V1 and IR-64 (V2; several levels of urea and Azolla : Pu1 = urea-tablets + an Azolla cover (Azc, Pu2 = urea-tablets + Azolla incorporated (Azi , Pu3 = urea-prill + Azc , Pu4 = urea-prill + Azi; seasons : Ss 1 = wet season, Ss2 = dry season, Ss3 = wet season. The experimental design used was a factorial experiment in a Randomized Block Design, where each treatment was replicated four times. Parameters used were, dry weight of straw (St, grain (G, plant (P1 = St + G in kg/ha; N-total percentage (% N-to of St and G, percentage N-derived from urea + Az (% N-Pu of St and G; percentage N-derived from soil (% N-S of St and G; uptake of N-Pu and N-S in St, G and P1. Some results of these experiment were, N-Pu play a less important role in growth of lowland crop expressed in several parameters compared to N-soil. The form of N-urea in tablets are superior to that the form of urea in prills. For the last product of lowland rice which is grain obviously V1 (Atomita-1 is better than V2 (IR-64 expressed in t/ha. The progress of seasons showed clearly that there is an N accumulation which might be the increase of soil organic matter (SOM and that means there is an increase in soil quality in the view point of N
Performance of Azolla caroliniana Willd. and Salvinia auriculata Aubl. on fish farming effluent.
Toledo, J J; Penha, J
2011-02-01
The increasing release of untreated fish farming effluents into water courses that flow to the Pantanal wetlands in Mato Grosso (Brazil) may drive this ecosystem to eutrophication. Therefore, the growth of Azolla caroliniana Willd. and Salvinia auriculata Aubl. in fish farming effluent and their effect on its quality were evaluated for 48 days in a greenhouse. The results were compared to those obtained in a nutrient rich solution (Hoagland ½ medium). Azolla caroliniana showed lower relative growth rate in fish farming effluent (0.020 d-1) than in Hoagland ½ medium (0.029 d-1). However, S. auriculata grew slightly better in fish farming effluent (0.030 d-1) than in Hoagland ½ medium (0.025 d-1). The species apparently contributed to reduce nitrate and phosphate concentration in Hoagland ½ medium. However, in fish farming effluent, only electrical conductivity and pH were reduced by plants compared to the control without plants. Thus, A. caroliniana and S. auriculata show low potential for improving effluent quality.
Mishra, Deepesh Bharat; Roy, Debashis; Kumar, Vinod; Bhattacharyya, Amitav; Kumar, Muneendra; Kushwaha, Raju; Vaswani, Shalini
2016-02-01
The present study was conducted to see the effect of feeding different levels of Azolla meal on blood biochemicals, hematology and immunocompetence traits of Chabro chicken. The study was conducted on 160 Chabro chicks, which were randomly divided into four treatment groups each with four replicates of 10 birds. The first treatment (T1) served as a control in which basal diets was offered without Azolla supplementation while in T2, T3, and T4 groups, basal diet was replaced with Azolla meal at 5%, 7.5%, and 10% levels, respectively. A feeding trial was conducted upto 8 weeks. At the last week of trial, blood samples were collected randomly from one bird of each replicate and plasma was separated to estimate certain biochemical parameters, some blood metabolites, minerals and enzymes like alanine aminotransferase and aspartate aminotransferase (AST). Hematological parameters such as hemoglobin, packed cell volume, total leukocytes count and differential leukocytes count were estimated in fresh blood just after collection. The humoral immune response was measured against sheep red blood cells,and cell-mediated immune response was measured against phyto hemagglutinin lectin from Phaseolus vulgaris (PHA-P). The study showed that hematological profile of the Chabro bird was not affected by any treatment except heterophil and lymphocyte which was found higher in T2 and T3 groups and eosinophil was found higher in a T3 group than control. Blood glucose, creatinine, cholesterol, total protein, albumin, uric acid, and triglycerides were found similar in all the groups and within the normal values for broiler chicken. Liver enzymes and macro mineral content in blood were found similar in all the treatment groups and within normal physiological range. Although AST was found higher in 10% replacement group than control, the value was within normal range for broiler chicken. Although antibody titer was found similar in all the experimental groups in the present study, cell
Directory of Open Access Journals (Sweden)
Deepesh Bharat Mishra
2016-02-01
Full Text Available Aim: The present study was conducted to see the effect of feeding different levels of Azolla meal on blood biochemicals, hematology and immunocompetence traits of Chabro chicken. Materials and Methods: The study was conducted on 160 Chabro chicks, which were randomly divided into four treatment groups each with four replicates of 10 birds. The first treatment (T1 served as a control in which basal diets was offered without Azolla supplementation while in T2, T3, and T4 groups, basal diet was replaced with Azolla meal at 5%, 7.5%, and 10% levels, respectively. A feeding trial was conducted upto 8 weeks. At the last week of trial, blood samples were collected randomly from one bird of each replicate and plasma was separated to estimate certain biochemical parameters, some blood metabolites, minerals and enzymes like alanine aminotransferase and aspartate aminotransferase (AST. Hematological parameters such as hemoglobin, packed cell volume, total leukocytes count and differential leukocytes count were estimated in fresh blood just after collection. The humoral immune response was measured against sheep red blood cells,and cell-mediated immune response was measured against phyto hemagglutinin lectin from Phaseolus vulgaris (PHA-P. Results: The study showed that hematological profile of the Chabro bird was not affected by any treatment except heterophil and lymphocyte which was found higher in T2 and T3 groups and eosinophil was found higher in a T3 group than control. Blood glucose, creatinine, cholesterol, total protein, albumin, uric acid, and triglycerides were found similar in all the groups and within the normal values for broiler chicken. Liver enzymes and macro mineral content in blood were found similar in all the treatment groups and within normal physiological range. Although AST was found higher in 10% replacement group than control, the value was within normal range for broiler chicken. Although antibody titer was found similar in all
UV-B effect on constituents of Azolla caroliniana.
Ibrahim, Mohamed M; Mostafa, Eazaz M
2007-01-01
Changes in growth and ultrastructure of Azolla caroliniana in response to elevated UV-B radiation were investigated. Exposure of plants to UV-B radiation for 1, 8, 16, 24 and 48 h exhibited a significant decrease in biomass and relative growth rate. This decrease resulted in an increase in doubling time over the control. Also, Chl a and b contents were significantly decreased especially after 16 h. The reduction was accompanied by a decrease in 5-aminolaevulinic acid content (precursor of chlorophyll). On the other hand, contents of carotenoid and UV-absorbing phenolic compounds (flavonoids and anthocyanins) were increased.
De, Arnab Kumar; Ghosh, Arijit; Debnath, Subhas Chandra; Sarkar, Bipul; Saha, Indraneel; Adak, Malay Kumar
2018-06-05
The present work is emphasised with the herbicidal tolerance of Azolla pinnata R.Br. and its modulation with TiO 2 nano-particle. Both carbohydrate and nitrogen metabolism were effected with 2,4-D as herbicide and in few cases TiO 2 -NP had recovered few detrimental effects. From the nutrient status in Azolla it recorded the recovery of nitrogen as well as potassium by TiO 2 -NP but not in case of phosphorus. However, a conversion of nitrate to ammonium was more induced by TiO 2 -NP under herbicidal toxicity. Similar results were obtained for inter-conversion of amino acid-nitrate pool, but no changes with glutamine synthase activity with TiO 2 -NP. Initially, the effects of 2,4-D was monitored with changes of chlorophyll content but had not been recovered with nanoparticle. Photosynthetic reserves expressed as both total and reducing sugar were insensitive to TiO 2 -NP interference but activity of soluble and wall bound invertase was in reverse trend as compared to control. The 2,4-D mediated changes of redox and its oxidative stress was ameliorated in plants with over expressed ADH activity. As a whole the Azolla bio system with TiO 2 supplementation may be useful in sustenance against 2,4-D toxicity through recovery of nitrogen metabolism. Thus, Azolla-TiO 2 -NP bio system would be realised to monitor the herbicidal toxicity in soil and its possible bioremediation.
Temmink, Ralph J M; Harpenslager, Sarah F; Smolders, Alfons J P; van Dijk, Gijs; Peters, Roy C J H; Lamers, Leon P M; van Kempen, Monique M L
2018-03-13
Azolla spp., a water fern often used for phytoremediation, is a strong phosphorus (P) accumulator due to its high growth rate and N 2 fixing symbionts (diazotrophs). It is known that plant growth is stimulated by P, but the nature of the interactive response of both symbionts along a P gradient, and related changes in growth-limiting factors, are unclear. We determined growth, and N and P sequestration rates of Azolla filiculoides in N-free water at different P concentrations. The growth response appeared to be biphasic and highest at levels ≥10 P µmol l -1 . Diazotrophic N sequestration increased upon P addition, and rates were three times higher at high P than at low P. At 10 µmol P l -1 , N sequestration rates reached its maximum and A. filiculoides growth became saturated. Due to luxury consumption, P sequestration rates increased until 50 µmol P l -1 . At higher P concentrations (≥50 µmol l -1 ), however, chlorosis occurred that seems to be caused by iron- (Fe-), and not by N-deficiency. We demonstrate that traits of the complete symbiosis in relation to P and Fe availability determine plant performance, stressing the role of nutrient stoichiometry. The results are discussed regarding Azolla's potential use in a bio-based economy.
Brouwer, Paul; Schluepmann, Henriette; Nierop, Klaas Gj; Elderson, Janneke; Bijl, Peter K; van der Meer, Ingrid; de Visser, Willem; Reichart, Gert-Jan; Smeekens, Sjef; van der Werf, Adrie
2018-03-24
Since available arable land is limited and nitrogen fertilizers pollute the environment, cropping systems ought to be developed that do not rely on them. Here we investigate the rapidly growing, N 2 -fixing Azolla/Nostoc symbiosis for its potential productivity and chemical composition to determine its potential as protein feed. In a small production system, cultures of Azolla pinnata and Azolla filiculoides were continuously harvested for over 100 days, yielding an average productivity of 90.0-97.2 kg dry weight (DW) ha -1 d -1 . Under ambient CO 2 levels, N 2 fixation by the fern's cyanobacterial symbionts accounted for all nitrogen in the biomass. Proteins made up 176-208 g kg -1 DW (4.9 × total nitrogen), depending on species and CO 2 treatment, and contained more essential amino acids than protein from soybean. Elevated atmospheric CO 2 concentrations (800 ppm) significantly boosted biomass production by 36-47%, without decreasing protein content. Choice of species and CO 2 concentrations further affected the biomass content of lipids (79-100 g kg -1 DW) and (poly)phenols (21-69 g kg -1 DW). By continuous harvesting, high protein yields can be obtained from Azolla cultures, without the need for nitrogen fertilization. High levels of (poly)phenols likely contribute to limitations in the inclusion rate of Azolla in animal diets and need further investigation. © 2018 The Authors. Journal of the Science of Food and Agriculture published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. © 2018 The Authors. Journal of the Science of Food and Agriculture published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry.
Tammam, A A; Mostafa, E M
2012-06-01
The mechanisms by which Azolla caroliniana respond to salt stress in absence and presence of nitrate is investigated. Screening of amino acid and differential display is used to compare overall differences in gene expression between salinity-stressed and unstressed Azolla caroliniana by quantitative reverse transcriptase polymerase chain reaction (RT-PC R). Results showed that under saline conditions, aspartic acid, glutamic acid, alanine and leucine were the amino acids found to be abundant in Azolla caroliniana, accounting for 11.26%, 8.66%, 9.43%, and 12.36%, respectively. Following salinity stress, a decrease in free glutamate concomitant with a parallel decrease in free proline was indeed evident. Interaction between nitrate and salinity stress increased proline content significantly. By screening a cDNA library, we have identified protein products by homology with known proteins. The RNA transcripts encoding protein influencing secondary metabolites and vacuolar Na+/H+ antiporter that facilitate the transport system. The databasematched under interaction of nitrate and 50 mM NaCl were associated with wall biosynthesis, disease resistance, metabolite transport and protein regulator, other gene for metabolism of steroids and secondary transport. Results obtained from this research could represent a key step in understanding the molecular mechanism of salt tolerance of Azolla caroliniana in the presence and absence of nitrate.
Energy Technology Data Exchange (ETDEWEB)
Jain, S K; Gujral, G S; Jha, N K; Vasudevan, P [Indian Inst. of Tech., New Delhi (India)
1992-01-01
The absorption of iron, copper, cadmium, nickel, lead, zinc, manganese and cobalt by Azolla pinnata R.Br and Lemna minor L., and subsequent utilization of this biomass for production of biogas (methane), have been investigated. Iron or manganese did not have any toxic effect on the anaerobic fermentation of Azolla and Lemna, while copper, cobalt, lead and zinc showed toxicity. At low concentrations cadmium and nickel showed a favourable effect on the rate of biogas production and its methane content, but with increase in concentrations,rate of biogas production and methane content decreased. However, although there was this decrease in biogas production and methane content, the methane content of biogas was still higher than that which was obtained from non-contaminated biomass. (author).
Cohen, Michael F; Gurung, Sushma; Birarda, Giovanni; Holman, Hoi-Ying N; Yamasaki, Hideo
2015-01-01
In the genus Azolla rapid abscission of roots from floating fronds occurs within minutes in response to a variety of stresses, including exposure to nitrite. We found that hydrogen peroxide, though itself not an inducer of root abscission, modulates nitrite-induced root abscission by Azolla pinnata in a dose-dependent manner, with 2 mM H2O2 significantly diminishing the responsiveness to 2 mM NaNO2, and 10 mM H2O2 slightly enhancing it. Hypoxia, which has been found in other plants to result in autogenic production of H2O2, dramatically stimulated root abscission of A. pinnata in response to nitrite, especially for plants previously cultivated in medium containing 5 mM KNO3 compared to plants cultivated under N2-fixing conditions without combined nitrogen. Plants, including Azolla, produce the small signaling molecule nitric oxide (NO) from nitrite using nitrate reductase. We found Azolla plants to display dose-dependent root abscission in response to the NO donor spermine NONOate. Treatment of plants with the thiol-modifying agents S-methyl methanethiosulfonate or glutathione inhibited the nitrite-induced root abscission response. Synchrotron radiation-based Fourier transform infrared spectromicroscopy revealed higher levels of carbonylation in the abscission zone of dropped roots, indicative of reaction products of polysaccharides with potent free radical oxidants. We hypothesize that metabolic products of nitrite and NO react with H2O2 in the apoplast leading to free-radical-mediated cleavage of structural polysaccharides and consequent rapid root abscission.
Directory of Open Access Journals (Sweden)
Michael F Cohen
2015-07-01
Full Text Available In the genus Azolla rapid abscission of roots from floating fronds occurs within minutes in response to a variety of stresses, including exposure to nitrite. We found that hydrogen peroxide, though itself not an inducer of root abscission, modulates nitrite-induced root abscission by Azolla pinnata in a dose-dependent manner, with 2 mM H2O2 significantly diminishing the responsiveness to 2 mM NaNO2, and 10 mM H2O2 slightly enhancing it. Hypoxia, which has been found in other plants to result in autogenic production of H2O2, dramatically stimulated root abscission of A. pinnata in response to nitrite, especially for plants previously cultivated in medium containing 5 mM KNO3 compared to plants cultivated under N2-fixing conditions without combined nitrogen. Plants, including Azolla, produce the small signaling molecule nitric oxide (NO from nitrite using nitrate reductase. We found Azolla plants to display dose-dependent root abscission in response to the NO donor spermine NONOate. Treatment of plants with the thiol-modifying agents S-methyl methanethiosulfonate or glutathione inhibited the nitrite-induced root abscission response. Synchrotron radiation-based Fourier transform infrared (SR-FTIR spectromicroscopy revealed higher levels of carbonylation in the abscission zone of dropped roots, indicative of reaction products of polysaccharides with potent free radical oxidants. We hypothesize that metabolic products of nitrite and NO react with H2O2 in the apoplast leading to free-radical-mediated cleavage of structural polysaccharides and consequent rapid root abscission.
Cultivation of Azolla microphylla biomass on secondary-treated Delhi municipal effluents
Energy Technology Data Exchange (ETDEWEB)
Arora, A.; Saxena, S. [Indian Agricultural Research Institute, New Delhi (India). Centre for Conservation of Blue Green Algae
2005-07-01
Study was conducted on recycling municipal wastewaters for cultivation of Azolla microphylla biomass, which is used for inoculation into paddy fields as N biofertiliser and has other applications as green manure, animal feed and biofilter. Secondary-treated municipal wastewaters were collected from Wazirabad sewage treatment plant in New Delhi during all four seasons and tested for reactive P and heavy metal content. The reactive P levels in effluents ranged between 1-2 ppm and levels of heavy metals like Cd, Pb, Ni, Zn, Fe and Mn were well below permissible limits. A. microphylla was grown in sewage effluents and its dilutions prepared with tapwater. It showed good growth potential on sewage effluents. Doubling times during September and December months compared well with those on Espinase and Watanabe (E and W) medium and tapwater. Dried Azolla biomass produced on sewage waters did not show presence of toxic heavy metals Cd, Cr and Pb. However, levels of P in dried biomass cultivated on sewage effluents were lower as compared to those from E and W medium and tapwater. The biomass produced can be used for inoculating paddy fields or for other applications and polished wastewaters can be recycled for irrigation purposes. (author)
Performance of Azolla caroliniana Willd. and Salvinia auriculata Aubl. on fish farming effluent
Directory of Open Access Journals (Sweden)
JJ. Toledo
Full Text Available The increasing release of untreated fish farming effluents into water courses that flow to the Pantanal wetlands in Mato Grosso (Brazil may drive this ecosystem to eutrophication. Therefore, the growth of Azolla caroliniana Willd. and Salvinia auriculata Aubl. in fish farming effluent and their effect on its quality were evaluated for 48 days in a greenhouse. The results were compared to those obtained in a nutrient rich solution (Hoagland ½ medium. Azolla caroliniana showed lower relative growth rate in fish farming effluent (0.020 d-1 than in Hoagland ½ medium (0.029 d-1. However, S. auriculata grew slightly better in fish farming effluent (0.030 d-1 than in Hoagland ½ medium (0.025 d-1. The species apparently contributed to reduce nitrate and phosphate concentration in Hoagland ½ medium. However, in fish farming effluent, only electrical conductivity and pH were reduced by plants compared to the control without plants. Thus, A. caroliniana and S. auriculata show low potential for improving effluent quality.
Energy Technology Data Exchange (ETDEWEB)
Rozen, A.; Tel-Or, E.
1986-01-01
Sugar supported activities of H/sub 2/ production and C/sub 2/H/sub 2/ reduction were characterized in axenic cell cultures of the cyanobiont Anabaena azollae isolated from the water fern Azolla filiculoides. Fructose was found to be the favoured substrate, enhancing activities in both the light and the dark even at relatively low concentrations of 0.5-1.0 mM. Higher concentrations of sucrose, (10-20mM) also supported H/sub 2/ production and C/sub 2/H/sub 2/ reduction, while glucose was less effective. Levels of H/sub 2/ production were always lower than those of C/sub 2/H/sub 2/ reduction. 13 references.
Energy Technology Data Exchange (ETDEWEB)
Carvalho, E.F. de [Acre Univ., Rio Branco, AC (Brazil); Lopes, N.F. [Vicosa Univ., MG (Brazil). Dept. de Biologia Vegetal
1994-02-01
Growth and solar energy conversion were studied in three Azolla species grown under four levels (30, 50, 70 and 100%) of solar radiation incidence under outdoor conditions. Under full sunlight, the specie A. microphylla showed higher crop growth rate, relative growth rate, net assimilation rate and efficiency of solar energy conversion than the other ones. (author). 8 figs., 23 refs.
Collinson, Margaret E.; van Konijnenburg-van Cittert, Johanna H.A.; Marone, Federica; Brain, Anthony P.R.
Azolla primaeva (Penhallow) Arnold fertile whole plants from the lower Eocene of Driftwood Creek, Canada have been examined using LM, SEM, TEM and SRXTM methods on hand specimens and sieved residues. The new data have resulted in an emended diagnosis. The megaspore is partly covered by filosum and
Crowdfunding the Azolla fern genome project: a grassroots approach.
Li, Fay-Wei; Pryer, Kathleen M
2014-01-01
Much of science progresses within the tight boundaries of what is often seen as a "black box". Though familiar to funding agencies, researchers and the academic journals they publish in, it is an entity that outsiders rarely get to peek into. Crowdfunding is a novel means that allows the public to participate in, as well as to support and witness advancements in science. Here we describe our recent crowdfunding efforts to sequence the Azolla genome, a little fern with massive green potential. Crowdfunding is a worthy platform not only for obtaining seed money for exploratory research, but also for engaging directly with the general public as a rewarding form of outreach.
Distribution of Azolla filiculoides Lam. (Azollaceae in Poland
Directory of Open Access Journals (Sweden)
Ewa Szczęśniak
2011-01-01
Full Text Available Azolla filiculoides has been an ephemeral plant in Poland since the end of the 20th century. In the last 15 years this species appeared in 5 locations in south-west Poland. Habitat and plants of two populations became destroyed, three other still exist. A. filiculoides occurs in eutrophic or even polluted water where it forms dense mats, up to 10 cm thick. It stays sterile and propagates only in a vegetative manner. Frost resistance of Lower Silesia populations is higher than reported so far; fern may winter and rebuild the population after frost reaching 22oC. Size of the populations is changeable during the vegetation season. A. filiculoides occurs in water habitats and plant communities in which it substitutes Lemna minor.
Costa, M L; Santos, M C R; Carrapiço, F; Pereira, A L
2009-08-01
The results of using the nitrogen fixing symbiotic system Azolla-Anabaena to improve the quality of treated urban wastewater, particularly on what concerns phosphorus removal efficiencies (40-65%), obtained in continuous assays performed during the past few years and presented earlier, were very promising. Nevertheless, the presence of combined nitrogen in some wastewaters can compromise the treatment efficiency. The main goal of this work was to compare plants behaviour in wastewater and in mineral media with and without added nitrogen. Azolla filiculoides's specific growth rates in wastewater and in mineral media without added nitrogen or with low nitrate concentration were very similar (0.122 d(-1)-0.126 d(-1)), but decreased in the presence of ammonium (0.100 d(-1)). The orthophosphate removal rate coefficients were similar in all the growth media (0.210 d(-1)-0.232 d(-1)), but ammonium removal rate coefficient in wastewater was higher (0.117 d(-1)) than in mineral medium using that source of nitrogen (0.077 d(-1)). The ammonium present in wastewater, despite its high concentration (34 mg NL(-1)), didn't seem to inhibit growth and nitrogen fixation, however, in mineral media, ammonium (40 mg NL(-1)) was found to induce, respectively, 18% and 46% of inhibition.
Akinbile, Christopher O; Ogunrinde, Temitope A; Che Bt Man, Hasfalina; Aziz, Hamidi Abdul
2016-01-01
Two constructed wetlands, one with Azolla pinnata plant (CW1) and the other without (CW2) for treating domestic wastewaters were developed. Fifteen water parameters which include: Dissolved Oxygen (DO), Biochemical Oxygen Demand (BOD5), Chemical Oxygen Demand (COD), Total Suspended Solid (TSS), Total Phosphorus (TP), Total Nitrogen (TN), Ammoniacal Nitrogen (NH3N), Turbidity, pH, Electrical Conductivity (EC), Iron (Fe), Magnesium (Mg), Manganese (Mn), and heavy metals such as Lead (Pb) and Zinc (Zn) were analyzed using standard laboratory procedures. The experiments were conducted in two (dry and wet) seasons simultaneously. Results showed considerable reductions in all parameters and metals including Zn in CW1 compared with CW2 in the two seasons considered while Pb and Mn were not detected throughout the study. Zn concentration levels reduced significantly in both seasons just as removal efficiencies of 70.03% and 64.51% were recorded for CW1 while 35.17% and 33.45% were recorded for CW2 in both seasons. There were no significant differences in the removal efficiencies of Fe in both seasons as 99.55%, 59.09%, 88.89%, and 53.56% were recorded in CW1 and CW2 respectively. Azolla pinnata has proved effective in domestic wastewater phytoremediation studies.
Park, Hun; Song, Uhram
2017-10-03
Although Azolla species are among the most promising plants for use in phytoremediation, more studies on their growth and nitrogen (N) uptake along the N gradients of growing media are required. In this study, N concentration-dependent growth in growing media and phosphorus (P) and N accumulation by Azolla japonica were studied by estimating direct N uptake from media by molybdenum-iron proteins. The doubling time of A. japonica was less than a week, regardless of the N concentration (0, 5, and 25 mg N/L) present in the growth media, indicating that this plant is suitable for remediation. Plants showed a high uptake of P, probably via plant-bacteria symbiosis, indicating their potential for effective P remediation. A. japonica also showed more than 4% N content regardless of the treatment and accumulated more than 40 mg of N per microcosm in 3 weeks. iron and molybdenum levels in plants were strongly associated with N fixation, and N uptake from media was estimated to be more than 25 mg per microcosm in 3 weeks, indicating that A. japonica has N remediation potential. As A. japonica is a rapidly growing plant, capable of efficient P and N remediation, it has great potential for use in phytoremediation of nutrient-enriched waters such as agricultural or urban wastewater and eutrophicated aquatic ecosystems.
Zheng, Weiwen; Bergman, Birgitta; Chen, Bin; Zheng, Siping; Guan, Xiong; Xiang, Guan; Rasmussen, Ulla
2009-01-01
The nitrogen-fixing symbiosis between cyanobacteria and the water fern Azolla microphylla is, in contrast to other cyanobacteria-plant symbioses, the only one of a perpetual nature. The cyanobacterium is vertically transmitted between the plant generations, via vegetative fragmentation of the host or sexually within megasporocarps. In the latter process, subsets of the cyanobacterial population living endophytically in the Azolla leaves function as inocula for the new plant generations. Using electron microscopy and immunogold-labeling, the fate of the cyanobacterium during colonization and development of the megasporocarp was revealed. On entering the indusium chamber of the megasporocarps as small-celled motile cyanobacterial filaments (hormogonia), these differentiated into large thick-walled akinetes (spores) in a synchronized manner. This process was accompanied by cytoplasmic reorganizations and the release of numerous membrane vesicles, most of which contained DNA, and the formation of a highly structured biofilm. Taken together the data revealed complex adaptations in the cyanobacterium during its transition between plant generations.
Schor-Fumbarov, Tamar; Goldsbrough, Peter B; Adam, Zach; Tel-Or, Elisha
2005-12-01
A cDNA encoding a type 2 metallothionein (MT) was isolated from Azolla filiculoides, termed AzMT2, accession no. AF482470. The AzMT2 transcript was expressed in sterile A. filiculoides that were free of the cyanobiont Anabaena azollae after erythromycin treatment, proving that AzMT2 is encoded by the fern genome. AzMT2 RNA expression was enhanced by the addition of Cd(+2), Cu(+2), Zn(+2) and Ni(+2) to the growth medium. The transcript level of AzMT2 correlated with the metal content in the plants. Temporal analysis of AzMT2 expression demonstrated that Cd(2+) and Ni(2+) induction of AzMT2 RNA expression occurred within 48 h. AzMT2-enhanced expression responded more intensely to the toxic Cd and Ni ions in A. filiculoides suggesting that AzMT2 may participate in detoxification mechanism. The more moderate response of AzMT2 to Zn and Cu ions, which are essential micronutrients, suggest a role for AzMT2 in metal homeostasis.
Speelman, E.N.
2010-01-01
With the realization that the Arctic Ocean was covered with enormous quantities of the aquatic floating fern Azolla 49 Myrs ago, new questions regarding the Eocene conditions facilitating these blooms arose. This dissertation describes the reconstruction of paleo-environmental conditions
DEFF Research Database (Denmark)
Xu, Heshui; Zhu, Bo; Liu, Jingna
2017-01-01
Rice paddies are a major source of methane. How to reduce the methane emission in the paddy field without decreasing the yield has become a major concern of scientists, environmental groups, and agricultural policymakers worldwide. Azolla, used as a dual crop in rice cultivation, has multiple agr...
Directory of Open Access Journals (Sweden)
Gabriela Alves Leão
Full Text Available ABSTRACT Phytoremediation has proven to be an efficient technology for removing arsenic (As from water, but the plants used in this process need to be tolerant to the damage caused by As. The toxic effect of As on growth and functioning of the antioxidant system was studied in individual plants of Azolla caroliniana exposed to five concentrations of As (0.0, 0.25, 0.5, 1.0 and 1.5 mg L-1 for the course of five days. Growth, As absorption, enzymatic activity, total and non-protein thiols and anthocyanin content were assessed. Azolla caroliniana was able to take up large amounts of the pollutant, reaching As concentrations of 386.1 µg g-1 dry weight without saturating the absorption mechanism. The tolerance index and the growth of A. caroliniana decreased with the increased As uptake. Superoxide dismutase, peroxidases, catalases and glutathione reductase activities increased at lower doses of As and subsequently declined with higher concentrations, whereas ascorbate peroxidase activity was reduced in all treatments. Unlike the enzymatic defence system, anthocyanin and thiol content increased consistently in all treatments and showed a positive correlation with As concentration. Therefore, the increased synthesis of non-enzymatic antioxidants is most likely the main factor responsible for the high As tolerance of A. caroliniana.
Performance of dead Azolla filiculoides biomass in Biosorption of Au from wastewater.
Umali, L J; Duncan, J R; Burgess, J E
2006-01-01
Dried milled biomass of Azolla filiculoides removed up to 98.2% of gold from wastewater from a gold plating factory containing 5 mg gold/l in solution in batch biosorption. The gold uptake capacity of the biomass was 98 mg/g. Whole dried biomass used in a continuous flow column removed up to 100% of gold from diluted wastewater. A similar column was linked to a sulphide precipitation process to provide a two-step system which was able to remove 98% of gold from undiluted wastewater containing 41 mg Au/l. The lifetime of the column was five days.
De, Arnab Kumar; Dey, Narottam; Adak, Malay Kumar
2016-07-01
In the present experiment a pteridophytic species Azolla and an angiospermic species Vernonia were evaluated on the basis of cellular reactivity for herbicidal action through ongoing concentrations. Initially, both the species recorded a significant activity of IAA-oxidase as mark of IAA metabolism with herbicidal sensitivity. Still, Vernonia species were more affected on 2,4-D mediated auxin catabolism. The loss of auxin concentrations on the tissues by 2,4-D reaction was also reflected on growth parameters including relative growth rate and chlorophyll biosynthesis. In a dose dependent manner Vernonia plants were more affected with loss of chlorophyll content and decline in relative growth rate. On the other hand, both those parameters were adjusted significantly with 2,4-D accumulation in Azolla . The stability of cellular metabolism was documented by significant down regulation of protein and lipid peroxidation with concomitant moderation to superoxide and hydrogen peroxide accumulation. The later two were more vulnerable to damage in the Vernonia plant with profuse accumulation of protein and lipid peroxidation products. Similarly, tissue specific reaction to superoxide and hydrogen peroxide accumulation were distinctly demarcated in two species significantly. As a whole, the cellular responses and metabolite distribution to 2,4-D sensitization are the features to describe bio-indices for aquatic fern species Azolla with comparison to angiospermic species Vernonia .
Azolla-anabaena-bacteria system as a natural microcosm
Carrapico, Francisco J.
2002-02-01
Azolla is an aquatic fern that contains a permanent endosymbiotic prokaryotic community (cyanobacteria and bacteria) inside of the cavity in the leaf dorsal lobe of the pteridophyte. This is a unique situation and can be seen as a microcosm inside of an organism and also can be considered a good example of a living model for biological and environmental studies. These symbionts are specific of this symbiosis and lives immobilized in a mucilaginous fibrillar network, which fills part of the cavity. The symbionts works as immobilized organisms in a natural system that can be used as a model for biotechnological research and in biologically based life support systems. The nature and the complexity of this system is simultaneously a reference and a challenge for the research in the communication between the two levels of nature organization (microcosm and mesocosm), and can also be used as a reference for the design of new environmental engineered symbiotic systems that include man as a prelude to life in space.
Directory of Open Access Journals (Sweden)
Atousa Farahpour-Haghani
2017-01-01
Full Text Available Water ferns (Azolla spp., Azollaceae are reported for the first time as host plants for the larvae of the small China-mark moth Cataclysta lemnata (Linnaeus (Lepidoptera: Crambidae: Acentropinae in rice fields and waterways of northern Iran. Cataclysta lemnata is a semi-aquatic species that has been recorded to feed on Lemnaceae and a few other aquatic plants. However, it has not been reported before on Azolla spp. Larvae use water fern as food source and shelter and, at high population density in the laboratory, they completely wiped water fern from the water surface. Feeding was confirmed after rearing more than eight continual generations of C. lemnata on water fern in the laboratory. Adults obtained this way are darker and have darker fuscous markings in both sexes compared with specimens previously reported and the pattern remains unchanged after several generations.
Pereira, A L; Monteiro, B; Azevedo, J; Campos, A; Osório, H; Vasconcelos, V
2015-08-01
Harmful algal blooms (HABs) contaminate aquatic ecosystems and are responsible for animal poisoning worldwide. We conducted a toxicity test with the aquatic fern and the biofertilizer, Azolla filiculoides. The sporophytes were exposed to three concentrations (0.01, 0.1 and 1μgmL(-1)) of a microcystin (MC) cyanobacterial crude extract and purified MC-LR. The growth of A. filiculoides decreased only at 1μgmL(-1) crude extract concentration while with MC-LR it decreased at all the tested concentrations, indicating that the presence of other compounds in the crude extract altered toxicity and stimulated the fern growth at lower concentrations (0.01 and 0.1μgmL(-1)). Both phycoerythrocyanin and allophycocyanin levels decreased in all the concentrations of crude extract and MC-LR. The phycocyanin had a marked increase at 0.1μgmL(-1) crude extract concentration and a marked decrease at 1μgmL(-1) MC-LR concentration. These changes in the phycobiliprotein content indicate a shift in the antenna pigments of the cyanobionts of A. filiculoides. The changes in two oxidative stress enzymes, glutathione reductase for the crude extract assay and glutathione peroxidase for MC-LR assay, points towards the induction of stress defense responses. The low bioconcentration factor in both crude extract and MC-LR treatments can suggest the low uptake of microcystins, and indicates that the aquatic fern can be used as a biofertilizer and as animal feed but is not suitable for MC phytoremediation. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Selvaraj Kunjiappan
2015-04-01
Conclusion: Azolla microphylla phytochemically synthesized GNaP protects liver against oxidative damage and tissue damaging enzyme activities and could be used as an effective protector against acetaminophen-induced hepatic damage in fresh water common carp fish.
Thagela, Preeti; Yadav, Ravindra Kumar; Mishra, Vagish; Dahuja, Anil; Ahmad, Altaf; Singh, Pawan Kumar; Tiwari, Budhi Sagar; Abraham, Gerard
2017-01-01
Salinity stress causes adverse physiological and biochemical changes in the growth and productivity of a plant. Azolla, a symbiotic pteridophyte and potent candidate for biofertilizer due to its nitrogen fixation ability, shows reduced growth and nitrogen fixation during saline stress. To better understand regulatory components involved in salinity-induced physiological changes, in the present study, Azolla microphylla plants were exposed to NaCl (6.74 and 8.61 ds/m) and growth, photochemical reactions of photosynthesis, ion accumulation, and changes in cellular proteome were studied. Maximum dry weight was accumulated in control and untreated plant while a substantial decrease in dry weight was observed in the plants exposed to salinity. Exposure of the organism to different concentrations of salt in hydroponic conditions resulted in differential level of Na + and K + ion accumulation. Comparative analysis of salinity-induced proteome changes in A. microphylla revealed 58 salt responsive proteins which were differentially expressed during the salt exposure. Moreover, 42 % spots among differentially expressed proteins were involved in different signaling events. The identified proteins are involved in photosynthesis, energy metabolism, amino acid biosynthesis, protein synthesis, and defense. Downregulation of these key metabolic proteins appears to inhibit the growth of A. microphylla in response to salinity. Altogether, the study revealed that in Azolla, increased salinity primarily affected signaling and photosynthesis that in turn leads to reduced biomass.
Directory of Open Access Journals (Sweden)
A.F. Silva
2012-09-01
Full Text Available Os objetivos deste estudo foram avaliar Azolla caroliniana como planta-teste em estudos ecotoxicológicos e estimar a CL50;7d dos herbicidas 2,4-D, glyphosate, clomazone e oxyfluorfen. As plantas foram aclimatadas em sala de bioensaio. Para isso, foram selecionadas cinco plantas em 50 mL de meio de cultivo Hoagland. Após esse período, foram adicionados 50 mL de Hoagland mais o herbicida, completando o volume para 100 mL. A concentração letal de 50% (CL50;7d para A. caroliniana exposta ao herbicida 2,4-D foi de 708,35 mg L-1; ao glyphosate (formulação Scout®, de 23,66 mg L-1; ao glyphosate (formulação Trop®, de 38,91 mg L-1; ao clomazone, de 129,63 mg L-1; e ao oxyfluorfen, de 80,50 mg L-1. Os herbicidas glyphosate (Scout® e Trop® e oxyflourfen foram classificados como moderadamente tóxicos a A. caroliniana, e o clomazone e o 2,4-D, como praticamente não tóxicos. Conclui-se que A. caroliniana pode ser utilizada como planta bioindicadora de herbicidas à base de glyphosate e oxyfluorfen.The objectives of this study were to evaluate Azolla caroliniana as test plant in ecotoxicological studies and to estimate the LC50; 7d of the herbicides 2,4 D , glyphosate, and clomazone oxyfluorfen. The plants were acclimatized in the bioassay room. Five plants in 50 mL Hoagland culture medium were selected. After that, 50 mL of Hoagland and the herbicide were added, completing the volume to 100 mL. The 50% lethal concentration (LC50; 7d for A. caroliniana exposed to the herbicide 2,4- D, was 708.35 mg L-1; to glyphosate (formulation Scout®, 23.66 mg L-1; to glyphosate (formulation Trop®, 38.91 mg L-1; to clomazone, 129.63 mg L-1; and to oxyflourfen, 80.50 mg L-1. The herbicides glyphosate (Scout® and Trop® and oxyflourfen were classified as moderately toxic to A. caroliniana, while clomazone and 2,4-D were classified as practically non-toxic. It was concluded that A. caroliniana plants can be used as bio-indicators for glyphosate and
Energy Technology Data Exchange (ETDEWEB)
Singh, S.P.; Srivastava, S.C.; Pandey, K.D. (Banaras Hindu Univ., Varanasi (IN). Centre of Advanced Study in Botany)
1990-01-01
A photosynthetic bacterium Rhodopseudomonas sp. BHU strain 1 was isolated from the root zone of water fern Azolla pinnata. The bacterium was found to produce hydrogen with potato starch under phototrophic conditions. The immobilized bacterial cells showed sustained hydrogen production with a more than 4-fold difference over free cell suspensions. The data have been discussed in the light of possible utilization of relatively cheaper raw materials by non-sulphur bacteria to evolve hydrogen. (author).
Energy Technology Data Exchange (ETDEWEB)
Kauser, A M; Sikander, A [Nuclear Inst. for Agriculture and Biology, Faisalabad (Pakistan)
1990-12-31
Under the IAEA coordination project, a series of field and pot experiments have been conducted to demonstrate the various aspects of Azolla technology as a contribution of nitrogen to the nutrition of agricultural crops, especially rice. This final report summarizes the previous experiments and gives details on the last experiments. 1 fig., 7 tabs.
International Nuclear Information System (INIS)
Kauser, A.M.; Sikander, A.
1989-01-01
Under the IAEA coordination project, a series of field and pot experiments have been conducted to demonstrate the various aspects of Azolla technology as a contribution of nitrogen to the nutrition of agricultural crops, especially rice. This final report summarizes the previous experiments and gives details on the last experiments. 1 fig., 7 tabs
Khataee, A R; Movafeghi, A; Vafaei, F; Lisar, S Y Salehi; Zarei, M
2013-01-01
The potential of an aquatic fern, Azolla filiculoides, in phytoremediation of a mono azo dye solution, C.I. Acid Blue 92 (AB92), was studied. The effects of operational parameters such as reaction time, initial dye concentration, fern fresh weight, pH, temperature and reusability of the fern on biodegradation efficiency were investigated. The intermediate compounds produced by biodegradation process were analyzed using GC-MS analysis. An artificial neural network (ANN) model was developed to predict the biodegradation efficiency. The findings indicated that ANN provides reasonable predictive performance (R2 = 0.961). The effects of AB92 solutions (10 and 20 mg L(-1)) on growth, chlorophylls and carotenoids content, activity of antioxidant enzymes such as superoxide dismutase, peroxidase and catalase and formation of malondialdehyde were analyzed. AB92 generally showed inhibitory effects on the growth. Moreover, photosynthetic pigments in the fronds significantly decreased in the treatments. An increase was detected for lipid peroxidation and antioxidant enzymes activity, suggesting that AB92 caused reactive oxygen species production in Azolla fronds, which were scavenged by induced activities of antioxidant enzymes.
Urea application promotes amino acid metabolism and membrane lipid peroxidation in Azolla.
Chen, Jiana; Huang, Min; Cao, Fangbo; Pardha-Saradhi, P; Zou, Yingbin
2017-01-01
A pot experiment was conducted to evaluate the effect of urea on nitrogen metabolism and membrane lipid peroxidation in Azolla pinnata. Compared to controls, the application of urea to A. pinnata resulted in a 44% decrease in nitrogenase activity, no significant change in glutamine synthetase activity, 660% higher glutamic-pyruvic transaminase, 39% increase in free amino acid levels, 22% increase in malondialdehyde levels, 21% increase in Na+/K+- levels, 16% increase in Ca2+/Mg2+-ATPase levels, and 11% decrease in superoxide dismutase activity. In terms of H2O2 detoxifying enzymes, peroxidase activity did not change and catalase activity increased by 64% in urea-treated A. pinnata. These findings suggest that urea application promotes amino acid metabolism and membrane lipid peroxidation in A. pinnata.
A study on the Phytoremediation Potential of Azolla pinnata under laboratory conditions
Directory of Open Access Journals (Sweden)
Upekha Mandakini Lenaduwa Lokuge
2016-11-01
Full Text Available Heavy metal contamination in aquatic environments has become one of the major environmental problems all over the world. Phytoremediation is a plant based technology that utilizes special plants known as hyperaccumulators to purify heavy metal contaminated sites. Hyperaccumulators are capable of absorbing heavy metals in greater concentrations. Azolla pinnata is an aquatic macrophyte that has been earmarked for its hyperaccumulation ability. This green technology is often more favoured over conventional methods due to its low cost, low environmental impacts and wider public acceptance.This study was conducted under laboratory conditions to assess the ability of A. pinnata for the removal of Cr, Ni, Cd and Pb through rhizofiltration, which is one of the phytoremediation strategies under laboratory conditions. Under three main experiments, the fern’s phytoremediation ability was investigated. In the first experiment, A. pinnata was exposed to prepared solutions of Cr, Ni and Pb of 2ppm, 4ppm, 6ppm, 8ppm and 10ppm and of Cd solutions of 0.5ppm, 1.0ppm, 1.5ppm, 2.0ppm, 2.5ppm and 3.0ppm respectively. Experiments were carried out separately for Cr, Ni, Cd and Pb concentrations for 7 days. The concentrations of heavy metals used in the experiments largely agreed with the environmentally measured values, although in certain experiments, the initial concentrations exceeded the environmental pollution levels.The presence of Cr, Ni, Cd and Pb caused a maximum inhibition of A.pinnata growth by 47%, 54%, 52% and 45% respectively while the highest removal percentages of Cr- 98%, Ni- 57%, Cd- 88% and Pb- 86% were recorded in 2ppm, 2ppm, 0.5ppm and 8ppm treatments respectively. The highest Bio Concentration Factor (BCF for Cr was 1376.67 when treated with 6ppm, 684.95 at 4ppm for Ni, 1120.06 at 0.5ppm for Cd and 1332.53 at 8ppm for Pb respectively. At the end of the experiments toxic symptoms were observed in plats exposed to Cd and Ni. The findings of
de Vries, Jan; Fischer, Angela Melanie; Roettger, Mayo; Rommel, Sophie; Schluepmann, Henriette; Bräutigam, Andrea; Carlsbecker, Annelie; Gould, Sven Bernhard
2016-01-01
The phytohormones cytokinin and auxin orchestrate the root meristem development in angiosperms by determining embryonic bipolarity. Ferns, having the most basal euphyllophyte root, form neither bipolar embryos nor permanent embryonic primary roots but rather an adventitious root system. This raises the questions of how auxin and cytokinin govern fern root system architecture and whether this can tell us something about the origin of that root. Using Azolla filiculoides, we characterized the influence of IAA and zeatin on adventitious fern root meristems and vasculature by Nomarski microscopy. Simultaneously, RNAseq analyses, yielding 36,091 contigs, were used to uncover how the phytohormones affect root tip gene expression. We show that auxin restricts Azolla root meristem development, while cytokinin promotes it; it is the opposite effect of what is observed in Arabidopsis. Global gene expression profiling uncovered 145 genes significantly regulated by cytokinin or auxin, including cell wall modulators, cell division regulators and lateral root formation coordinators. Our data illuminate both evolution and development of fern roots. Promotion of meristem size through cytokinin supports the idea that root meristems of euphyllophytes evolved from shoot meristems. The foundation of these roots was laid in a postembryonically branching shoot system. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.
Urea application promotes amino acid metabolism and membrane lipid peroxidation in Azolla.
Directory of Open Access Journals (Sweden)
Jiana Chen
Full Text Available A pot experiment was conducted to evaluate the effect of urea on nitrogen metabolism and membrane lipid peroxidation in Azolla pinnata. Compared to controls, the application of urea to A. pinnata resulted in a 44% decrease in nitrogenase activity, no significant change in glutamine synthetase activity, 660% higher glutamic-pyruvic transaminase, 39% increase in free amino acid levels, 22% increase in malondialdehyde levels, 21% increase in Na+/K+- levels, 16% increase in Ca2+/Mg2+-ATPase levels, and 11% decrease in superoxide dismutase activity. In terms of H2O2 detoxifying enzymes, peroxidase activity did not change and catalase activity increased by 64% in urea-treated A. pinnata. These findings suggest that urea application promotes amino acid metabolism and membrane lipid peroxidation in A. pinnata.
Phytoremediation of heavy metals from fly ash pond by Azolla caroliniana.
Pandey, Vimal Chandra
2012-08-01
Abundance of naturally growing Azolla caroliniana (water fern) on the surface of metal enriched fly ash (FA) pond reflects its toxitolerant characteristics. Results indicate the efficiency of A. caroliniana for phytoremediation of FA pond because of its higher bioconcentration factor. The metal concentration ranged from 175 to 538 and 86 to 753mgkg(-1) in roots and fronds, respectively. Bioconcentration factor (BCF) values of all metals in root and frond ranged from 1.7 to18.6 and 1.8 to 11.0, respectively, which were greater than one and indicates the metal accumulation potential of A. caroliniana. Translocation factor (TF) ranged from 0.37 to 1.4 for various heavy metals. The field result proved that A. caroliniana is a potential accumulator for the examined heavy metals and can be used for phytoremediation of FA pond. Copyright © 2012 Elsevier Inc. All rights reserved.
Prasad, Sheo Mohan; Kumar, Sushil; Parihar, Parul; Singh, Rachana
2016-11-01
A field experiment was conducted to investigate the impact of alone and combined exposures of herbicide pretilachlor (5, 10 and 20μgml(-1)) and enhanced UV-B radiation (UV-B1; ambient +2.2kJm(-2) day(-1) and UV-B2; ambient +4.4kJm(-2) day(-1)) on growth, oxidative stress and the ascorbate-glutathione (AsA-GSH) cycle in two agronomically important Azolla spp. viz., Azolla microphylla and Azolla pinnata. Decreased relative growth rate (RGR) in both the species under tested stress could be linked to enhanced oxidative stress, thus higher H2O2 accumulation was observed, that in turn might have caused severe damage to lipids and proteins, thereby decreasing membrane stability. The effects were exacerbated when spp. were exposed to combined treatments of enhanced UV-B and pretilachlor. Detoxification of H2O2 is regulated by enzymes/metabolites of AsA-GSH cycle such as ascorbate peroxidase (APX) and glutathione reductase (GR) activity that were found to be stimulated. While, dehydroascorabte reductase (DHAR) activity, and the amount of metabolites: ascorbate (AsA), glutathione (GSH) and ratios of reduced/oxidized AsA (AsA/DHA) and GSH (GSH/GSSG), showed significant reduction with increasing doses of both the stressors, either applied alone or in combination. Glutathione-S-transferase (GST), an enzyme involved in scavenging of xenobiotics, was found to be stimulated under the tested stress. This study suggests that decline in DHAR activity and in AsA/DHA ratio might have led to enhanced H2O2 accumulation, thus decreased RGR was noticed under tested stress in both the species and the effect was more pronounced in A. pinnata. Owing to better performance of AsA-GSH cycle in A. microphylla, this study substantiates the view that A. microphylla is more tolerant than A. pinnata. Copyright © 2016 Elsevier Inc. All rights reserved.
Goda, Ashraf; Saad, Amal; Hanafy, Mohamed; Sharawy, Zaki; El-Haroun, Ehab
2017-07-01
The present study was conducted to evaluate the effect of either individual or combined wheat bran (WB) replacement with Azolla pinnata supplemented with Digestin™ in the diet of freshwater prawn,Macrobrachium rosenbergii Postlarvae (PL) on growth performance, nutrient utilization, chemical body composition and survival (%). Experimental diets were a wheat bran-soybean based diet with no Azolla and Digestin TM (control, T1), and diets containing 17% Azolla supplemented with Digestin TM 0% (T2), 1% (T3), 2% (T4) and 3% (T5). Each experimental diet was allocated into three tanks (6m3/tank) fed for 12 wks. Each tank was subdivided into three equal pens by nets (2m3) and stoked with 84 PL/m2. The experimental diets were readily consumed by prawns PLs where both high growth and good feed efficiency were achieved for all diets. The results showed that the diets containing A. pinnata supplemented with Digestin™ at the level up to 3% have the higher growth and better nutrient utilization than the control diet. No differences were observed for moisture and protein content among the experimental diets. However, the highest protein content was observed on prawns fed on diets T1 and T5 respectively, while the lowest value was recorded for T 4 diet. The results also show that prawn PLs fed the diets contain A. pinnata and supplemented with Digestin TM recorded the highest values of body lipid content compared to the control diet. Feed efficiency and economic conversion rate (ECR) values show that economic performance and the cost-effectiveness of the A. pinnata supplemented with up to 3% Digestin TM recorded the highest net return, and therefore it is recommended for prawn, M. rosenbergii PL's. These results are clearly indicating that A. pinnata have a good potential for use in prawn diets at reasonable levels than other conventional diets.
Abraham, G; Yadav, R K; Kaushik, G K
2015-04-01
Azolla microphylla Kaulf. is an aquatic nitrogen fixing pteridophyte commonly found in aquatic habitats including paddy fields. Methanolic extract of the fronds of A. microphylla was subjected to partial purification by solvent partitioning with diethyl ether and ethyl acetate followed by hydrolysis, and further partitioning with ethyl acetate. The two fractions, thus obtained were tested for antibacterial activity. It was observed that the ethyl acetate fraction inhibited the growth of the pathogenic bacterium Xanthomonas oryzae. The GC-MS analysis of the ethyl acetate fraction showed several prominent peaks with retention time ranging from 8.83 to 45.54 min. A comparison of these peaks with the GC-MS libraries revealed that it could be eicosenes and heptadecanes with potential of antimicrobial activity.
Directory of Open Access Journals (Sweden)
Sudadi
2014-07-01
Full Text Available The application of chemical fertilizer for long time may adverse soil environment. Organic agriculture, for example combination use of azolla based-organic fertilizer, phosphate rock and rice hull ash, was one of ways that able to recover it. Research was conducted in Sukosari, Jumantono, Karanganyar while soi chemical properties analysis was analysed in Soil Chemistry and Fertility Laboratory, Fac. of Agriculture, Sebelas Maret University April to November 2013. Research design used was RAKL with 5 treatments, each repeated 5 times. The treatments applied were P0 (control, P1 ( azola inoculum dosage 250 g/m2 + phosphate rock + rice hull ash equal to 150 kg/ha KCl, P2 (azola inoculum dosage 500 g/m2 + phosphate rock equal to 150kg/ha, SP-36 + rice hull ash equal to 100 kg/ha KCl, P3 (manure dosage of 5 ton/ha,P4 (Urea 250 kg/ha + SP-36 150 kg/ha + KCl 100 kg/ha. Data analysed statistically by F test (Fisher test with level of confident 95% followed by DMRT (Duncan Multiple Range Test if any significant differences. The result showed that the treatment combination of azolla, phosphate rock and rice hull ash increase soil organic matter content, cation exchange capacity, available-P and exchangeable-K as well as rice yield ( (at harvest-dry grain weight and milled-dry grain weight.
Toxicity of Diclofenac in the Fern Azolla filiculoides and the Lichen Xanthoria parietina.
Vannini, Andrea; Paoli, Luca; Vichi, Marco; Bačkor, Martin; Bačkorová, Miriam; Loppi, Stefano
2018-03-01
This study investigated the occurrence of toxicity, expressed as damage to the photosynthetic apparatus, in the aquatic fern Azolla filiculoides and the lichen Xanthoria parietina following treatments with diclofenac at different concentrations (0.1, 1, 10 and 100 mg/L) and different exposure times (24, 48, 72 and 240 h). Measurements of photosynthetic efficiency, chlorophyll content and chlorophyll degradation indicated dose- and time-dependent toxicity, since significant differences with control samples as well as among treatments, emerged mainly for the highest concentration (100 mg/L) and the longest time (240 h). In addition, also the mycobiont of the lichen X. parietina showed similar toxic effects, expressed as ergosterol content. The absence of relevant alterations at the lowest concentration (0.1 mg/L) suggested a very limited susceptibility of these species to environmentally relevant levels of this pharmaceutical.
Batten, D J.; Collinson, M E.
2001-05-01
Species of the megaspore genus Minerisporites Potonié, megaspore apparatuses of species of the water fern Azolla Lamarck, and some associated organic-walled microfossils recovered from deposits of the Upper Palaeocene and Palaeocene/Eocene transition in the southern part of the Netherlands and neighbouring Belgium are redescribed on the basis of an examination of specimens under scanning and transmission electron microscopes. Originally studied about 40 years ago by S.J. Dijkstra, the re-examination has enabled emended diagnoses to be produced for six taxa: Minerisporites glossoferus (Dijkstra) Tschudy, M. mirabilis (Miner) Potonié, M. mirabilissimus (Dijkstra) Potonié, Azolla schopfii Dijkstra, A. teschiana Florschütz, and A. velus (Dijkstra) Jain and Hall. In addition, a revised description is provided for massulae of Salvinia Séguier that were originally thought to be megaspores and, hence, named by Dijkstra as Triletes? exiguus. The gross morphology and construction of the exospore of the species of Minerisporites are similar, but nevertheless sufficiently distinct for them to be maintained as separate taxa. Monolete microspores are preserved in hollows in the reticulate surface of some of the specimens of M. mirabilissimus. This is consistent with the presumed isoetalean affinity of Minerisporites. An apparent stratigraphic morphocline from M. glossoferus to M. mirabilis, suggested previously, is confirmed following our reassessment of their characteristics. The species of Azolla are all multi-floated, but they differ from each other in several ways, in particular with respect to the ultrastructure of the megaspore wall. They are also distinct from all other species that have been considered in sufficient detail for satisfactory comparisons to be made. The massulae of A. teschiana are described for the first time. The floats in A. velus are attached to the proximal part of the megaspore only by suprafilosal hairs. There are no maniculae. It is argued that
Directory of Open Access Journals (Sweden)
R Samudera
2008-09-01
Full Text Available This was conducted to know the effect of Azzola usage in their dietary toward skin color abdomen fat and carcass fat of male Alabio duck. The subject of this research was male Alabio duck attain the age 3 weeks as number 80 tails, with average first body weight 390,82 ± 0,63 g. The dietary contain 16% protein and 3000 kcal energy. Observation parameters including abdomen fat percentage, carcass fat, and skin color. Complete Random Design (RAL consist of 4 treatments and 5 repeating was applied. Each treatment unit consisted of 4 tails of male Alabio duck. Set as treatment was levels of Azzola pinnata flour usage as much as 0 (A0; 7.5 (A2; 15 (A3; and 22.5% (A4. The effect of treatment towards abdomen fat (A0, A1, A2, and A3 / 1.50; 1.41; 1.23; 0.92 %, carcass fat (A0, A1, A2, and A3 / 7.99; 7.53; 5.74; 5.25 %, and skin color (A0, A1, A2, and A3 / 2.66; 3.62; 3.94; 4.20. this research showed result of that treatment influence was significantly difference (P < 0.05. Conclusion of this research, that azolla usage within dietary is able to decrease abdomen fat degree and carcass fat, reform skin color, thus, produce yellow color or un-pale. (Animal Production 10(3: 164-167 (2008 Key Words: Alabio duck, azolla, skin color, abdomen fat, carcass fat
Muradov, Nazim; Taha, Mohamed; Miranda, Ana F; Kadali, Krishna; Gujar, Amit; Rochfort, Simone; Stevenson, Trevor; Ball, Andrew S; Mouradov, Aidyn
2014-02-28
Shortages in fresh water supplies today affects more than 1 billion people worldwide. Phytoremediation strategies, based on the abilities of aquatic plants to recycle nutrients offer an attractive solution for the bioremediation of water pollution and represents one of the most globally researched issues. The subsequent application of the biomass from the remediation for the production of fuels and petrochemicals offers an ecologically friendly and cost-effective solution for water pollution problems and production of value-added products. In this paper, the feasibility of the dual application of duckweed and azolla aquatic plants for wastewater treatment and production of renewable fuels and petrochemicals is explored. The differences in absorption rates of the key wastewater nutrients, ammonium and phosphorus by these aquatic macrophytes were used as the basis for optimization of the composition of wastewater effluents. Analysis of pyrolysis products showed that azolla and algae produce a similar range of bio-oils that contain a large spectrum of petrochemicals including straight-chain C10-C21 alkanes, which can be directly used as diesel fuel supplement, or a glycerin-free component of biodiesel. Pyrolysis of duckweed produces a different range of bio-oil components that can potentially be used for the production of "green" gasoline and diesel fuel using existing techniques, such as catalytic hydrodeoxygenation. Differences in absorption rates of the key wastewater nutrients, ammonium and phosphorus by different aquatic macrophytes can be used for optimization of composition of wastewater effluents. The generated data suggest that the composition of the petrochemicals can be modified in a targeted fashion, not only by using different species, but also by changing the source plants' metabolic profile, by exposing them to different abiotic or biotic stresses. This study presents an attractive, ecologically friendly and cost-effective solution for efficient bio
2014-01-01
Background Shortages in fresh water supplies today affects more than 1 billion people worldwide. Phytoremediation strategies, based on the abilities of aquatic plants to recycle nutrients offer an attractive solution for the bioremediation of water pollution and represents one of the most globally researched issues. The subsequent application of the biomass from the remediation for the production of fuels and petrochemicals offers an ecologically friendly and cost-effective solution for water pollution problems and production of value-added products. Results In this paper, the feasibility of the dual application of duckweed and azolla aquatic plants for wastewater treatment and production of renewable fuels and petrochemicals is explored. The differences in absorption rates of the key wastewater nutrients, ammonium and phosphorus by these aquatic macrophytes were used as the basis for optimization of the composition of wastewater effluents. Analysis of pyrolysis products showed that azolla and algae produce a similar range of bio-oils that contain a large spectrum of petrochemicals including straight-chain C10-C21 alkanes, which can be directly used as diesel fuel supplement, or a glycerin-free component of biodiesel. Pyrolysis of duckweed produces a different range of bio-oil components that can potentially be used for the production of “green” gasoline and diesel fuel using existing techniques, such as catalytic hydrodeoxygenation. Conclusions Differences in absorption rates of the key wastewater nutrients, ammonium and phosphorus by different aquatic macrophytes can be used for optimization of composition of wastewater effluents. The generated data suggest that the composition of the petrochemicals can be modified in a targeted fashion, not only by using different species, but also by changing the source plants’ metabolic profile, by exposing them to different abiotic or biotic stresses. This study presents an attractive, ecologically friendly and cost
Effects of lead accumulation on the Azolla caroliniana-Anabaena association.
Roberts, Anne E; Boylen, Charles W; Nierzwicki-Bauer, Sandra A
2014-04-01
The effect of lead accumulation on photopigment production, mineral nutrition, and Anabaena vegetative cell size and heterocyst formation in Azolla caroliniana was investigated. Plants were exposed to 0, 1, 5, 10, and 20 mg L(-1) lead acetate for ten days. Lead accumulation increased when plants were treated with higher lead concentrations. Results revealed a statistically significant decline in total chlorophyll, chlorophyll a, chlorophyll b, and carotenoids in 5, 10, and 20 mg Pb L(-1) treatment groups as compared to plants with 0 or 1 mg Pb L(-1) treatments. No statistically significant change in anthocyanin production was observed. Calcium, magnesium, and zinc concentrations in plants decreased in increasing treatment groups, whereas sodium and potassium concentrations increased. Nitrogen and carbon were also found to decrease in plant tissue. Anabaena vegetative cells decreased in size and heterocyst frequency declined rapidly in a Pb dose-dependent manner. These results indicate that, while A. caroliniana removes lead from aqueous solution, the heavy metal causes physiological and biochemical changes by impairing photosynthesis, changing mineral nutrition, and impeding the growth and formation of heterocysts of the symbiotic cyanobacteria that live within leaf cavities of the fronds. Copyright © 2014. Published by Elsevier Inc.
Sea surface salinity of the Eocene Arctic Azolla event using innovative isotope modeling
Speelman, E. N.; Sewall, J. O.; Noone, D.; Huber, M.; Sinninghe Damste, J. S.; Reichart, G. J.
2009-04-01
With the realization that the Eocene Arctic Ocean was covered with enormous quantities of the free floating freshwater fern Azolla, new questions regarding Eocene conditions facilitating these blooms arose. Our present research focuses on constraining the actual salinity of, and water sources for, the Eocene Arctic basin through the application of stable water isotope tracers. Precipitation pathways potentially strongly affect the final isotopic composition of water entering the Arctic Basin. Therefore we use the Community Atmosphere Model (CAM3), developed by NCAR, combined with a recently developed integrated isotope tracer code to reconstruct the isotopic composition of global Eocene precipitation and run-off patterns. We further addressed the sensitivity of the modeled hydrological cycle to changes in boundary conditions, such as pCO2, sea surface temperatures (SSTs) and sea ice formation. In this way it is possible to assess the effect of uncertainties in proxy estimates of these parameters. Overall, results of all runs with Eocene boundary conditions, including Eocene topography, bathymetry, vegetation patterns, TEX86 derived SSTs and pCO2 estimates, show the presence of an intensified hydrological cycle with precipitation exceeding evaporation in the Arctic region. Enriched, precipitation weighted, isotopic values of around -120‰ are reported for the Arctic region. Combining new results obtained from compound specific isotope analyses (δD) on terrestrially derived n-alkanes extracted from Eocene sediments, and model outcomes make it possible to verify climate reconstructions for the middle Eocene Arctic. Furthermore, recently, characteristic long-chain mid-chain ω20 hydroxy wax constituents of Azolla were found in ACEX sediments. δD values of these C32 - C36 diols provide insight into the isotopic composition of the Eocene Arctic surface water. As the isotopic signature of the runoff entering the Arctic is modelled, and the final isotopic composition of
Rai, Prabhat Kumar; Tripathi, B D
2009-01-01
The aim of the present work was to monitor the Hg pollution in water and sediments of G.B. Pant Sagar located in Singrauli Industrial Region, India and to suggest the efficient aquatic plants for its phytoremediation. The study assessed the comparative potential of a free floating water fern Azolla pinnata and submerged aquatic macrophyte Vallisneria spiralis to purify waters polluted by Hg. Six days laboratory experiments have been conducted to mark the percentage removal of Hg at initial concentration of 0.1, 0.5, 1.0 and 3.0 mg L(-1). The percentage removal of Hg was higher for A. pinnata (80-94%) than V. spiralis (70-84%). Likewise, the Hg accumulated in dry mass was much higher for A. pinnata and a high correlation (R(2) = 0.91 for A. pinnata and 0.99 for V. spiralis) was obtained between applied Hg doses and accumulated amounts in biomass. A concentration dependent decrease in chlorophyll a, protein, RNA, DNA and nutrients (NO(3-) and PO(4)(3-)) uptake was detected in A. pinnata and V. spiralis due to Hg toxicity. The decrease was more prominent in Azolla than Vallisneria. The results recommended the use of A. pinnata and V. spiralis to ameliorate the industrial effluents (thermal power, chlor-alkali and coal mine effluent) contaminated with Hg.
Removal of copper(II) ions from aqueous solutions by Azolla rongpong: batch and continuous study.
Nedumaran, B; Velan, M
2008-01-01
Batch and packed bed continuous biosorption studies were conducted to investigate the kinetics and isotherms of Cu(II) ions on the biomass of blue green alga Azolla rongpong. It is observed that the biosorption capacity of algae depends on initial pH and dosage. The biosorption capacity increases with increasing concentration and follows Freundlich isotherm model well with k and n values 0.06223 and 0.949 respectively. The optimum pH of 3.5 with an algae dosage of 1 g/L was observed. The results indicate that with the advantage of high metal biosorption capacity and recovery of Cu(II) ions, A. rongpong can be used as an efficient and economic biosorbent for the removal and recovery of toxic heavy metals from aqueous wastes even at higher concentration.
Energy Technology Data Exchange (ETDEWEB)
Wet, L.P.D. de; Schoonbee, H.J.; Pretorius, J.; Bezuidenhout, L.M. (Rand Afrikaans University, Johannesburg (South Africa). Depts. of Zoology and Botany, Research Unit for Aquatic and Terrestrial Ecosystems)
1990-10-01
The bio-accumulation of the heavy metals, Fe, Cu, Ni, Pb, Zn, Mn and Cr by the water fern, Azolla filiculoides Lam. in a wetland ecosystem polluted by effluents from sewage works, mines and industries was investigated. Results showed that the different metals can be accumulated by the water fern at concentration levels not necessarily related to their actual concentrations in the aquatic environment, as measured in this case, in the bottom sediments. 45 refs., 1 fig., 3 tabs.
Bhaskaran, Sreenath Kunnathupara; Kannappan, Poornima
2017-05-01
Azolla microphylla is an important fast-growing aquatic plant trusted for its agronomic, nutritious and therapeutic uses. The present work is undertaken to investigate the protective effect of the ethanolic extract of Azolla microphylla (EAM) against the Isoproterenol (ISO) induced cardiotoxicity in rats. Rats were pre-treated with EAM (250 and 500mg/kg b.w.) for 28 days along with ISO (85mg/kg; s.c.) on the 29th and 30th days. ISO-induced rats displayed significant diminution in cardiac antioxidant enzymes activities, increased lipid peroxidation and alteration in cardiac marker enzymes. The same group also displayed an increase in levels of serum lipid profiles and pro-inflammatory cytokines (IL-6 and IL-8) accompanied with a significant reduction in the anti-inflammatory cytokine levels (IL-10). Moreover, the histopathological investigations in the heart tissue of ISO-induced group exhibited myocardial necrosis and inflammation, which correlated with the increased immunoreactivity for Bax/iNOS, whereas an absence of reactivity for Bcl-2 proteins. However, in EAM pre-treated rats, the activities of antioxidant enzymes, cardiac marker enzymes, membrane-bound ATPases together with the levels of lipid profile, non-enzymatic antioxidants, pro and anti-inflammatory cytokines were maintained at normalcy that was further supported by improving histopathological changes and myocardial architecture. The IHC results of EAM pre-treated rats indicate up-regulated and down-regulated expressions of Bcl-2 and Bax/iNOS proteins, respectively. Thus, the present study reveals that A. microphylla alleviates myocardial damage in ISO-induced cardiac injury and demonstrates cardioprotective potential which could be attributed to its potent antioxidant and free radical scavenging activity. A possible mechanism for the protective effect is the elevated expression of endogenous antioxidant defense enzymes, anti-inflammatory cytokines, degraded lipid peroxidation products and improved
Response of microbial communities to pesticide residues in soil restored with Azolla imbricata.
Lu, Xiao-Ming; Lu, Peng-Zhen
2018-01-01
Under conditions of Azolla imbricata restoration, the high-throughput sequencing technology was employed to determine change trends of microbial community structures in the soil that had undergone long-term application of pesticides. The relationship between the content of pesticide residues in the soil and the microbial community structure was analyzed. The results indicated that the microbial diversity was strongly negatively correlated with the contents of pesticide residues in the soil. At a suitable dosage of 5 kg fresh A. imbricata per square meter of soil area, the soil microbial diversity increased by 12.0%, and the contents of pesticide residues decreased by 26.8-72.1%. Sphingobacterium, Sphingopyxis, Thermincola, Sphingobium, Acaryochloris, Megasphaera, Ralstonia, Pseudobutyrivibrio, Desulfitobacterium, Nostoc, Oscillochloris, and Aciditerrimonas may play major roles in the degradation of pesticide residues. Thauera, Levilinea, Geothrix, Thiobacillus, Thioalkalispira, Desulfobulbus, Polycyclovorans, Fluviicola, Deferrisoma, Erysipelothrix, Desulfovibrio, Cytophaga, Vogesella, Zoogloea, Azovibrio, Halomonas, Paludibacter, Crocinitomix, Haliscomenobacter, Hirschia, Silanimonas, Alkalibacter, Woodsholea, Peredibacter, Leptolinea, Chitinivorax, Candidatus_Lumbricincola, Anaerovorax, Propionivibrio, Parasegetibacter, Byssovorax, Runella, Leptospira, and Nitrosomonas may be indicators to evaluate the contents of pesticide residues.
Abraham, Gerard; Dhar, Dolly Wattal
2010-09-01
Azolla microphylla plants exposed directly to NaCl (13 dsm(-1)) did not survive the salinity treatment beyond a period of one day, whereas plants exposed directly to 4 and 9 dsm(-1) NaCl were able to grow and produce biomass. However, plants pre-exposed to NaCl (2 dsm(-1)) for 7 days on subsequent exposure to 13 dsm(-1) NaCl were able to grow and produce biomass although at a slow rate and are hereinafter designated as pre-exposed plants. The pre-exposed and directly exposed plants distinctly differed in their response to salt in terms of lipid peroxidation, proline accumulation, activity of antioxidant enzymes, such as SOD, APX, and CAT, and Na(+)/K(+) ratio. Efficient modulation of antioxidant enzymes coupled with regulation of ion transport play an important role in the induction of salt tolerance. Results show that it is possible to induce salt adaptation in A. microphylla by pre-exposing them to low concentrations of NaCl.
Kunjiappan, Selvaraj; Chowdhury, Ranjana; Bhattacharjee, Chiranjib
2014-06-01
This article reports the environmentally benign synthesis of gold nanoparticles (GNPs) using methanol extract of Azolla microphylla as the stabilizing and reducing agent. The GNPs were characterized by UV-vis spectrophotometry and FTIR, and the morphological characteristics were analyzed by XRD, FESEM-EDX and HRTEM. The GNPs could be formed in very short time, even in less than 30 min. The nanoparticles measured by UV-spectrophotometer demonstrated a peak at 540 nm corresponding to surface plasmon resonance spectra, and the peaks showed by FTIR suggested the presence of organic biomolecules on the surface of the GNPs. XRD results confirmed the crystalline nature of the GNPs, and FESEM-EDX and HRTEM analyses had been performed in the size ranges of 17-40 nm and 1.25-17.5 nm respectively. The synthesized GNPs showed excellent antioxidant activity. This study shows the feasibility of using plant sources for the biosynthesis of GNPs.
Uptake and toxicity of arsenic, copper, and silicon in Azolla caroliniana and Lemna minor.
Rofkar, Jordan R; Dwyer, Daryl F; Bobak, Deanna M
2014-01-01
Here we report on the analysis of two aquatic plant species, Azolla caroliniana and Lemna minor, with respect to tolerance and uptake of co-occurring arsenic, copper, and silicon for use in engineered wetlands. Plants were cultured in nutrient solution that was amended with arsenic (0 or 20 microM), copper (2 or 78 microM), and silicon (0 or 1.8 mM) either singly or in combination. We hypothesized that arsenic and copper would negatively affect the uptake of metals, growth, and pigmentation and that silicon would mitigate those stresses. Tolerance was assessed by measuring growth of biomass and concentrations of chlorophyll and anthocyanins. Both plant species accumulated arsenic, copper, and silicon; L. minor generally had higher levels on a per biomass basis. Arsenic negatively impacted A. caroliniana, causing a 30% decrease in biomass production and an increase in the concentration of anthocyanin. Copper negatively impacted L. minor, causing a 60% decrease in biomass production and a 45% decrease in chlorophyll content. Silicon augmented the impact of arsenic on biomass production in A. caroliniana but mitigated the effect of copper on L. minor. Our results suggest that mixtures of plant species may be needed to maximize uptake of multiple contaminants in engineered wetlands.
Dai, Ling-Peng; Xiong, Zhi-Ting; Huang, Yu; Li, Min-Jing
2006-10-01
This study was designed to examine the effects of cadmium on several color-related parameters (including chlorophyll, carotenoid, and anthocyanin), total phenolics, and phenylalanine ammonia-lyase (PAL) activity in an aquatic fern species Azolla imbricate (A. imbricata). Cd accumulation and effects in the fronds were closely related with Cd concentration in the growth medium. The fronds under 0.5 mg/L Cd treatment turned red on the 3rd day, and this color change also appeared under 0.05 and 0.1 mg/L Cd treatment on the 5th day. Correlated with the color change, the contents of chlorophyll and carotenoid in the fronds significantly decreased in the presence of high Cd concentrations, while the anthocyanin content increased during the experiment. Significant increase in total phenolics content and PAL activity were also detected during Cd treatment. The results suggested that the Cd-induced change in color of fronds might be due to the decrease in chlorophyll and carotenoid and the increase in anthocyanin. Anthocyanin, total phenolics and their biosynthesis-related PAL might play a role in detoxification of Cd in A. imbricata.
Dicty_cDB: Contig-U12529-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0.81 9 ( EJ308578 ) 1095390124987 Global-Ocean-Sampling_GS-27-01-01-1... 34 0.84 3 ( EF520892 ) Azolla... microphylla voucher T. Lumpkin s.n. (DUKE)... 48 0.96 1 ( EF520891 ) Azolla microphyll...a voucher Watanabe s.n. (DUKE) t... 48 0.96 1 ( EF520887 ) Azolla mexicana voucher Zimmerman s.n. (DUKE) tRN...... 48 0.96 1 ( EF520885 ) Azolla mexicana voucher D.W. Rains s.n. (DUKE) tR... 48 0.96 1 ( DQ066515 ) Azo...lla microphylla voucher Reid & Peters 80 tRNA-... 48 0.96 1 ( DQ066511 ) Azolla mic
Amare, Elfu; Kebede, Fassil; Berihu, Tesfay; Mulat, Worku
2017-10-16
This study investigated the concurrent accumulation of eight heavy metals by two floating aquatic macrophytes (Lemna minor and Azolla filiculoides) cultivated in ambient media and blended wastewaters in the semiarid regions of Ethiopia. Both species accumulated heavy metals in varying degrees with a significant concentration gradient within the immediate water media. Highest bioconcentration factor was determined for Mn and Fe in both plants. Results revealed that L. minor was high phytoaccumulator for Fe, Mn, Zn and Co but moderate for Cd, Cu, Ni and Cr. On the other hand, A. filiculoides was a high accumulator for Fe, Mn, Zn and Cu, but its potency was moderate for Co, Cr and Ni, but lower for Cd. Both species exhibited significant difference in accumulating Co, Zn and Mn (p < 0.05). In general, the bioconcentration factors for both plants were comparable within the same treatment. In this study, stronger associations between the heavy metal concentrations in the plant tissues and in the grown water media were observed for A. filiculoides.
Ekman, Martin; Tollbäck, Petter; Bergman, Birgitta
2008-01-01
Cyanobacteria are able to form stable nitrogen-fixing symbioses with diverse eukaryotes. To extend our understanding of adaptations imposed by plant hosts, two-dimensional gel electrophoresis and mass spectrometry (MS) were used for comparative protein expression profiling of a cyanobacterium (cyanobiont) dwelling in leaf cavities of the water-fern Azolla filiculoides. Homology-based protein identification using peptide mass fingerprinting [matrix-assisted laser desorption ionization-time of flight (MALDI-TOF-MS)], tandem MS analyses, and sequence homology searches resulted in an identification success rate of 79% of proteins analysed in the unsequenced cyanobiont. Compared with a free-living strain, processes related to energy production, nitrogen and carbon metabolism, and stress-related functions were up-regulated in the cyanobiont while photosynthesis and metabolic turnover rates were down-regulated, stressing a slow heterotrophic mode of growth, as well as high heterocyst frequencies and nitrogen-fixing capacities. The first molecular data set on the nature of the NifH post-translational modification in cyanobacteria was also obtained: peptide mass spectra of the protein demonstrated the presence of a 300-400 Da protein modification localized to a specific 13 amino acid sequence, within the part of the protein that is ADP-ribosylated in other bacteria and close to the active site of nitrogenase. Furthermore, the distribution of the highest scoring database hits for the identified proteins points to the possibility of using proteomic data in taxonomy.
Restoration using Azolla imbricata increases nitrogen functional bacterial groups and genes in soil.
Lu, Xiao-Ming; Lu, Peng-Zhen; Yang, Ke
2017-05-01
Microbial groups are major factors that influence soil function. Currently, there is a lack of studies on microbial functional groups. Although soil microorganisms play an important role in the nitrogen cycle, systematic studies of the effects of environmental factors on microbial populations in relation to key metabolic processes in the nitrogen cycle are seldom reported. In this study, we conducted a systematic analysis of the changes in nitrogen functional groups in mandarin orange garden soil treated with Azolla imbricata. The structures of the major functional bacterial groups and the functional gene abundances involved in key processes of the soil nitrogen cycle were analyzed using high-throughput sequencing (HTS) and quantitative real-time PCR, respectively. The results indicated that returning A. imbricata had an important influence on the composition of soil nitrogen functional bacterial communities. Treatment with A. imbricata increased the diversity of the nitrogen functional bacteria. The abundances of nitrogen functional genes were significantly higher in the treated soil compared with the control soil. Both the diversity of the major nitrogen functional bacteria (nifH bacteria, nirK bacteria, and narG bacteria) and the abundances of nitrogen functional genes in the soil showed significant positive correlations with the soil pH, the organic carbon content, available nitrogen, available phosphorus, and NH 4 + -N and NO 3 - -N contents. Treatment with 12.5 kg fresh A. imbricata per mandarin orange tree was effective to improve the quality of the mandarin orange garden soil. This study analyzed the mechanism of the changes in functional bacterial groups and genes involved in key metabolic processes of the nitrogen cycle in soil treated by A. imbricata.
Kooh, Muhammad Raziq Rahimi; Lim, Linda B L; Lim, Lee Hoon; Dahri, Muhammad Khairud
2016-02-01
This study investigated the potential of untreated Azolla pinnata (AP) to remove toxic rhodamine B (RB) dye. The effects of adsorbent dosage, pH, ionic strength, contact time, and concentration were studied. Experiments involving the effects of pH and ionic strength indicated that hydrophobic-hydrophobic interactions might be the dominant force of attraction for the RB-AP adsorption system. The kinetics modelling of the kinetics experiment showed that pseudo-second-order best represented the adsorption process. The Weber-Morris intraparticle diffusion model showed that intraparticle diffusion is not the rate-limiting step, while the Boyd model suggested that film diffusion might be rate-limiting. The adsorption isotherm model, Langmuir, best represented the adsorption process, and the maximum adsorption capacity was predicted to be 72.2 and 199.7 mg g(-1) at 25 and 65 °C, respectively. Thermodynamics study indicates spontaneity, endothermic and physisorption-dominant adsorption process. The adsorbents were regenerated to satisfactory level with distilled water, HNO3 and NaOH. Pre-treatment of adsorbent with oxalic acid, citric acid, NaOH, HCl and phosphoric acid was investigated but the adsorption capacity was less than the untreated AP.
Soil Fertility Status on Organic Paddy Experiment
Directory of Open Access Journals (Sweden)
Mujiyo
2015-07-01
Full Text Available The study aims to determine fertility status of the soil after organic paddy experiments using kinds and doses of organic fertilizers. Experiment was conducted at greenhouse laboratory in Faculty of Agriculture Sebelas Maret University Surakarta. Experimental design used completely randomized design with 9 kinds of treatment was replicated 3 times. Experiments were the use of cow manure, Azolla fertilizer, Azolla inoculum and its combinations that are based on fulfilling nutrient requirements of 120 kg N ha-1. Result shows that the use of cow manure, Azolla fertilizers and Azolla inoculum had no effect on changes of soil fertility status. Soil fertility status was not significantly correlated with cow manure (0,16ns, Azolla fertilizer (0,26ns and Azolla inoculum (0,16ns. Average of final soil fertility status included fertile category, which was similar as the initial soil fertility status. Average of final soil properties of treatment but nevertheless was relatively higher than in no treatment, indicating the use of cow manure, Azolla fertilizer, Azolla inoculum and its combinations had greater impact to soil properties. Cow manure despite increased available K2O and dry grain, but it did not significantly increase the soil fertility status from fertile to very fertile. This was presumably due to the relatively short experiment period, only one planting season had not given significant effect to soil properties. Implication of this study is the use of cow manure, Azolla fertilizer, Azolla inoculum and its combinations although did not increase the soil fertility status but could maintain soil fertility status as the initial conditions before planting.
Kösesakal, Taylan; Ünal, Muammer; Kulen, Oktay; Memon, Abdülrezzak; Yüksel, Bayram
2016-01-01
In this study, the phytoremediation capacity of Azolla filiculoides Lam. for the water resources contaminated with petroleum hydrocarbons was investigated. The plants were grown in nitrogen-free Hoagland nutrient solution containing 0.005%, 0.01%, 0.05%, 0.1%, 0.2%, 0.3%, 0.4%, and 0.5% crude oil under greenhouse conditions for 15 days. Although the growth rate of the plants were not negatively influenced by the presence of crude oil in the media for the concentration of 0.005% and 0.01% v/v, a gradual impeding effect of crude oil in the growth media has been observed at concentrations 0.05-0.1%. More than 0.1% crude oil in the growth medium ostensibly retarded the growth. For example, 0.2% oil in the media reduced growth approximately 50% relative to the control, and the presence of crude oil at concentrations 0.3% or more were lethal. The data about the percentage of plant growth, fresh weight increase and root growth clearly indicated that the tolerance level of A. filiculoides plants to crude oil ranges between 0.1% and 0.2%. In comparison to control samples, the biodegradation rate of total aliphatic and aromatic (phenathrene) hydrocarbons at 0.05-0.2% oil concentrations, was 94-73% and 81-77%, respectively. On the other hand, in case of further increases in oil concentration in media, i.e.; 0.3-0.5%, the biodegradation rate was still higher in the experimental samples, respectively 71-63% and 75-71%. The high biodegradation rates of petroleum hydrocarbons in the experimental samples suggested that A. filiculoides plants could be a promising candidate to be used for the phytoremediation of low crude oil contaminated precious freshwater resources.
Is there foul play in the leaf pocket? The metagenome of floating fern
Dijkhuizen, L.W.; Brouwer, P.; Bolhuis, H.; Reichart, G.-J.; Koppers, N.; Huettel, B.; Bolger, A.M.; Li, F.-W.; Cheng, S.; Liu, X.; Wong, G.K.-S.; Pryer, K.; Weber, A.; Bräutigam, A.; Schluepmann, H.
2018-01-01
Dinitrogen fixation by Nostoc azollae residing in specialized leaf pockets supports prolific growth of the floating fern Azolla filiculoides. To evaluate contributions by further microorganisms, the A. filiculoides microbiome and nitrogen metabolism in bacteria persistently associated with Azolla
Directory of Open Access Journals (Sweden)
Mousumi Das
2018-03-01
Full Text Available Aquatic fern Azolla pinnata comprises significant high food value with a good proportion of protein, vitamins, and minerals. This study was carried out to examine the effect of fresh A. pinnata as a substitution of commercial fish feed (CFF for Thai silver barb Barbonymus gonionotus. Post fingerlings of B. gonionotus were reared in five treatments, labeled T1 to T5, by substituting 0%, 25%, 50%, 75%, and 100% protein of CFF with A. pinnata protein (dry matter basis respectively for 56 days. The specific growth rate, net production rate, protein efficiency ratio, proximate composition, and overall conditions of fish were not significantly varied between the fish reared completely with CFF and 25% substitution with A. pinnata. However, a significantly higher profit rate (431.49 USD ha−1 56 day−1 was calculated for fish reared in T2 than other treatments. In contrast, there was a significant reduction of growth and other parameters of the fish that were observed in the case where more than 25% CFF was substituted with A. pinnata. The poorest performance was observed in fish fed completely with A. pinnata, at T5. Based on the results, 25% of CFF of Thai silver barb could be substituted with fresh A. pinnata without significantly lowering their growth and product quality and could contribute significant to a higher profit margin.
International Nuclear Information System (INIS)
Ali, Muhammad Aslam; Kim, P.J.; Inubushi, K.
2015-01-01
Effects of different soil amendments were investigated on methane (CH 4 ) and nitrous oxide (N 2 O) emissions, global warming potential (GWP) and yield scaled GWPs in paddy soils of Republic of Korea, Japan and Bangladesh. The experimental treatments were NPK only, NPK + fly ash, NPK + silicate slag, NPK + phosphogypsum(PG), NPK + blast furnace slag (BFS), NPK + revolving furnace slag (RFS), NPK + silicate slag (50%) + RFS (50%), NPK + biochar, NPK + biochar + Azolla-cyanobacteria, NPK + silicate slag + Azolla-cyanobacteria, NPK + phosphogypsum (PG) + Azolla-cyanobacteria. The maximum decrease in cumulative seasonal CH 4 emissions was recorded 29.7% and 32.6% with Azolla-cyanobacteria plus phospho-gypsum amendments in paddy soils of Japan and Bangladesh respectively, followed by 22.4% and 26.8% reduction with silicate slag plus Azolla-cyanobacteria application. Biochar amendments in paddy soils of Japan and Bangladesh decreased seasonal cumulative N 2 O emissions by 31.8% and 20.0% respectively, followed by 26.3% and 25.0% reduction with biochar plus Azolla-cyanobacteria amendments. Although seasonal cumulative CH 4 emissions were significantly increased by 9.5–14.0% with biochar amendments, however, global warming potentials were decreased by 8.0–12.0% with cyanobacterial inoculation plus biochar amendments. The maximum decrease in GWP was calculated 22.0–30.0% with Azolla-cyanobacteria plus silicate slag amendments. The evolution of greenhouse gases per unit grain yield (yield scaled GWP) was highest in the NPK treatment, which was decreased by 43–50% from the silicate slag and phosphogypsum amendments along with Azolla-cyanobacteria inoculated rice planted soils. Conclusively, it is recommended to incorporate Azolla-cyanobacteria with inorganic and organic amendments for reducing GWP and yield scaled GWP from the rice planted paddy soils of temperate and subtropical countries. - Highlights: • Azolla-cyanobacteria with organic and inorganic amendments
Batch and column studies on biosorption of acid dyes on fresh water macro alga Azolla filiculoides.
Padmesh, T V N; Vijayaraghavan, K; Sekaran, G; Velan, M
2005-10-17
The biosorption of Acid red 88 (AR88), Acid green 3 (AG3) and Acid orange 7 (AO7) by deactivated fresh water macro alga Azolla filiculoides was investigated in batch mode. Langmuir and Freundlich adsorption models were used for the mathematical description of the batch biosorption equilibrium data and model constants were evaluated. The adsorption capacity was pH dependent with a maximum value of 109.0 mg/g at pH 7 for AR88, 133.5 mg/g at pH 3 for AG3 and 109.6 mg/g at pH 3 for AO7, respectively, was obtained. The pseudo first and second order kinetic models were also applied to the experimental kinetic data and high correlation coefficients favor pseudo second order model for the present systems. The ability of A. filiculoides to biosorb AG3 in packed column was also investigated. The column experiments were conducted to study the effect of important design parameters such as initial dye concentration (50-100 mg/L), bed height (15-25 cm) and flow rate (5-15 mL/min) to the well-adsorbed dye. At optimum bed height (25 cm), flow rate (5 mL/min) and initial dye concentration (100 mg/L), A. filiculoides exhibited 28.1mg/g for AG3. The Bed Depth Service Time model and the Thomas model were used to analyze the experimental data and the model parameters were evaluated.
Forni, C; Braglia, R; Harren, F J M; Cristescu, S M
2012-04-01
Surfactants are used for several purposes and recently they have attracted the attention for their ability to modify the behavior of other preexistent or co-disposed contaminants, although their use or discharge in wastewaters can represent a real or potential risk for the environment. Lemna minor L. and Azolla filiculoides Lam. are floating aquatic macrophytes, very effective in accumulating several pollutants including sodium dodecyl sulphate (SDS). In this work we evaluated the effects of SDS on these species by determining the stress ethylene production via laser-based trace gas detection, and the activities of enzymes involved in stress response, such as guaiacol peroxidase (G-POD), phenylalanine ammonia-lyase (PAL) and polyphenol-oxidase (PPO). Phenolics content was also determined. The macrophytes were treated with different concentrations of SDS for one week. SDS affected duckweed enzymatic activities and phenol content. While in the fern phenolics amount, PAL, G-POD and PPO activities were not affected by SDS except for 100 ppm SDS, the only concentration that was taken up and not completely degraded. Stress ethylene production was induced only in the fern treated with 50 and 100 ppm SDS. Copyright © 2011 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Ali, Muhammad Aslam, E-mail: litonaslam@yahoo.com [Dept. of Environmental Science, Bangladesh Agricultural University, Mymensingh 2202 (Bangladesh); Dept. of Agricultural Chemistry, Gyeongsang National University, Jinju (Korea, Republic of); Division of Environmental Horticulture, Chiba University, Matsudo, Chiba 271-8510 (Japan); Kim, P.J., E-mail: pjkim@nongae.gsnu.ac.kr [Dept. of Agricultural Chemistry, Gyeongsang National University, Jinju (Korea, Republic of); Inubushi, K. [Division of Environmental Horticulture, Chiba University, Matsudo, Chiba 271-8510 (Japan)
2015-10-01
Effects of different soil amendments were investigated on methane (CH{sub 4}) and nitrous oxide (N{sub 2}O) emissions, global warming potential (GWP) and yield scaled GWPs in paddy soils of Republic of Korea, Japan and Bangladesh. The experimental treatments were NPK only, NPK + fly ash, NPK + silicate slag, NPK + phosphogypsum(PG), NPK + blast furnace slag (BFS), NPK + revolving furnace slag (RFS), NPK + silicate slag (50%) + RFS (50%), NPK + biochar, NPK + biochar + Azolla-cyanobacteria, NPK + silicate slag + Azolla-cyanobacteria, NPK + phosphogypsum (PG) + Azolla-cyanobacteria. The maximum decrease in cumulative seasonal CH{sub 4} emissions was recorded 29.7% and 32.6% with Azolla-cyanobacteria plus phospho-gypsum amendments in paddy soils of Japan and Bangladesh respectively, followed by 22.4% and 26.8% reduction with silicate slag plus Azolla-cyanobacteria application. Biochar amendments in paddy soils of Japan and Bangladesh decreased seasonal cumulative N{sub 2}O emissions by 31.8% and 20.0% respectively, followed by 26.3% and 25.0% reduction with biochar plus Azolla-cyanobacteria amendments. Although seasonal cumulative CH{sub 4} emissions were significantly increased by 9.5–14.0% with biochar amendments, however, global warming potentials were decreased by 8.0–12.0% with cyanobacterial inoculation plus biochar amendments. The maximum decrease in GWP was calculated 22.0–30.0% with Azolla-cyanobacteria plus silicate slag amendments. The evolution of greenhouse gases per unit grain yield (yield scaled GWP) was highest in the NPK treatment, which was decreased by 43–50% from the silicate slag and phosphogypsum amendments along with Azolla-cyanobacteria inoculated rice planted soils. Conclusively, it is recommended to incorporate Azolla-cyanobacteria with inorganic and organic amendments for reducing GWP and yield scaled GWP from the rice planted paddy soils of temperate and subtropical countries. - Highlights: • Azolla-cyanobacteria with organic and
Directory of Open Access Journals (Sweden)
Simona Paolacci
2018-06-01
Full Text Available A substantial number of Lemnaceae are invasive outside their natural distribution area. Lemna minuta is considered invasive in several European countries, where it can occur in the same habitat as invasive Azolla filiculoides and native Lemna minor. In this study the presence, abundance and growth rates of all three species were monitored across 24 natural ponds and in a series of mesocosms in order to explore the importance of species invasiveness and habitat invisibility. Field monitoring showed that the distribution of the three species of macrophytes is heterogeneous in space and time. However, the data show no association of nutrient or light levels with plant distribution. Indeed, using reciprocal transplanting experiments it was demonstrated that all species are able to grow in all ponds, even ponds where the species do not naturally occur. It is concluded that distribution of L. minor, L. minuta, and A. filiculoides is not limited by the prevailing physicochemical characteristics of the ponds during the summer period. Remarkably, in these experiments A. filiculoides displayed the highest RGR, and exerted a negative influence on growth rates and surface cover of L. minor and L. minuta. Despite such apparent invasiveness, A. filiculoides was relatively rare in the study area. Rather, the species most abundant was L. minor which has the lowest RGR under field conditions in summer. Therefore, this study shows that the invasiveness of the species during the summer months is not necessarily reflected in the actual distribution pattern in natural ponds. In fact, alien L. minuta and A. filiculoides are under-represented in the monitored area. It is concluded that the interaction of several factors, including growth under winter-conditions and/or dispersal after disturbances, is the major determinant of the abundance and heterogeneous distribution of L. minor, L. minuta, and A. filiculoides in the study area.
SOIL N, P AND K CONCENTRATIONS AND RICE YIELD INCREASED DUE TO THE APPLICATION OF Azolla pinnata
Directory of Open Access Journals (Sweden)
A. Arivin Rivaie*
2014-01-01
Full Text Available Many studies showed that application of Azolla pinnata as biofertilizer improved soil fertility some agricultural crops, including rice, whereas farmers in Lampung consider that A. pinnata suppresses growth of rice seedlings, so they throw it field by raising irrigation water surface. Information on effects A. pinnata application on changes in nutrient availability and rice yield obtained from paddy fields of regions still rare. A study was carried out to investigate effects of different rates of A. pinnata on changes in N, P, K concentrations in paddy soils, N uptake, and rice yield. A well-irrigated paddy field was incorporated with A. pinnata, and then rice seedlings of Ciherang variety had been grown from June up to December 2009. Results: application of A. pinnata at dose of five t per ha increased concentration of N, P and K as well as rice yield. A. pinnata had a relatively high N content, ie 2.43 percent. Application of A. pinnata of 7.5 t per ha increased significantly available soil P, indicated that A. pinnata requires a fairly high P to grow optimally. Application of A. pinnata of 7.5 t per ha gave highest dry grain yield, suggests that application A. pinnata did not suppress rice yield, even use of A. pinnata as organic matter source will help to conserve fossil fuels and foreign exchange as well as will allow more paddy fields that can be fertilized by N.
Ali, Muhammad Aslam; Kim, P J; Inubushi, K
2015-10-01
Effects of different soil amendments were investigated on methane (CH4) and nitrous oxide (N2O) emissions, global warming potential (GWP) and yield scaled GWPs in paddy soils of Republic of Korea, Japan and Bangladesh. The experimental treatments were NPK only, NPK+fly ash, NPK+silicate slag, NPK+phosphogypsum(PG), NPK+blast furnace slag (BFS), NPK+revolving furnace slag (RFS), NPK+silicate slag (50%)+RFS (50%), NPK+biochar, NPK+biochar+Azolla-cyanobacteria, NPK+silicate slag+Azolla-cyanobacteria, NPK+phosphogypsum (PG)+Azolla-cyanobacteria. The maximum decrease in cumulative seasonal CH4 emissions was recorded 29.7% and 32.6% with Azolla-cyanobacteria plus phospho-gypsum amendments in paddy soils of Japan and Bangladesh respectively, followed by 22.4% and 26.8% reduction with silicate slag plus Azolla-cyanobacteria application. Biochar amendments in paddy soils of Japan and Bangladesh decreased seasonal cumulative N2O emissions by 31.8% and 20.0% respectively, followed by 26.3% and 25.0% reduction with biochar plus Azolla-cyanobacteria amendments. Although seasonal cumulative CH4 emissions were significantly increased by 9.5-14.0% with biochar amendments, however, global warming potentials were decreased by 8.0-12.0% with cyanobacterial inoculation plus biochar amendments. The maximum decrease in GWP was calculated 22.0-30.0% with Azolla-cyanobacteria plus silicate slag amendments. The evolution of greenhouse gases per unit grain yield (yield scaled GWP) was highest in the NPK treatment, which was decreased by 43-50% from the silicate slag and phosphogypsum amendments along with Azolla-cyanobacteria inoculated rice planted soils. Conclusively, it is recommended to incorporate Azolla-cyanobacteria with inorganic and organic amendments for reducing GWP and yield scaled GWP from the rice planted paddy soils of temperate and subtropical countries. Copyright © 2015 Elsevier B.V. All rights reserved.
Santos, Catarina; Azevedo, Joana; Campos, Alexandre; Vasconcelos, Vitor; Pereira, Ana L
2015-11-01
Physiological and biochemical effects of cylindrospermopsin (CYN), a cyanobacterial toxin that inhibits protein synthesis and released during a harmful cyanobacterial bloom, has been overlooked in plants. Therefore, at the present research, the toxic effects (physiological and biochemical) of a crude extract containing CYN were assessed in the aquatic fern Azolla filiculoides exposed to three concentrations (0.05, 0.5 and 5 μg CYN mL(-1)). At 5 μg CYN mL(-1), fern growth rate has showed a drastic decrease (0.001 g g(-1) day(-1)) corresponding to a 99.8% inhibition, but at the concentrations of 0.05 and 0.5 μg CYN mL(-1) the growth rate was similar to the control plants. Growth rate also indicated a IC50 of 2.9 μg CYN mL(-1). Those data point to the presence of other compounds in the crude extract may stimulate the fern growth and/or the fern is tolerant to CYN. Chlorophyll (a and b), carotenoids and protein content as well as the activities of glutathione reductase (GR) and glutathione-S-transferase (GST) has increased at 5 μg CYN mL(-1) which may indicate that photosynthesis and protein synthesis are not affected by CYN and the probable activation of defense and detoxifying mechanisms to overcome the effects induced by the presence of CYN. Low uptake of cylindrospermopsin (1.314 μg CYN g(-1) FW) and low bioconcentration factor (0.401) point towards to a safe use of A. filiculoides as biofertilizer and as food source, but also indicate that the fern is not suitable for CYN phytoremediation.
Lifescience Database Archive (English)
Full Text Available tion tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides...lignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculo
Lifescience Database Archive (English)
Full Text Available |Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides Align length ...ts) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 47 ...entus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2
Lifescience Database Archive (English)
Full Text Available r|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides Align...nts: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...thus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides G
Lifescience Database Archive (English)
Full Text Available M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla fil...ificant alignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...onein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Lifescience Database Archive (English)
Full Text Available S3M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla f...gnificant alignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...hionein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Kordyum, V. A.; Man'ko, V. G.; Popova, A. F.; Shcherbak, O. H.; Mashinsky, A. L.; Nguen-Hgue-Thyok
The miniature cenosis consisting of the water fern Azolla with its associated symbiotic nitrogen-fixing cyanobacterium Anabaena and the concomitant bacteria was investigated. Ecological closure was shown to produce sharp quantitative and qualitative changes in the number and type of concomitant bacteria. Changes in the distribution of bacterial types grown on beef-extract broth after space flight were recorded. Anabaena azollae underwent the most significant changes under spaceflight conditions. Its cell number per Azolla biomass unit increased substantially. Thus closure of cenosis resulted in a weakening of control over microbial development by Azolla. This tendency was augmented by spaceflight factors. Reduction in control exerted by macro-organisms over development of associated micro-organisms must be taken into account in constructing closed ecological systems in the state of weightlessness.
Lifescience Database Archive (English)
Full Text Available t_id Q8S3M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...cing significant alignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...etallothionein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Lifescience Database Archive (English)
Full Text Available t_id Q8S3M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...cing significant alignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...etallothionein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Kooh, Muhammad Raziq Rahimi; Lim, Linda B L; Lim, Lee-Hoon; Malik, Owais Ahmed
2018-04-16
This study investigated the potential of Azolla pinnata (AP) in the removal of toxic methyl violet 2B (MV) dye wastewater using the phytoextraction approach with the inclusion of an Artificial Neural Network (ANN) modelling. Parameters examined included the effects of dye concentration, pH and plant dosage. The highest removal efficiency was 93% which was achieved at a plant dosage of 0.8 g (dye volume = 200 mL, initial pH = 6.0, initial dye concentration = 10 mg L -1 ). A significant decrease in relative frond number (RFN), a growth rate estimator, observed at a dye concentration of 20 mg L -1 MV indicated some toxicity, which coincided with the plant pigments studies where the chlorophyll a content was lower than the control. There were little differences in the plant pigment contents between the control and those in the presence of dye (5 to 15 mg L -1 ) indicating the tolerance of AP to MV at lower concentrations. A three-layer ANN model was optimized (6 neurons in the hidden layer) and successfully predicted the phytoextraction of MV (R = 0.9989, RMSE = 0.0098). In conclusion, AP proved to be a suitable plant that could be used for the phytoextraction of MV while the ANN modelling has shown to be a reliable method for the modelling of phytoextraction of MV using AP.
Lifescience Database Archive (English)
Full Text Available rEMBL tr_hit_id Q8S3M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoid...ences producing significant alignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...G67_AMACR Metallothionein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Metabolic adaptation, a specialized leaf organ structure and vascular responses to diurnal N
Brouwer, Paul; Bräutigam, Andrea; Buijs, Valerie A.; Tazelaar, Anne O.E.; Werf, van der Adrie; Schlüter, Urte; Reichart, Gert Jan; Bolger, Anthony; Usadel, Björn; Weber, Andreas P.M.; Schluepmann, Henriette
2017-01-01
Sustainable agriculture demands reduced input of man-made nitrogen (N) fertilizer, yet N2 fixation limits the productivity of crops with heterotrophic diazotrophic bacterial symbionts. We investigated floating ferns from the genus Azolla that host phototrophic diazotrophic Nostoc azollae in leaf
Nierop, K.G.J.; Speelman, E.N.; de Leeuw, J.W.; Reichart, G.J.
2011-01-01
Several studies have reported the presence of large amounts of lignin in ubiquitously occurring species of the freshwater fern Azolla. Molecular analysis using flash pyrolysis and thermally assisted hydrolysis and methylation shows, however, that neither the leaves nor the roots of Azolla contain
Lifescience Database Archive (English)
Full Text Available TrEMBL tr_hit_id Q8S3M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...llothionein-like protein 2 OS=Azolla ... 47 6e-04 tr|Q1W3C8|Q1W3C8_CAMSI Metallothionin 2 OS=Camellia sinens...4G67_AMACR Metallothionein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Kunjiappan, Selvaraj; Bhattacharjee, Chiranjib; Chowdhury, Ranjana
2015-06-01
The present study aims to evaluate the hepatoprotective and antioxidant effects of gold nanoparticles (GNaP) biosynthesized through the mediation of Azolla microphylla and A. microphylla extract on acetaminophen-induced hepatocyte damage in common carp fish (Cyprinus carpio L.). The gold nanoparticles (100, 150, 200 μg/ml) and A. microphylla extract powder (100, 200, 400 μg/ml) were added to the primary hepatocytes in different conditions: treatment I (before 12 mM acetaminophen), treatment II (after 12 mM acetaminophen), and treatment III (both before and after 12 mM acetaminophen), and incubated. Among these, control group treated with 12 mM acetaminophen produced significantly elevated levels (50-80%) of lactate dehydrogenase (LDH), catalase (CAT), glutamate oxalate transaminase (GOT), glutamate pyruvate transaminase (GPT), and malondialdehyde (MDA), and significantly decreased the levels (60-75%) of superoxide dismutase (SOD) and glutathione peroxidase (GSH-Px). Treatment with methanol extract of A. microphylla phytochemically biosynthesized gold nanoparticles (100, 150, 200 μg/ml) and A. microphylla methanol extract powder (100, 200, 400 μg/ml) significantly improved the viability of cells in a culture medium. It also significantly reduced the levels of LDH, CAT, GOT, GPT, and MDA, and significantly increased the levels of SOD and GSH-Px. In conclusion, gold nanoparticles biosynthesized through A. microphylla demonstrated effective hepatoprotective and antioxidant effects than methanol extract of A. microphylla.
Lifescience Database Archive (English)
Full Text Available M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 54 3e-06 tr|O81528|O81528_MESCR Metallothionein OS=Mes...etallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Length = 77 Score = 54.3 bits (129),
Piekarska-Stachowiak, Anna; Nakielski, Jerzy
2013-12-01
In contrast to seed plants, the roots of most ferns have a single apical cell which is the ultimate source of all cells in the root. The apical cell has a tetrahedral shape and divides asymmetrically. The root cap derives from the distal division face, while merophytes derived from three proximal division faces contribute to the root proper. The merophytes are produced sequentially forming three sectors along a helix around the root axis. During development, they divide and differentiate in a predictable pattern. Such growth causes cell pattern of the root apex to be remarkably regular and self-perpetuating. The nature of this regularity remains unknown. This paper shows the 2D simulation model for growth of the root apex with the apical cell in application to Azolla pinnata. The field of growth rates of the organ, prescribed by the model, is of a tensor type (symplastic growth) and cells divide taking principal growth directions into account. The simulations show how the cell pattern in a longitudinal section of the apex develops in time. The virtual root apex grows realistically and its cell pattern is similar to that observed in anatomical sections. The simulations indicate that the cell pattern regularity results from cell divisions which are oriented with respect to principal growth directions. Such divisions are essential for maintenance of peri-anticlinal arrangement of cell walls and coordinated growth of merophytes during the development. The highly specific division program that takes place in merophytes prior to differentiation seems to be regulated at the cellular level.
Directory of Open Access Journals (Sweden)
Kanangire, CK.
2002-01-01
Full Text Available Effects of Azolla-based Meal on the Production of an Agro-piscicultural Ecosystem in Rwanda Marshlands. Cette étude analyse les différences de caractères au niveau de la descendance des croisements interspécifiques entre Sesamum indicum L. et Ceratotheca sesamoides Endl. Les résultats obtenus montrent que l'héritabilité de la présence d'une forte pilosité sur les tiges et sur les pétioles est contrôlée par deux gènes assortis et indépendants. Les deux gènes dominants S et P confèrent aux plantes une importante pilosité sur les tiges et sur les pétioles tandis qu'un allèle dominant S-pp et ss-P confère aux plantes une pilosité respectivement abondante sur les tiges st sur les pétioles. Seuls les génotypes homozygotes sspp avec deux gènes récessifs produisent des plantes avec peu de poils sur les tiges et sur les pétioles. Les implications de ces résultats dans l'évolution de ces espèces sont discutées.
Lifescience Database Archive (English)
Full Text Available ionein-like type 1 protein OS=Ip... 57 5e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1
Lifescience Database Archive (English)
Full Text Available Metallothionein-like protein 2 OS=Azolla ... 57 6e-07 tr|O81529|O81529_MESCR Metallothionein OS=Mesembryant...S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Length = 77 Score
Effect of Two Kinds of Green Manure and Urea on Production and N Uptake by Lowland Rice
International Nuclear Information System (INIS)
Haryanto; Idawati; Havid Rasjid; Elsje L Sisworo
2004-01-01
One field experiment has been conducted to study effect of two kinds of green manure and urea on production and N uptake in lowland rice. This experiment were used 11 treatments : (U) applying urea fertilizer at dose 200 kg urea/ha or recommended dose, (1/2 U) urea at 100 kg/ha, (1/2 U + Az) urea at 100 kg/ha + Azolla inoculation, (1/2 U + S) urea at 100 kg/ha + Sesbania incorporated at 50 DAT (days after transplanting), (Az + S) Azolla inoculation + Sesbania incorporated at 50 DAT, (Az + Sph) Azolla inoculation + Sesbania crop imported into the soil as green manure applied at preparation time of the land, (1/2 U + Az + S) treatment of (Az + S) combined with 100 kg urea/ha application, (1/2 U + Az + Sph) treatment of (Az + Sph) combined with 100 kg urea/ha application, (A) inoculation of Azolla, (S) Sesbania incorporated at 50 DAT, and Control (without urea, Azolla, and Sesbania). Lowland rice variety Cilosari was used in this experiment. This experiment was designed by Randomized Complete Block Design with 4 replicates for each treatment. To study the N-derived from fertilizer and green manure the 15 N isotope technique was used with the non direct method. Labelled 15 N ammonium sulphate with 10.12% 15 N was applied at 1 m x 1 m isotope plots for each plot in this experiment. The result showed that treatment combination of 100 kg urea/ha + Azolla inoculation + Sesbania crop incorporated into the soil as green manure applied at preparation time of the land gave N availability of soil higher than that resulted by 200 kg Urea/ha application. These treatments were not significantly different for total N uptake and N-derived from fertilizer in the rice grain. (author)
Lifescience Database Archive (English)
Full Text Available AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 6e-07 tr|O81529|O81529_MESCR Metallothionein OS=Mesemb...tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Length = 77
Directory of Open Access Journals (Sweden)
Claudio Rossano Trindade Trindade
2011-12-01
Full Text Available AIM: This study determined the temporal variation of the biomass and the concentrations of carbon, nitrogen and phosphorus in Azolla filiculoides Lam. in a small (0.5 ha shallow dystrophic lake located in the city of Rio Grande (Rio Grande do Sul State, Brazil. METHOD: Sampling was conducted monthly between November 2000 and October 2001. The macrophytes were collected randomly in three replicates with a circular collector 0.3 m in diameter and subsequently washed with tap water and oven-dried at 60 ºC for determination of the dry weight and the nutrient status (i.e., carbon, nitrogen and phosphorus. Primary productivity was estimated by the variation in biomass among successive samples. RESULTS: A. filiculoides was present in the lake throughout the year and occupied between 50 and 80% of the surface area. The biomass values ranged from 34.2 g DW.m-2, recorded in May (autumn, to 170.9 g DW.m-2 in January (summer. The highest rate of primary productivity was 3.3 g DW.m-2.d-1, observed in June. The concentrations of carbon, nitrogen and phosphorus in the plant ranged between 403 and 551 g.kg-1, 13.4 and 25.7 g.kg-1 and 0.5 and 1.9 g.kg-1, respectively. The water N:P ratio ranged between 19:1 and 368:1. CONCLUSION: The coverage of the surface of the lake by A. filiculoides throughout the study period and the nutritional status of the plant demonstrate the importance of the cycling of nutrients by macrophytes in this aquatic environment. The higher N:P ratio in the water column, compared with other neighboring environments without macrophytes, shows that the enrichment of the lake may result from the biological N-fixation activity produced by A. filiculoides.OBJETIVO: Este estudo determinou a variação temporal da biomassa e as concentrações de carbono, nitrogênio e fósforo de Azolla filiculoides Lam., em um pequeno lago raso distrófico situado no município do Rio Grande (Rio Grande do Sul, Brasil. MÉTODO: As amostragens foram realizadas
Lifescience Database Archive (English)
Full Text Available ke protein OS=Ipomoea b... 57 4e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 6...SNC C DPC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Lifescience Database Archive (English)
Full Text Available OS=Ipomoea b... 57 3e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 6e-07 tr|O8...PC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla f
Lifescience Database Archive (English)
Full Text Available 8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 2e-06 tr|O81529|O81529_MESCR Metallothion...DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Le
Cohen, Michael F; Gurung, Sushma; Fukuto, Jon M; Yamasaki, Hideo
2014-03-01
Shedding of organs by abscission is a key terminal step in plant development and stress responses. Cell wall (CW) loosening at the abscission zone can occur through a combination chain breakage of apoplastic polysaccharides and tension release of cellulose microfibrils. Two distinctly regulated abscission cleavage events are amenable to study in small water ferns of the genus Azolla; one is a rapid abscission induced by environmental stimuli such as heat or chemicals, and the other is an ethylene-induced process occurring more slowly through the action of hydrolytic enzymes. Although free radicals are suggested to be involved in the induction of rapid root abscission, its mechanism is not fully understood. The apoplast contains peroxidases, metal-binding proteins and phenolic compounds that potentially generate free radicals from H2O2 to cleave polysaccharides in the CW and middle lamella. Effects of various thiol-reactive agents implicate the action of apoplastic peroxidases having accessible cysteine thiols in rapid abscission. The Ca(2+) dependency of rapid abscission may reflect the stabilization Ca(2+) confers to peroxidase structure and binding to pectin. To spur further investigation, we present a hypothetical model for small signaling molecules H2O2 and NO and their derivatives in regulating, via modification of putative protein thiols, free radical attack of apoplastic polysaccharides. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.
Lifescience Database Archive (English)
Full Text Available 34 3.2 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 34 3.2 tr|B5U0R0|B5U0R0_ANABR Met...7 +DHD Sbjct: 192 TGHDHD 197 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Setiawati, Mieke Rochimi; Damayani, Maya; Herdiyantoro, Diyan; Suryatmana, Pujawati; Anggraini, Derisfha; Khumairah, Fiqriah Hanum
2018-02-01
The yield of rice plants is strongly influenced by N fertilizer. Nitrogen in rice plants has roles in vegetative growth, tiller formation and increasing yield through rice protein formation. Nitrogen supplied from organic fertilizers is better than inorganic fertilizers that may have environmental problem effects. Organic fertilizers from Azolla pinnata water fern contain higher N than other organic fertilizers. Symbiosis between A. pinnata and the N-fixing cyanobacteria results in high content of nitrogen, 3 to 5%. A. pinnata can be added to the rice field as organic fertilizer in form of fresh biomass or composted. Composted form can be ground into powder which passes through 100 mesh sieve. Preparation of compost powder of A. pinnata is done to reduce the constraints of voluminous application of organic fertilizers and to improve the efficiency of its use. The objective of this research was to compare the effect of the use of fresh A. pinnata and compost powder of A. pinnata on some soil and plant chemical properties and rice yield. The treatments applied were fresh A. pinnata at the dose of 0, 10 and 20 ton ha-1 and A. pinnata compost powder at 12.5 and 25 kg ha-1. The results showed that incorporation of fresh A. pinnata at 20 tons ha-1 and its compost powder at 25 kg ha-1 increased the available P of soil, plant P content and tiller number, but did not affect the content of organic-C, total soil N, plant N content and rice yield. This study suggested the benefits of A. pinnata compost powder technology in organic fertilization of soil to increase the nutrient content of soil and rice plants.
Lifescience Database Archive (English)
Full Text Available otein OS=Ipomoea b... 57 3e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...onein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Length = 77 Score = 56.6 bits (135), Expect =...C C DPC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothi
Energy Technology Data Exchange (ETDEWEB)
Vieira, Ludmila Cabreira
2016-07-01
Radioactive waste as any other type of waste should be treated and disposed adequately. It is necessary to consider its physical, chemical and radiological characteristics for choosing the appropriate action for the treatment and final disposal. Many treatment techniques currently used are economically costly, often invalidating its use and favoring the study of other treatment techniques. One of these techniques is biosorption, which demonstrates high potential when applied to radioactive waste. This technology uses materials of biological origin for removing metals. Among potential biosorbents found, macrophyte aquatics are useful because they may remove uranium present in the liquid radioactive waste at low cost. This study aims to evaluate the biosorption capacity of macrophyte aquatics Pistia stratiotes, Limnobium laevigatum, Lemna sp and Azolla sp in the treatment of liquid radioactive waste. This study was divided into two stages, the first one is characterization and preparation of biosorption and the other is tests, carried out with uranium solutions and real samples. The biomass was tested in its raw form and biosorption assays were performed in polypropylene vials containing 10 ml of solution of uranium or 10ml of radioactive waste and 0.20g of biomass. The behavior of biomass was evaluated by sorption kinetics and isotherm models. The highest sorption capacities found was 162.1 mg / g for the macrophyte Lemna sp and 161.8 mg / g for the Azolla sp. The equilibrium times obtained were 1 hour for Lemna sp, and 30 minutes for Azolla sp. With the real waste, the macrophyte Azolla sp presented a sorption capacity of 2.6 mg / g. These results suggest that Azolla sp has a larger capacity of biosorption, therefore it is more suitable for more detailed studies of treatment of liquid radioactive waste. (author)
Application of macrophytes as biosorbents for radioactive liquid waste treatment
International Nuclear Information System (INIS)
Vieira, Ludmila Cabreira
2016-01-01
Radioactive waste as any other type of waste should be treated and disposed adequately. It is necessary to consider its physical, chemical and radiological characteristics for choosing the appropriate action for the treatment and final disposal. Many treatment techniques currently used are economically costly, often invalidating its use and favoring the study of other treatment techniques. One of these techniques is biosorption, which demonstrates high potential when applied to radioactive waste. This technology uses materials of biological origin for removing metals. Among potential biosorbents found, macrophyte aquatics are useful because they may remove uranium present in the liquid radioactive waste at low cost. This study aims to evaluate the biosorption capacity of macrophyte aquatics Pistia stratiotes, Limnobium laevigatum, Lemna sp and Azolla sp in the treatment of liquid radioactive waste. This study was divided into two stages, the first one is characterization and preparation of biosorption and the other is tests, carried out with uranium solutions and real samples. The biomass was tested in its raw form and biosorption assays were performed in polypropylene vials containing 10 ml of solution of uranium or 10ml of radioactive waste and 0.20g of biomass. The behavior of biomass was evaluated by sorption kinetics and isotherm models. The highest sorption capacities found was 162.1 mg / g for the macrophyte Lemna sp and 161.8 mg / g for the Azolla sp. The equilibrium times obtained were 1 hour for Lemna sp, and 30 minutes for Azolla sp. With the real waste, the macrophyte Azolla sp presented a sorption capacity of 2.6 mg / g. These results suggest that Azolla sp has a larger capacity of biosorption, therefore it is more suitable for more detailed studies of treatment of liquid radioactive waste. (author)
Lifescience Database Archive (English)
Full Text Available hit_id Q8S3M2 Definition tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...ducing significant alignments: (bits) Value tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azoll... Metallothionein OS=Amaranthus cruentus PE... 41 0.026 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla
Protein (Cyanobacteria): 175822 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available agen triple helix repeat-containing protein 'Nostoc azollae' 0708 MRLIEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGGEIFLMPYALCPMPYALCPMPYALCPMPYALCPMPYALCPMPYAQNQDFSHPNRESSVKLFSSVAPKP ...
Anticaries Activity of Azolla pinnata and Azolla rubra | Prashith ...
African Journals Online (AJOL)
http://dx.doi.org/10.4314/star.v3i3.21 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers ...
Protein (Cyanobacteria): 298492611 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 551115:2260 ... 50S ribosomal protein L20 'Nostoc azollae' 0708 MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTAHQQVMKALRSAYRDRKKKKRDFRRLWITRINAASRQNGLSYSQLIGNLKKANVELNRKMLAQLAVLDPASFAKVAELANSVKA
CYANOBACTERIA FOR MITIGATING METHANE EMISSION FROM SUBMERGED PADDY FIELDS
Energy Technology Data Exchange (ETDEWEB)
Upasana Mishra; Shalini Anand [Department of Environmental Studies, Inderprastha Engineering College, Sahibabad, Ghaziabad (India)
2008-09-30
Atmospheric methane, a potent greenhouse gas with high absorption potential for infrared radiation, is responsible for one forth of the total anticipated warming. It is forming a major part of green house gases, next after carbon dioxide. Its concentration has been increasing alarmingly on an average at the rate of one percent per year. Atmospheric methane, originating mainly from biogenic sources such as paddy fields, natural wetlands and landfills, accounts for 15-20% of the world's total anthropogenic methane emission. With intensification of rice cultivation in coming future, methane emissions from paddy fields are anticipated to increase. India's share in world's rice production is next after to China and likewise total methane emission from paddy fields also. Methane oxidation through planktophytes, particularly microalgae which are autotrophic and abundant in rice rhizospheres, hold promise in controlling methane emission from submerged paddy fields. The present study is focused on the role of nitrogen fixing, heterocystous cyanobacteria and Azolla (a water fern harboring a cyanobacterium Anabaena azollae) as biological sink for headspace concentration of methane in flooded soils. In this laboratory study, soil samples containing five potent nitrogen fixer cyanobacterial strains from paddy fields, were examined for their methane reducing potential. Soil sample without cyanobacterial strain was tested and taken as control. Anabaena sp. was found most effective in inhibiting methane concentration by 5-6 folds over the control. Moist soil cores treated with chemical nitrogen, urea, in combination with cyanobacteria mixture, Azolla microphylla or cyanobacteria mixture plus Azolla microphylla exhibited significance reduction in the headspace concentration of methane than the soil cores treated with urea alone. Contrary to other reports, this study also demonstrates that methane oxidation in soil core samples from paddy fields was stimulated by
Absorption and degradation of 14C-2, 4-D by some free-floating aquatic weeds
International Nuclear Information System (INIS)
Singh, S.P.
1980-01-01
Plants of Salvinia, Lemna, Azolla and Limnobium, which are free-floating aquatic weeds, were grown separately in glass dishes containing initially 400 ml of nutrient solution and 2 μCi of 14 C-2,4-D under controlled conditions of temperature, light and relative humidity. The total uptake of 2,4-D by these plant species increased with the increasing duration of exposure to herbicide. 2,4-D uptake, calculated on per unit dry weight of weed, was maximum in case of Limnobium, followed by Salvinia, Lemna and Azolla. After 20 days of treatment, the highest radioactivity (24%) was obtained in the organic fraction of the extracts of Limnobium and Azolla; followed by Salvinia (8%) and Lemna (6%). In a separate experiment, root uptake and subsequent translocation of 14 C-2,4-D was also studied. At all the stages of sampling, more than half to 3/4th of the absorbed 14 C-2,4-D was found in the roots, and the remaining was present in the shoot. (author)
Bharali, Ashmita; Baruah, Kushal Kumar; Baruah, Sunitee Gohain; Bhattacharyya, Pradip
2018-02-01
Rice soil is a source of emission of two major greenhouse gases (methane (CH 4 ) and nitrous oxide (N 2 O)) and a sink of carbon dioxide (CO 2 ). The effect of inorganic fertilizers in combination with various organics (cow dung, green manure (Sesbania aculeata) Azolla compost, rice husk) on CH 4 emission, global warming potential, and soil carbon storage along with crop productivity were studied at university farm under field conditions. The experiment was conducted in a randomized block design for 2 years in a monsoon rice (cv. Ranjit) ecosystem (June-November, 2014 and 2015). Combined application of inorganic (NPK) with Sesbania aculeata resulted in high global warming potential (GWP) of 887.4 kg CO 2 ha -1 and low GWP of 540.6 kg CO 2 ha -1 was recorded from inorganic fertilizer applied field. Irrespective of the type of organic amendments, flag leaf photosynthesis of the rice crop increased over NPK application (control). There was an increase in CH 4 emission from the organic amended fields compared to NPK alone. The combined application of NPK and Azolla compost was effective in the buildup of soil carbon (16.93 g kg -1 ) and capacity of soil carbon storage (28.1 Mg C ha -1 ) with high carbon efficiency ratio (16.9). Azolla compost application along with NPK recorded 15.66% higher CH 4 emission with 27.43% yield increment over control. Azolla compost application significantly enhanced carbon storage of soil and improved the yielding ability of grain (6.55 Mg ha -1 ) over other treatments.
Biosolubilization of uranyl ions in uranium ores by hydrophyte plants
International Nuclear Information System (INIS)
Cecal, Alexandru; Calmoi, Rodica; Melniciuc-Puica, Nicoleta
2006-01-01
This paper investigated the bioleaching of uranyl ions from uranium ores, in aqueous medium by hydrophyte plants: Lemna minor, Azolla caroliniana and Elodea canadensis under different experimental conditions. The oxidation of U(IV) to U(VI) species was done by the atomic oxygen generated in the photosynthesis process by the aquatic plants in the solution above uranium ores. Under identical experimental conditions, the capacity of bioleaching of uranium ores decreases according to the following series: Lemna minor > Elodea canadensis > Azolla caroliniana. The results of IR spectra suggest the possible use of Lemna minor and Elodea canadensis as a biological decontaminant of uranium containing wastewaters. (author)
Directory of Open Access Journals (Sweden)
Hafzon Exaputra
2016-05-01
Full Text Available Utilization fern (Azolla pinnata and water hyacinth (Eichhornia crassipes in addition to preserving the environment also produces elements that are needed for the growth of living things. Household wastewater by plants Azolla pinnata and hyacinth will return sustainability, and can be used as a maintenance gourami (Osphronemus gouramy. The purpose of this research are: (1 to determine the effect of aquatic plants in domestic wastewater to the quality of the water quality standard household waste and growth of carp (Osphronemus gouramy. (2 to find out which one is better growth of carp (Osphronemus gouramy in household waste water between the new and old by fern (Azolla pinnata and by plants hyacinth (Eichhornia crassipes. (3 as a source of information for the public about environmental pollution and recycling of waste water by using plants in domestic wastewater. This type of research experiments. Samples of each treatment 20 fish carp with 4 treatments. Treatment I (wastewater new households by ferns, treatment of II (wastewater new households by plants hyacinth, Treatment III (domestic wastewater long by ferns, treatment IV (household wastewater long by water hyacinth plants. The measured parameters ie width, length and weight of carp within a certain period. Data were analyzed using Analysis of Variance (ANOVA two lanes and qualitative analysis. The results obtained by analysis of existing water plants on the effect of domestic wastewater on growth of carp (Osphronemus gouramy, as well as the provision of fern (Azolla pinnata provides the most good influence on the growth of carp. Kata Kunci: Tumbuhan air, air limbah rumah tangga, pertumbuhan ikan gurami.
Uranium removal from water by five aquatic plants
International Nuclear Information System (INIS)
Hu Nan; Ding Dexin; Li Guangyue; Wang Yongdong; Li Le; Zheng Jifang
2012-01-01
Hydroponic solution culture experiments were conducted on the growth of Eichhornia crassipes, Lemna minor L, Azolla imbircata, Potamogeton crispus, and Alligator alternanthera Herb in water with 0.15, 1.50 and 15.00 mg . L -1 concentrations of uranium, and on the uranium removal from the water by the aquatic plants. For the 21 days of hydroponic solution culture experiments, Azolla imbircata exhibited the strongest resistance to uranium and its growth inhibition rates induced by the water with 0.15, 1.50 and 15.00 mg · L -1 concentrations of uranium were 4.56%, 2.48%, 6.79%, respectively, and the uranium removal rates from the water by the plant amounted to 94%, 97% and 92%, respectively. Further experiments revealed that the most uranium removal could be achieved when 7.5 g Azolla imbircata was grown in 1 L of water, and the time required for the plant to reduce the uranium concentration in water with 1.25, 2.50, 5.00 and 10.00 mg · L -l concentrations of uranium below that stipulated in the national emission standards of China were 17, 19, 23 and 25 days, respectively. The results have laid foundation for further studies of phytoremediation of uranium contaminated water. (authors)
Potential of some aquatic plants for removal of arsenic from wastewater by green technology
Directory of Open Access Journals (Sweden)
Mohammed Barznji Dana A.
2015-03-01
Full Text Available Phytoremediation or green technology is counted among the successful and effective biological contaminated water treatment techniques. Basically, the concept of this green, cost-effective, simple, environmentally nondisruptive method consists in using plants and microbiological processes to reduce contaminants in the ecosystem. Different species from aquatic plants (emerged, free-floating, and submerged have been studied to mitigate toxic contaminants such as arsenic, cadmium, chromium, copper, lead, mercury, zinc, etc. Arsenic is one of the most severe toxic elements; it is widely distributed in the environment, usually found in combination with chloride, oxygen, sulphur and metal ions as a result of mineral dissolution from sedimentary or volcanic rocks and the dilution of geothermal water. The effluents from both industrial and agricultural sectors are also regarded as sources to contaminate water. From the accumulation point of view, several aquatic plants have been mentioned as good arsenic accumulators and their performance is evaluated using the green technology method. These include Spirodela polyrhiza, Wolffia globosa, Lemna gibba, L. minor, Eichhornia crassipes, Azolla caroliniana, Azolla filiculoides, Azolla pinnata, Ceratophyllum demersum and Pistia stratiotes. The up-to-date information illustrated in this review paper generates knowledge about the ability of some common aquatic plants around the globe to remediate arsenic from contaminated water.
Aquatic arsenic: phytoremediation using floating macrophytes.
Rahman, M Azizur; Hasegawa, H
2011-04-01
Phytoremediation, a plant based green technology, has received increasing attention after the discovery of hyperaccumulating plants which are able to accumulate, translocate, and concentrate high amount of certain toxic elements in their above-ground/harvestable parts. Phytoremediation includes several processes namely, phytoextraction, phytodegradation, rhizofiltration, phytostabilization and phytovolatilization. Both terrestrial and aquatic plants have been tested to remediate contaminated soils and waters, respectively. A number of aquatic plant species have been investigated for the remediation of toxic contaminants such as As, Zn, Cd, Cu, Pb, Cr, Hg, etc. Arsenic, one of the deadly toxic elements, is widely distributed in the aquatic systems as a result of mineral dissolution from volcanic or sedimentary rocks as well as from the dilution of geothermal waters. In addition, the agricultural and industrial effluent discharges are also considered for arsenic contamination in natural waters. Some aquatic plants have been reported to accumulate high level of arsenic from contaminated water. Water hyacinth (Eichhornia crassipes), duckweeds (Lemna gibba, Lemna minor, Spirodela polyrhiza), water spinach (Ipomoea aquatica), water ferns (Azolla caroliniana, Azolla filiculoides, and Azolla pinnata), water cabbage (Pistia stratiotes), hydrilla (Hydrilla verticillata) and watercress (Lepidium sativum) have been studied to investigate their arsenic uptake ability and mechanisms, and to evaluate their potential in phytoremediation technology. It has been suggested that the aquatic macrophytes would be potential for arsenic phytoremediation, and this paper reviews up to date knowledge on arsenic phytoremediation by common aquatic macrophytes. Copyright © 2011 Elsevier Ltd. All rights reserved.
ANATOMICAL-HISTOLOGICAL OBSERVATIONS CONDUCTED ON AQUATIC FERNS IN THE DANUBE DELTA
Directory of Open Access Journals (Sweden)
Anca SÂRBU
2017-12-01
Full Text Available This paper analyses aquatic ferns from the genera Azolla Lam., Marsilea L. and Salvinia Séguier, which occur in the Danube Delta, Romania, and comprises a series of anatomical and histological observations of taxonomical, chorological and eco-morphological importance. The research conducted on specimens collected between 2005-2013 from the natural habitats of the Danube Delta, but also from the extra-deltaic artificial habitats have enabled: i a reconsideration of some chorological aspects regarding the species of the genus Azolla in Romania; ii a greater understanding of the adaptive plasticity relative to the factor water for the taxon Marsilea quadrifolia L. collected from natural and artificial habitats; iii the enrichment of the data regarding the structural characteristics of the taxon Salvinia natans (L. All., particularly around the adaptive elements associated with living on the surface of the water.
Czech Academy of Sciences Publication Activity Database
Papaefthimiou, D.; Hrouzek, Pavel; Mugnai, M. A.; Rasmussen, U.; Lukešová, Alena; Turicchia, S.; Ventura, S.
2008-01-01
Roč. 58, - (2008), s. 553-564 ISSN 1466-5026 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60660521 Keywords : nostoc strains * ardra * azolla Subject RIV: EE - Microbiology, Virology Impact factor: 2.222, year: 2008
African Journals Online (AJOL)
Timothy Ademakinwa
Also, the importance of algae in soil formation and soil fertility improvement cannot be over ... The presence of nitrogen fixing microalgae (Nostoc azollae) in the top soil of both vegetable ..... dung, fish food and dirty water from fish ponds on.
Energy Technology Data Exchange (ETDEWEB)
Gonzalez-Paredes, Y.; Ferrera-Cerrato, R.; Alarcon, A.
2009-07-01
Polycyclic aromatic hydrocarbons (PAH) are ubiquitous organic pollutants that are considered toxic and carcinogenic compounds to living organisms. There us scarce information about the effect of PAH on symbiotic systems such as Azolla-Anabaena, arbuscular mycorrhizal fungi-plants, or legume-rhizobia. (Author)
Comparative analysis of marine paleogene sections and biota from West Siberia and the Arctic Region
Akhmet'ev, M. A.; Zaporozhets, N. I.; Iakovleva, A. I.; Aleksandrova, G. N.; Beniamovsky, V. N.; Oreshkina, T. V.; Gnibidenko, Z. N.; Dolya, Zh. A.
2010-12-01
The analysis of the main biospheric events that took place in West Siberia and the Arctic region during the Early Paleogene revealed the paleogeographic and paleobiogeographic unity of marine sedimentation basins and close biogeographic relations between their separate parts. Most biotic and abiotic events of the first half of the Paleogene in the Arctic region and West Siberia were synchronous, unidirectional, and interrelated. Shelf settings, sedimentation breaks, and microfaunal assemblages characteristic of these basins during the Paleogene are compared. The comparative analysis primarily concerned events of the Paleocene-Eocene thermal maximum (PETM) and beds with Azolla (aquatic fern). The formation of the Eocene Azolla Beds in the Arctic region and West Siberia was asynchronous, although it proceeded in line with a common scenario related to the development of a system of estuarine-type currents in a sea basin partly isolated from the World Ocean.
Directory of Open Access Journals (Sweden)
P Nungkat
2015-01-01
Full Text Available A study that was aimed to determine the effect of the use of organic manure and azolla on methane emission on paddy field of organic systems was conducted on paddy fields in the Gempol Village, Sambirejo District of Sragen Regency, Indonesia. The experimental design performed for this study was a completely randomized block design consisting of three factors; the factor I was rice cultivars (Mira-1; Mentik Wangi; Merah Putih; factor II was dose of organic manure (0 t/ha and 10 t/ha and factor III was Azolla inoculums dose (0 t/ha and 2 t/ha. Gas sampling was conducted 3 times in one growing season when the rice plants reached ages of 38, 66 and 90 days after planting. The results showed that there was no correlation between the uses of organic fertilizers for rice production on methane emission. The increase of methane emission was very much influenced by the redox potential. Methane emission from Mira-1 field was higher than that from Mentik Wangi and Merah Putih fields. Emission of methane gas from Mira-1 field ranged from -509.82 to 791.34 kg CH4/ha; that from Wangi ranged from -756.77 to d 547.50 kg CH4/ha and that from Merah Putih ranged from -399.63 to 459.94 kg CH4/ha. Application of 10 t organic manure /ha and 2 t azolla/ha in Mentik Wangi reduced methane emissions with a high rice production compared to Merah Putih and Mira-1.
Algal communities associated with aquatic macrophytes in some ...
African Journals Online (AJOL)
This study describes the algal communities of six ponds colonised by aquatic macrophytes in Nyanza Province, Kenya. Plankton samples were collected from the water column and epiphytic samples from macrophytes such as Azolla, Pistia, Nymphaea, Ipomoea and Ludwigia. Pond pH, temperature, conductivity, ...
Ethiopian Journal of Science and Technology - Vol 6, No 1 (2013)
African Journals Online (AJOL)
Symbiotic Blue Green Algae (Azolla): A Potential Bio fertilizer for Paddy Rice Production in Fogera Plain, Northwestern Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T Feyisa, T Amare, EA Adgo, YG Selassie, 1-11 ...
Directory of Open Access Journals (Sweden)
A. Chattopadhyay, S. Adhikari, S. P. Adhikary, S. Ayyappan
2006-04-01
Full Text Available In this investigation, the efficacy of the herbicide butachlor, (N-butoxymethyl-2 chloro-21, 61 diethyl acetanilide was tested against few common submerged macrophytes namely Hydrilla (Hydrilla verticillata (L. Royale, Najas (Najas minor All., Nechamandra (Nechamandra alternifolia (Roxb. Thwaites and Ottelia (Ottelia alismoides (L. Pers. of freshwater fish ponds. Almost complete decay of Hydrilla, Nechamandra and Ottelia was achieved at 7.5 L of active ingredient/ha/m butachlor within 15 days while the herbicide showed no negative effect on Najas. However at the same concentration of butachlor, total mortality of zooplankton and water fern Azolla (Azolla caroliniana Lamarck occurred within seven days. In case of few freshwater fish species like Rohu (Labeo rohita, Channa (Channa punctatus, Anabas (Anabas testitudineus and Heteropneustes (Heteropneustes fossilis, total mortality occurred upto 90 days after application of the same dose of butachlor but fish survived beyond 120 days of herbicide application indicating degradation of the herbicides.
Alternative energy from agriculture: biological conversion and recycling
Energy Technology Data Exchange (ETDEWEB)
Massantini, F.; Caporali, F.; Masoni, A.
1980-01-01
A review on producing methanol and ethanol from agricultural products (sugar beet, sweet sorghum sugar cane, etc.) and biogas from aquatic plants (Eichhornia crassipes) and algae (Azolla, Chlorella) is given. Anaerobic fermentation of liquid manure and sewage, straw, distillery residues, and other organic wastes is also covered. (Refs. 42).
Brinkhuis, H.; Bijl, P.K.
Held in the palm of a human hand, a single specimen of Azolla filiculoides looks downright inconsequential. Even with the scaly leaves of this miniature aquatic fern spread flat, it barely spans the distance between the creases that cleave the flesh. Its fibrous root tendrils dangle like a lock of
African Journals Online (AJOL)
Feyisa, T. Vol 6, No 1 (2013) - Articles Symbiotic Blue Green Algae (Azolla): A Potential Bio fertilizer for Paddy Rice Production in Fogera Plain, Northwestern Ethiopia Abstract PDF. ISSN: 2312-6019. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
African Journals Online (AJOL)
Adgo, EA. Vol 6, No 1 (2013) - Articles Symbiotic Blue Green Algae (Azolla): A Potential Bio fertilizer for Paddy Rice Production in Fogera Plain, Northwestern Ethiopia Abstract PDF. ISSN: 2312-6019. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
Three new fern records for Kilimanjaro | Hemp | Journal of East ...
African Journals Online (AJOL)
Working on the flora and vegetation of Mt. Kilimanjaro, Tanzania, three ferns in three families were found that are not yet recorded for the floral region T2. The altitudinal range, localities and habitat description are given for Adiantum reniforme, Azolla africana and Trichomanes radicans. Journal of East African Natural History ...
African Journal of Biotechnology
African Journals Online (AJOL)
Azolla filiculoides a planktonic fern found floating on the surface of wetlands, ponds and rivers. Because of its ability to fix nitrogen through symbiotic cyanobacteria, it causes more rice production in paddy fields and is used as a green fertilizer. A. filiculoides was introduced from Philippine as a green fertilizer for rice crop to ...
Physical and ionic characteristics in water soluble fraction (WSF) of ...
African Journals Online (AJOL)
The values of ionic and physical characteristics at 25, 50 and 100% water soluble fraction (WSF) of Olomoro well-head crude oil before and after exposure to Azolla africana were investigated. The WSF values before and after exposure to the plants showed that more ions were available after the introduction of the test plant.
African Journals Online (AJOL)
Adusei-Okrah, V. Vol 13, No 1 (2008) - Articles Improving the Nitrogen Mineralization of Dried Azolla pinnata as a Bio-fertilizer for Increased Rice Production in the Vertisol Abstract PDF. ISSN: 0855-4307. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...
Directory of Open Access Journals (Sweden)
Lie T.U.
2018-04-01
Full Text Available Duck farming needs to be innovated from traditional maintenance management systems that must be abandoned, costly modern intensive maintenance management and pollute the environment into an efficient and eco-green intensive maintenance system by applying the same system partnership pattern to its core. Integrated eco-green intensive peking duck breeding farm utilizing Azolla Microphylla and hedge leaf as feed supplement and other germplasm utilization. The Azolla Microphylla plant serves as a phytoremediation where it can recycle livestock wastewater into clean water thereby reducing excessive water exploitation and reducing the pollution of the stench. The purpose of this research is to obtain information about the financial strategy to start up the business of peking duck integrated with eco-green model. Beginning from planning activities, the company implements project management system with its Gantt Chart. The mapping of operational strategy is carried out comprehensively by always making continuous improvement (kaizen because in the current era to be good alone is not enough, but struggle is needed to be superior (market leader by beginning by cost leader.
316-IJBCS-Article-Prof Emile Fiogbe
African Journals Online (AJOL)
Dr Gatsing
Thèse de. Doctorat, Facultés Universitaires Notre-. Dame de la Paix, Namur, Belgique, 220p. Kestemont P, Micha J-C, Falter U. 1989. Les. Méthodes de Production d'Alevins de. Tilapia nilotica. ADCP / REP / 89 / 46,. PNUD-FAO, Rome, 132p. Lejeune A, Cagauan A, Van Hove C. 1999. Azolla Research and Development :.
from aqueous solution by Azolla filiculoides
African Journals Online (AJOL)
Jane
2011-07-25
Jul 25, 2011 ... tion, electroplating, ion exchange and membrane pro- cesses, are ... concentration of heavy metal ions to very low levels is high and the ... different concentrations (0.01 to 0.44 mmol/L) were prepared by ... After copper and.
Fossilized glycolipids reveal past oceanic N2 fixation by heterocystous cyanobacteria
Bauersachs, Thorsten; Speelman, Eveline N.; Hopmans, Ellen C.; Reichart, Gert-Jan; Schouten, Stefan; Damsté, Jaap S. Sinninghe
2010-01-01
N2-fixing cyanobacteria play an essential role in sustaining primary productivity in contemporary oceans and freshwater systems. However, the significance of N2-fixing cyanobacteria in past nitrogen cycling is difficult to establish as their preservation potential is relatively poor and specific biological markers are presently lacking. Heterocystous N2-fixing cyanobacteria synthesize unique long-chain glycolipids in the cell envelope covering the heterocyst cell to protect the oxygen-sensitive nitrogenase enzyme. We found that these heterocyst glycolipids are remarkably well preserved in (ancient) lacustrine and marine sediments, unambiguously indicating the (past) presence of N2-fixing heterocystous cyanobacteria. Analysis of Pleistocene sediments of the eastern Mediterranean Sea showed that heterocystous cyanobacteria, likely as epiphytes in symbiosis with planktonic diatoms, were particularly abundant during deposition of sapropels. Eocene Arctic Ocean sediments deposited at a time of large Azolla blooms contained glycolipids typical for heterocystous cyanobacteria presently living in symbiosis with the freshwater fern Azolla, indicating that this symbiosis already existed in that time. Our study thus suggests that heterocystous cyanobacteria played a major role in adding “new” fixed nitrogen to surface waters in past stratified oceans. PMID:20966349
Notes à La Flore de Corse, XXV
Jeanmonod, Daniel
2015-01-01
These “notes” deal with 110 noteworthy taxa amongst which 21 are new to the island's flora. One of these taxa is native: Reseda alba subsp. hookeri and 20 are introduced: Abies pinsapo, Acer ×coriaceum, Albizia julibrissin, Arundo micrantha, Azolla filiculoides, Bolboschoenus laticarpus, Digitaria ciliaris, Digitaria violascens, Eucalyptus camaldulensis, E. globulus, Genista januensis subsp. lydia, Hedera helix subsp. maroccana, Morus kagayamae, Oenothera rosea, Paspalum vaginatum, Puccinelli...
Lifescience Database Archive (English)
Full Text Available protein OS=Ipomoea b... 55 2e-06 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 54 3e-0...DPCTC 217 + T G+ACKCGSNC C DPC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azoll
Efficiency of nitrogen fertilizers for rice
Roger, Pierre-Armand; Grant, I.F.; Reddy, P.M.; Watanabe, I.
1987-01-01
The photosynthetic biomass that develops in the floodwater of wetland rice fields affects nitrogen dynamics in the ecosystem. This review summarizes available data on the nature, productivity, and composition of the photosynthetic aquatic biomass, and its major activities regarding the nitrogen cycle, i.e., nitrogen fixation by free living blue-green algae and #Azolla$, nitrogen trapping, nitrogen accumulation at the soil surface, its effect on nitrogen losses by ammonia volatilization, nitro...
Botanical ecology and conservation of the laguna de la herrera (sabana de bogotá, colombia)
Wijninga, V. M.; Rangel, Orlando; Cleef, A. M.
2012-01-01
Se estudió la vegetación alrededor de la Laguna de La Herrera, una laguna andina a 2550 m. Se diferenciaron una comunidad de Phytolacca bogotensis (1): comunidades helofíticas dominadas por: Scirpus californicus y Typha angustifolia (2); Scirpus californicus (3); Polygonum punctatum (4); Rumex obtusifolius y Polygonum punctatum (5); Bidens laevis (6); Hydrocotyle ranunculoides (7); comunidades pleustofíticas con: Limnobium laevigatum; (8); Azolla filiculoides y Lemna cf. gibba (9) y Eichhorni...
Biodiesel Production from Azolla filiculoides (Water Fern)
African Journals Online (AJOL)
1Department of Microbiology, Rasht Branch, Islamic Azad University, Rasht, Iran, 2Department of Biology, Faculty of ... Conclusion: The results indicate that biodiesel can be produced from ... Consequently, microalgae that can grow rapidly.
Biodiesel Production from Azolla filiculoides (Water Fern ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 13, No 6 (2014) >. Log in or Register to get access to full text downloads.
Impacts of invasive alien plants on water quality, with particular emphasis on South Africa
CSIR Research Space (South Africa)
Chamier, J
2012-04-01
Full Text Available observed, but nitrogen-fixation occurred on a much smaller scale compared to Azolla spp. (Barik et al., 2000). Increases in cyanobacteria numbers caused by their symbiotic relationship with aquatic weeds, add to the eutrophication processes in the water.... 86-90. BARIK SK, MISHRA S and AYYAPPAN S (2000) Decomposition patterns of unprocessed and processed lignocellulosics in a fresh- water fish pond. Aquat. Ecol. 34 (2) 185-200. BAYLEY SE and SCHINDLER DW (1991) The role of fire in deter- mining...
MARKETING STRATEGY FOR START UP BUSINESS OF BROILER PEKING DUCK FARM WITH ECO-GREEN INTEGRATED
Silitonga N.; Syah T.Y.R.; Erni N.
2018-01-01
The increasing number and the rate of Banten population growth from year to year make it as a potential market which is quite large for the development of broiler duck farming business in the future. In this case, intensive system broiler Peking duck farming which is integrated, economic, and eco-green intensive, eco-green commonly utilizes Azolla microphylla and flour of pluchea leaves and other germ plasmas as the feed supplements. As a company in Peking duck farming with Eco Green concept,...
First record of Stenopelmus rufinasus Gyllenhal, 1835 (Coleoptera: Curculionidae from Poland
Directory of Open Access Journals (Sweden)
Wanat Marek
2018-03-01
Full Text Available Stenopelmus rufinasus, a North American weevil introduced to Europe along with the invasive aquatic fern Azolla filiculoides, has been recorded from Poland for the first time. Its locality is a natural oxbow lake of the River Odra in Wrocław, the only city in Poland where A. filiculoides has been repeatedly recorded over the last dozen years. The diagnostic characters of this weevil species, its biology, current distribution in Europe and its prospects in Poland are discussed.
五种水生植物对水中铀的去除作用%Uranium removal from water by five aquatic plants
Institute of Scientific and Technical Information of China (English)
胡南; 丁德馨; 李广悦; 王永东; 李乐; 郑济芳
2012-01-01
采用水培实验,研究了浮叶植物野生水葫芦(Eichhornia crassipes)、漂浮植物浮萍(Lemna minor L)、满江红(Azolla imbircata)、沉水植物菹草(Potamogeton crispus)、挺水植物空心莲子草(Alligator Alternanthera Herb)在初始铀浓度分别为0.15、1.50和15.00mg·L-1水中的生长状况及它们对水中铀的去除能力.结果表明,在21d的水培试验期内,满江红对铀表现出了最强的抗性,0.15、1.50和15.00mg·L-1的铀对满江红的生长抑制率分别只有4.56%、2.48%和6.79%,而满江红对水中铀的去除率分别达到了94%、97%和92%.进一步的试验表明,每1L水中种植7.5g满江红,可以获得最大的铀去除率,将初始铀浓度为1.25、2.50、5.00和10.00mg·L-1的水体降至国家排放标准(GB23727-2009)规定值(0.05mg·L-1)以下分别需要17、19、23和25d.研究结果为进一步开展铀污染水体植物修复的研究打下了基础.%Hydroponic solution culture experiments were conducted on the growth of Eichhornia crassipes,Lemna minor L,Azolla imbircata,Potamogeton crispus,and Alligator alternanthera Herb in water with 0.15,1.50 and 15.00 mg · L-1 concentrations of uranium.The uranium removal from the water by the aquatic plants was also examined.For the 21 days of hydroponic solution culture experiments,Azolla imbircata exhibited the strongest resistance to uranium and its growth inhibition rates induced by the water with 0.15,1.50 and 15.00 mg · L-1 concentrations of uranium were 4.56%,2.48%,6.79%,respectively.The uranium removal rates from the water by the plant amounted to 94%,97% and 92%,respectively.Further experiments revealed that the most uranium removal could be achieved when 7.5 g Azolla imbircata was grown in 1 L of water.17,19,23 and 25 days were required for the plant with the uranium concentration in water of 1.25,2.50,5.00 and 10.00 mg · L-1 to reduce to below the national emission standards of China,respectively.The results
Directory of Open Access Journals (Sweden)
F.P Guimarães
2011-01-01
Full Text Available The potential of three macrophytes, Azolla caroliniana, Salvinia minima, and Lemna gibba was assessed in this study to select plants for use in environmental remediation contaminated with atrazine. Experiments were carried out in a greenhouse over six days in pots containing Hoagland 0.25 strength nutritive solution at the following atrazine concentrations: 0; 0.01; 0.1; 1.0; 10.0 mg L-1. Decrease in biomass accumulation was observed in the three macrophytes, as well as toxic effects evidenced by the symptomatology developed by the plants which caused their deaths. The chlorosis and necrosis allowed to observe in the plants the high sensitivity of the three species to the herbicide. Plants presented low potential for removal of atrazine in solution when exposed to low concentrations of the herbicide. However, at the 10.0 mg L-1 atrazine concentration, L. gibba and A. caroliniana showed potential to remove the herbicide from the solution (0.016 and 0.018 mg atrazine per fresh mass gram, respectively. This fact likely resulted from the processes of atrazine adsorption by the dead material. The percentage of atrazine removed from the solution by the plants decreased when the plants were exposed to high concentrations of the pollutant. Azolla caroliniana, S. minima, and L. gibba were not effective in removing the herbicide from solution. The use of these species to remedy aquatic environments was shown to be limited.Avaliou-se, neste estudo, o potencial de três macrófitas - Azolla caroliniana, Salvinia minima e Lemna gibba - com vistas à seleção de plantas para remediação de ambientes contaminados por atrazine. Foram realizados experimentos em casa de vegetação durante seis dias, em vasos contendo solução nutritiva Hoagland (0,25 de força iônica, nas seguintes concentrações de atrazine: 0; 0,01; 0,1; 1,0; e 10,0 mg L-1. A redução da biomassa acumulada pelas macrófitas foi observada, bem como os efeitos de toxidez evidenciados pela
Energy Technology Data Exchange (ETDEWEB)
Blanc-Valleron, M.M.; Rouchy, J.M. (Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France)); Schuler, M.; Rauscher, R. (Strasbourg-1 Univ., 67 (France)); Camoin, G. (Aix-Marseille-1 Univ., 13 - Marseille (France))
1994-12-01
Palynological and Rock-Eval pyrolysis studies of the Chaunaca and El Molino Fm (Santonian to Thanetian, Cordillera Oriental, Bolivia) indicate that some facies have economic significance as potential oil source rocks. The occurrence of Pediastrum and Azolla testify a lacustrine environment. In the Upper Molino, the environmental interpretation of an almost monospecific association of dinocysts is discussed. The presence of Apectodinium quinquelatum indicates that the age of the upper part of the Upper El Molino Fm is likely to be Upper Thanetian. (authors). 22 refs., 5 figs.
Differential Sensitivity of Nitrogen-Fixing, Azolla Microphylla to ...
African Journals Online (AJOL)
Michael Horsfall
photosynthesizing and nitrogen fixing micro-organisms contributing significantly ... Pesticide treatment with increasing doses accelerated the formation of reactive ... increased amount of proline in all the insecticide treated concentrations was .... monitoring the nitrite formation from ... centrifuged for 10 minutes in high speed.
Directory of Open Access Journals (Sweden)
Wijninga V. M.
1989-09-01
Full Text Available The acuatic, helophytic and pleustophytic vegetation of the Laguna de La Herrera, on the southwestern border of the high plain of Bogotá at 2550 m was studied following the Zurich- Montpellier approach. The communities recognized were: terrestrial community of Phytolacca bogotensis; helophytic communities of scirpus californicus and Typha angustifolia ; scirpus californicus ; Polygonum punctatum ; Rumex obtusifolius with Polygonum punctatum; Bidens laevis ; Hydrocotyle ranunculoides. Pleustophytic communities of Limnobium laevigatum; Azolla filiculoides with Lemna cf. gibba and Eichornia crassipes. The structure, floristic composition and ecological aspects were also considered. Several recommendations about conservation of the Laguna are given. Se estudió la vegetación alrededor de la Laguna de La Herrera, una laguna andina a 2550 m. Se diferenciaron una comunidad de Phytolacca bogotensis (1: comunidades helofíticas dominadas por: Scirpus californicus y Typha angustifolia (2; Scirpus californicus (3; Polygonum punctatum (4; Rumex obtusifolius y Polygonum punctatum (5; Bidens laevis (6; Hydrocotyle ranunculoides (7; comunidades pleustofíticas con: Limnobium laevigatum; (8; Azolla filiculoides y Lemna cf. gibba (9 y Eichhornia crassipes (10. Se registraron la estructura, composición florística, los rasgos ecológicos y la distribución de las comunidades y se comparó con la conductividad eléctrica y la calidad del agua. Finalmente, se hacen recomendaciones para la conservación de la laguna y la vegetación acuática.
Non-protein and agro-industrial by-products utilization by ruminants in Bangladesh
International Nuclear Information System (INIS)
Tareque, A.M.M.
1987-01-01
A series of experiments were designed to (1) investigate mixtures of locally available feedstuffs, particularly agro-industrial by-products with or without non-protein nitrogen supplementation as production rations for local and imported breeds of ruminants, (2) formulate rations based on locally available feedstuffs which can be compounded either on a large scale or at the village level for local animals, (3) determine the nutritive value of some non-conventional feedstuffs in terms of their digestibility and their ability to promote microbial synthesis. Rice straw, constituting about 85% of the total available feed dry matter in Bangladesh, is considered a basal, or sometimes the sole, feed for ruminant animals. The efficiency of utilization of rice straw could be improved by adding non-conventional feed resources, such as azolla, banana plant, sweet potato leaves and other legumes and grasses. Rates of growth and feed efficiency by local animals were found to be higher in those fed with urea treated rice straw or bagasse, with or without the addition of concentrates, than in animals fed untreated straw. Rations were also found to be satisfactory when rice straw was fed in combination with urea, legumes such as cowpea hay, azolla and sweet potato leaves or concentrates. It is concluded that the utilization of rice straw by ruminants can be improved by suitable supplementation with non-conventional feed resources. Research is needed to evaluate the use of molasses as a feed ingredient for ruminants in Bangladesh. (author)
International Nuclear Information System (INIS)
1986-12-01
This Newsletter describes the opening of the Soils and Plant Breeding Laboratory at the IAEA Seibersdorf Laboratory and describes the research taking place in the new unit. The Research Co-ordination Meetings on the improvement of yield and nitrogen fixation of the common bean in Latin America (December 1985, CENA, Piracicaba, Brazil), the management of legumes in pastures (March 1986, IAEA, Vienna) and isotopic studies of nitrogen fixation and nitrogen cycling by blue-green algae and Azolla (May 1986, International Rice Research Institute, The Philippines) are summarized, and recent publications are briefly described. Tabs
Pteridophyta collected in Northern Nigeria and Northern Cameroon
Directory of Open Access Journals (Sweden)
Jan kornaś
2014-01-01
Full Text Available 25 species of Pteridophyta were collected in Northern Nigeria (mainly the Lake Chad Basin and the Mandara Mts. and in the neighbouring parts of Cameroon. 11 of them have not been recorded previously from this area: Isoetes schweinfurthii A. Br. in Bak., Selaginella tenerrima A. Br. ex Kuhn, Ophioglossum gomenzianum Welw. ex A. Br., Marsilea coromandeliana Willd., M. distorta A. Br., M. nubica A. Br., M. subterranea Lepr. ex A. Br., Azolla africana Desv., Ceratopteris richardii Brogn., Adiantum capillus-veneris Linn., and Actiniopleris semiflabellata Pic. Ser.
International Nuclear Information System (INIS)
Wetselaar, R.I.
1992-01-01
This document is the report of an expert mission to assist in the initiation of research on sustainable agriculture in rice-based cropping systems as related to the flow of plant nutrients, and on the use of legumes in upland cropping systems. Experimental suggestions include an investigation of the acid tolerance of different soybean strains under upland conditions, an analysis of ways to replace fertilizer nitrogen for rice crops by a green manure such as azolla, and a study of the increase in nutrient availability due to th presence of fish in a paddy field
Complex agro-ecosystems for food security in a changing climate
Khumairoh, Uma; Groot, Jeroen CJ; Lantinga, Egbert A
2012-01-01
Attempts to increase food crop yields by intensifying agricultural systems using high inputs of nonrenewable resources and chemicals frequently lead to de-gradation of natural resources, whereas most technological innovations are not accessible for smallholders that represent the majority of farmers world wide. Alternatively, cocultures consisting of assemblages of plant and animal species can support ecological processes of nutrient cycling and pest control, which may lead to increasing yields and declining susceptibility to extreme weather conditions with increasing complexity of the systems. Here we show that enhancing the complexity of a rice production system by adding combinations of compost, azolla, ducks, and fish resulted in strongly increased grain yields and revenues in a season with extremely adverse weather conditions on East Java, Indonesia. We found that azolla, duck, and fish increased plant nutrient content, tillering and leaf area expansion, and strongly reduced the density of six different pests. In the most complex system comprising all components the highest grain yield was obtained. The net revenues of this system from sales of rice grain, fish, and ducks, after correction for extra costs, were 114% higher than rice cultivation with only compost as fertilizer. These results provide more insight in the agro-ecological processes and demonstrate how complex agricultural systems can contribute to food security in a changing climate. If smallholders can be trained to manage these systems and are supported for initial investments by credits, their livelihoods can be improved while producing in an ecologically benign way. PMID:22957173
Roberts, C. D.; Legrande, A. N.; Tripati, A. K.
2008-12-01
The report of fossil Azolla (a freshwater aquatic fern) in sediments from the Lomonosov Ridge suggests low salinity conditions occurred in the Arctic Ocean in the early Eocene. Restricted passages between the Arctic Ocean and the surrounding oceans are hypothesized to have caused this Arctic freshening. We investigate this scenario using a water-isotope enabled atmosphere-ocean general circulation model with Eocene boundary conditions including 4xCO2, 7xCH4, altered bathymetry and topography, and an estimated distribution of Eocene vegetational types. In one experiment, oceanic exchange between the Arctic Ocean and other ocean basins was restricted to two shallow (~250 m) seaways, one in the North Atlantic, the Greenland-Norwegian seaway, and the second connecting the Arctic Ocean with the Tethys Ocean, the Turgai Straits. In the restricted configuration, the Greenland-Norwegian seaway was closed and exchange through the Turgai Straits was limited to a depth of ~60 m. The simulations suggest that the severe restriction of Arctic seaways in the early Eocene may have been sufficient to freshen Arctic Ocean surface waters, conducive to Azolla blooms. When exchange with the Arctic Ocean is limited, salinities in the upper several hundred meters of the water column decrease by ~10 psu. In some regions, surface salinity is within 2-3 psu of the reported maximum modern conditions tolerated by Azolla (~5 psu). In the restricted scenario, salt is stored preferentially in the North Atlantic and Tethys oceans, resulting in enhanced meridional overturning, increased poleward heat transport in the North Atlantic western boundary current, and warming of surface and intermediate waters in the North Atlantic by several degrees. Increased sensible and latent heat fluxes from the North Atlantic Ocean, combined with a reduction in cloud albedo, also lead to an increase in surface air temperature of over much of North America, Greenland and Eurasia. Our work is consistent with
Effects of different combinations of Hoagland's solution and Azolla ...
African Journals Online (AJOL)
The assessments of photosynthetic rate, stomatal conductance, evapotranspiration, intercellular CO2 concentration and chlorophyll content in Beta vulgaris subsp. cycla 'Fordhook Giant' grown in hydroponic cultures containing different compositions of hydroponic solutions were evaluated in this study. The aim of the study ...
Turning the aquatic weed Azolla into a sustainable crop
Brouwer, P.
2017-01-01
Growing worldwide demands for food, energy and chemicals threatens natural ecosystems and global climate. Plants are crucial for food production, but may also be used to produce sustainable energy and materials. Hereto novel crops are sought with high productivity per hectare, whilst requiring
International Nuclear Information System (INIS)
Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro
2015-01-01
Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)
International Nuclear Information System (INIS)
Asha, V.S.; Arulmozhiselvan, K.
2006-01-01
In order to estimate N use efficiency in deep placement of NPK straight fertilizers, two pot experiments were conducted in high clay soil with direct seeded rice. 15 N urea was used as a tracer. A newly designed 'Nutriseed Holder' was used for simultaneous deep placement of fertilizers and sowing of seeds. Each holder had two cavities, one on top for holding seed and another one at bottom for holding fertilizer material. By implanting a holder in puddled soil, a rice hill was established. The length (5 or 10 cm) and width (8 or 12 mm) of nutriseed holder was standardized while evaluating the effect of Azolla, neem and seed inoculants. Appreciably, deep placement of plain NPK fertilizer in 12 mm holder placed at 5 cm depth recorded the highest grain yield with a yield increase of 81.8 per cent during rabi 2002 (cv CO 43) and 84.8 per cent during summer 2003 (cv CO 47) over broadcast application. Further, it increased recovery of added JSN in grain + straw to the tune of 57.1 per cent in rabi and 54.7 per cent in summer as compared to broadcast application (26.1% in rabi, 34.2 in summer). Deep placement enhanced more retention in soil (up to 9.0% in rabi, 14.6% in summer) whereas broadcast application enhanced more retention in Azolla biomass that was grown in floodwater (up to 2.3 % in rabi, 4.3 % in summer). Use of 12 mm width nutriseed holder aiding deep placement at 5 cm depth was found suitable for deriving high yield and N use efficiency. (author)
Directory of Open Access Journals (Sweden)
M. Mohammadi
2016-05-01
Full Text Available In order to evaluate the effect of ducks number on weeds diversity and density in paddy fields, an experiment was conducted at Sari Agricultural Sciences and Natural Resource University during growing season of 2011-2012. Experiment was arranged in split plot based on complete randomized block design with four replications. Main factors were duck number at three levels (consisting of control, 400 and 800 ducks.ha-1 and sub plots were three contrast cultivars (including Tarom as a traditional, and Shirodi and Ghaem as improved cultivars. Results of ANOVA showed highly significant differences between ducks, cultivars and ducks × cultivar interaction in terms of weeds density including nutsedge (Cyperus spp. L., common Water-plantain (Alisma plantago-aquatica L., barnyard grass (Echinochloa crus-galli L., duckweed (Lemna minor L., azolla (Azolla pinata R.Br. and paddy yield. Accordingly, the lowest weed density and diversity were recorded at 800 and 400 ducks.ha-1, respectively. Among rice cultivars Tarom and Ghaem had the minimum and the maximum weeds density and diversity. The highest nutsedge density (67 plant.m-2 was related to Ghaem cultivar in control (without duck plots as much as 97% higher than 800 ducks.ha-1. Maximum paddy yield was observed in 800 ducks.ha-1 in Shirodi (5.3 t.ha-1, Ghaem (4.3 t.ha-1 and Tarom (3.6 t.ha-1 as much as 23, 7 and 20% higher than those cultivars in 400 ducks.ha-1, respectively. Finally, in the current research conditions using 800 ducks.ha-1and Tarom cultivar resulted the best performance because of the lowest weed diversity and density as compared to other treatments.
Bioenergy potential of eight common aquatic weeds
Energy Technology Data Exchange (ETDEWEB)
Abbasi, S.A.; Nipaney, P.C.; Schaumberg, G.D. (Pondicherry (Central) Univ. (IN). Salim Ali School of Ecology)
1990-01-01
Eight common aquatic weeds Salvinia molesta, Hydrilla verticillata, Nymphaea stellata, Azolla pinnata, Ceratopteris sp. Scirpus sp. Cyperus sp, and Utricularia reticulata were digested anaerobically to produce methane. The carbon to nitrogen (C/N) ratio, carbon to phosphorus (C/P) ratio, and the volatile solids (VS) content of the weeds varied widely. No trend between these factors and the methane yield was discernable; the possible reasons are discussed. The energy potential of the weeds per unit area of the weed crop was worked out. Natural stands of salvinia, such as the one employed in the present investigation, would yield energy (methane) of the order of 10{sup 8} Kcal/ha/yr. (author).
Alimentation des lapins (Oryctolagus cuniculus L.) à base de Azolla ...
African Journals Online (AJOL)
Rabbits fed with the diet supplemented with Panicum maximum had an ... sustainable aquaculture production is that obtained with rabbit manures from the R3 diet ..... performance of three fish species. .... Organic Fertilizers used in the Urban.
Helechos y licofitos de la Reserva Natural Educativa Colonia Benítez (Chaco, Argentina
Directory of Open Access Journals (Sweden)
Bruno Dematteis
2015-01-01
Full Text Available La Reserva Natural Educativa Colonia Benítez cuenta con una superficie aproximada de ocho ha, está ubicada en el departamento Primero de Mayo, en la provincia del Chaco, Argentina. Desde el punto de vista fitogeográfico, esta área protegida se localiza dentro del Distrito Chaqueño Oriental de la Provincia Chaqueña. Como objetivos de este trabajo se planteó realizar un inventario de helechos y licofitos y una clave para el reconocimiento de los taxa que crecen en esta reserva. A tal fin, se examinaron las colecciones depositadas en CTES, y se realizaron nuevas recolecciones de especímenes. Se registraron 12 géneros con un total de 17 especies, siendo Doryopteris el género mejor representado con tres especies: D. concolor, D. lorentzii y D. pentagona. El género Adiantopsis presentó dos especies (A. chlorophylla y A. tweediana, al igual que Anemia con (A. simplicior y A. tomentosa var. anthriscifolia y Pteris (Pteris denticulata var. tristicula y Pteris vittata. Los demás géneros presentaron sólo una especie: Adiantum lorentzii, Anogramma chaerophylla, Azolla cristata, Hemionitis tomentosa, Microgramma vaccinifolia, Pityrogramma calomelanos var. calomelanos, Pleopeltis minima y Selaginella sellowii. El hábito terrícola fue el mejor representado con 12 especies, de las cuales una de ellas es rupícola y otras tres se pueden comportar como epífitos facultativos, en tanto que los estrictamente epífitos fueron representados por sólo dos especies. Azolla cristata fue la única especie acuática presente. Se presentan observaciones ecológicas y un análisis biogeográfico de las especies registradas
Peeters, Edwin T H M; Neefjes, Rozemarijn E M; Zuidam, Bastiaan G van
2016-01-01
Nutrients can determine the outcome of the competition between different floating plant species. The response of floating plants to current phosphorus levels may be affected by previously experienced phosphorus concentrations because some species have the ability to store excess phosphorus for later use. This might have an impact on their competition. Here, we investigate the effect of previous and actual phosphorus concentrations on the growth rate of free-floating plant species (Azolla filiculoides, Lemna minor/gibba and Ricciocarpus natans)and the effect of phosphorus history on the competition between L. minor/gibba and A. filiculoides and between L. minor/gibba and R. natans. As expected, plant growth was lower when previously kept at low instead of high phosphorus concentrations. Growth of L. minor/gibba and A. filiculoides with a phosphorus rich history was comparable for low and high actual phosphorus concentrations, however, internal phosphorus concentrations were significantly lower with low actual phosphorus concentration. This indicates that both species perform luxury phosphorus uptake. Furthermore, internal P concentration in Azolla and Lemna increased within two weeks after a period of P deficit without a strong increase in growth. A. filiculoides in a mixture with L. minor/gibba grew faster than its monoculture. Morphological differences may explain why A. filiculoides outcompeted L. minor/gibba and these differences may be induced by phosphorus concentrations in the past. Growth of L. minor/gibba was only reduced by the presence of A. filiculoides with a high phosphorus history. Growth of L. minor/gibba and R. natans in mixtures was positively affected only when they had a high phosphorus history themselves and their competitor a low phosphorus history. These observations clearly indicate that phosphorus history of competing plants is important for understanding the outcome of the competition. Therefore, actual and previously experienced phosphorus
Early pleistocene sediments at Great Blakenham, Suffolk, England
Gibbard, P. L.; Allen, P.; Field, M. H.; Hallam, D. F.
Detailed investigation of a fine sediment sequence, the College Farm Silty Clay Member, that overlies the Creeting Sands (Early Pleistocene) in Suffolk, is presented. The sedimentary sequence is thought to represent a freshwater pool accumulation in a small coastal embayment. Palaeobotanical investigation of the sediment indicates that it accumulated during the late temperate substage of a temperate (interglacial) event. The occurrence of Tsuga pollen, associated with abundant remains of the water fern Azolla tegeliensis indicate that the deposits are of Early Pleistocene age and are correlated with a later part of the Antian-Bramertonian Stage. Correlation with Tiglian TO substage in The Netherlands' sequence is most likely. The sediments' normal palaeomagnetic polarity reinforces the biostratigraphical correlation.
Energy Technology Data Exchange (ETDEWEB)
Singh, S.P.; Srivastava, S.C. (Banaras Hindu Univ., Varanasi (IN). Centre of Advanced Study in Botany)
1991-01-01
Four strains of non-sulphur photosynthetic bacteria were isolated from root zone associations of aquatic plants like Azolla, Salvinia and Eichhornia, as well as the deep-water rice. Based on the gross cell morphology and pigmentation, the isolates resembled Rhodopseudomonas sp. and have been designated as BHU strains 1 to 4, respectively. When subjected to elevated temperature (from 33-45{sup o}C), substantial growth/hydrogen production could be observed only in strains 1 and 4. Strains 2 and 3 on the other hand, showed diminished growth and negligible hydrogen photoproduction. The BHU strains 1 and 4 have been selected as the most active (thermostable) hydrogen producing strains of local origin as far as the Indian tropical climate is concerned. (author).
Invasive vascular plant species of oxbow lakes in south-western Poland
Directory of Open Access Journals (Sweden)
Spałek Krzysztof
2015-06-01
Full Text Available Natural water reservoirs are very valuable floristic sites in south-western Poland. Among them, the most important for the preservation of biodiversity of flora are oxbow lakes. The long-term process of human pressure on habitats of this type caused disturbances of their biological balance. Changes in the water regime, industrial development and chemisation of agriculture, especially in the period of the last two hundred years, led to systematic disappearances of localities of many plant species connected with rare habitats and also to the appearance of numerous invasive plant species. They are: Azolla filiculoides, Echinocystis lobata, Erechtites hieraciifolia, Impatiens glandulifera, I. parviflora, Reynoutria japonica, Solidago canadensis, S. gigantea and S. graminifolia. Field works were conducted in years 2005-2012.
(Oryctolagus cuniculus L.) à base de Azolla filiculoïdes, Elaeis ...
African Journals Online (AJOL)
L'intérêt des engrais organiques réside selon, Ben et al. (2014), dans leur capacité à favoriser le développement du plancton et des macroinvertébrés, qui sont les sources nutritives principales ou supplémentaires, pour la croissance des poissons. Ainsi les éléments comme l'azote et le phosphore constituent les principaux ...
Directory of Open Access Journals (Sweden)
Mwangangi Joseph M
2010-08-01
Full Text Available Abstract Background The diversity and abundance of Anopheles larvae has significant influence on the resulting adult mosquito population and hence the dynamics of malaria transmission. Studies were conducted to examine larval habitat dynamics and ecological factors affecting survivorship of aquatic stages of malaria vectors in three agro-ecological settings in Mwea, Kenya. Methods Three villages were selected based on rice husbandry and water management practices. Aquatic habitats in the 3 villages representing planned rice cultivation (Mbui Njeru, unplanned rice cultivation (Kiamachiri and non-irrigated (Murinduko agro-ecosystems were sampled every 2 weeks to generate stage-specific estimates of mosquito larval densities, relative abundance and diversity. Records of distance to the nearest homestead, vegetation coverage, surface debris, turbidity, habitat stability, habitat type, rice growth stage, number of rice tillers and percent Azolla cover were taken for each habitat. Results Captures of early, late instars and pupae accounted for 78.2%, 10.9% and 10.8% of the total Anopheles immatures sampled (n = 29,252, respectively. There were significant differences in larval abundance between 3 agro-ecosystems. The village with 'planned' rice cultivation had relatively lower Anopheles larval densities compared to the villages where 'unplanned' or non-irrigated. Similarly, species composition and richness was higher in the two villages with either 'unplanned' or limited rice cultivation, an indication of the importance of land use patterns on diversity of larval habitat types. Rice fields and associated canals were the most productive habitat types while water pools and puddles were important for short periods during the rainy season. Multiple logistic regression analysis showed that presence of other invertebrates, percentage Azolla cover, distance to nearest homestead, depth and water turbidity were the best predictors for Anopheles mosquito larval
Directory of Open Access Journals (Sweden)
Liang Ran
Full Text Available BACKGROUND: An ancient cyanobacterial incorporation into a eukaryotic organism led to the evolution of plastids (chloroplasts and subsequently to the origin of the plant kingdom. The underlying mechanism and the identities of the partners in this monophyletic event remain elusive. METHODOLOGY/PRINCIPAL FINDINGS: To shed light on this evolutionary process, we sequenced the genome of a cyanobacterium residing extracellularly in an endosymbiosis with a plant, the water-fern Azolla filiculoides Lam. This symbiosis was selected as it has characters which make it unique among extant cyanobacterial plant symbioses: the cyanobacterium lacks autonomous growth and is vertically transmitted between plant generations. Our results reveal features of evolutionary significance. The genome is in an eroding state, evidenced by a large proportion of pseudogenes (31.2% and a high frequency of transposable elements (approximately 600 scattered throughout the genome. Pseudogenization is found in genes such as the replication initiator dnaA and DNA repair genes, considered essential to free-living cyanobacteria. For some functional categories of genes pseudogenes are more prevalent than functional genes. Loss of function is apparent even within the 'core' gene categories of bacteria, such as genes involved in glycolysis and nutrient uptake. In contrast, serving as a critical source of nitrogen for the host, genes related to metabolic processes such as cell differentiation and nitrogen-fixation are well preserved. CONCLUSIONS/SIGNIFICANCE: This is the first finding of genome degradation in a plant symbiont and phenotypically complex cyanobacterium and one of only a few extracellular endosymbionts described showing signs of reductive genome evolution. Our findings suggest an ongoing selective streamlining of this cyanobacterial genome which has resulted in an organism devoted to nitrogen fixation and devoid of autonomous growth. The cyanobacterial symbiont of Azolla
Directory of Open Access Journals (Sweden)
Edwin T H M Peeters
Full Text Available Nutrients can determine the outcome of the competition between different floating plant species. The response of floating plants to current phosphorus levels may be affected by previously experienced phosphorus concentrations because some species have the ability to store excess phosphorus for later use. This might have an impact on their competition. Here, we investigate the effect of previous and actual phosphorus concentrations on the growth rate of free-floating plant species (Azolla filiculoides, Lemna minor/gibba and Ricciocarpus natansand the effect of phosphorus history on the competition between L. minor/gibba and A. filiculoides and between L. minor/gibba and R. natans. As expected, plant growth was lower when previously kept at low instead of high phosphorus concentrations. Growth of L. minor/gibba and A. filiculoides with a phosphorus rich history was comparable for low and high actual phosphorus concentrations, however, internal phosphorus concentrations were significantly lower with low actual phosphorus concentration. This indicates that both species perform luxury phosphorus uptake. Furthermore, internal P concentration in Azolla and Lemna increased within two weeks after a period of P deficit without a strong increase in growth. A. filiculoides in a mixture with L. minor/gibba grew faster than its monoculture. Morphological differences may explain why A. filiculoides outcompeted L. minor/gibba and these differences may be induced by phosphorus concentrations in the past. Growth of L. minor/gibba was only reduced by the presence of A. filiculoides with a high phosphorus history. Growth of L. minor/gibba and R. natans in mixtures was positively affected only when they had a high phosphorus history themselves and their competitor a low phosphorus history. These observations clearly indicate that phosphorus history of competing plants is important for understanding the outcome of the competition. Therefore, actual and previously
Peeters, Edwin T. H. M.; Neefjes, Rozemarijn E. M.; van Zuidam, Bastiaan G.
2016-01-01
Nutrients can determine the outcome of the competition between different floating plant species. The response of floating plants to current phosphorus levels may be affected by previously experienced phosphorus concentrations because some species have the ability to store excess phosphorus for later use. This might have an impact on their competition. Here, we investigate the effect of previous and actual phosphorus concentrations on the growth rate of free-floating plant species (Azolla filiculoides, Lemna minor/gibba and Ricciocarpus natans)and the effect of phosphorus history on the competition between L. minor/gibba and A. filiculoides and between L. minor/gibba and R. natans. As expected, plant growth was lower when previously kept at low instead of high phosphorus concentrations. Growth of L. minor/gibba and A. filiculoides with a phosphorus rich history was comparable for low and high actual phosphorus concentrations, however, internal phosphorus concentrations were significantly lower with low actual phosphorus concentration. This indicates that both species perform luxury phosphorus uptake. Furthermore, internal P concentration in Azolla and Lemna increased within two weeks after a period of P deficit without a strong increase in growth. A. filiculoides in a mixture with L. minor/gibba grew faster than its monoculture. Morphological differences may explain why A. filiculoides outcompeted L. minor/gibba and these differences may be induced by phosphorus concentrations in the past. Growth of L. minor/gibba was only reduced by the presence of A. filiculoides with a high phosphorus history. Growth of L. minor/gibba and R. natans in mixtures was positively affected only when they had a high phosphorus history themselves and their competitor a low phosphorus history. These observations clearly indicate that phosphorus history of competing plants is important for understanding the outcome of the competition. Therefore, actual and previously experienced phosphorus
Management of fresh water weeds (macrophytes) by vermicomposting using Eisenia fetida.
Najar, Ishtiyaq Ahmed; Khan, Anisa B
2013-09-01
In the present study, potential of Eisenia fetida to recycle the different types of fresh water weeds (macrophytes) used as substrate in different reactors (Azolla pinnata reactor, Trapa natans reactor, Ceratophyllum demersum reactor, free-floating macrophytes mixture reactor, and submerged macrophytes mixture reactor) during 2 months experiment is investigated. E. fetida showed significant variation in number and weight among the reactors and during the different fortnights (P macrophytes mixture reactor (number 105 ± 5.77 %; weight 41.07 ± 3.97 % ). ANOVA showed significant variation in cocoon production (F4 = 15.67, P macrophyte affects the growth and reproduction pattern of E. fetida among the different reactors, further the addition of A. pinnata in other macrophytes reactors can improve their recycling by E. fetida.
The Equipment of Using AZOLLA for O2-Supplimentation and its Test
Liu, Xia-Shi; Chen, Min; Bian, Zu-Liang; Liu, Chung-Chu
The water-consuming amount in a long-term astro-navigation is large. In order to reduce the burden of water supply from Earth ground, the space station needs to resolve the problems of water supply. For this reason, the recovery and regeneration of urine solution of spacemen, and its utilization possess a key importance. Many investigations on this aspect have been reported. Our research based on "biological absorption-purification-UV photocatalytic oxidation" techniques with a relevant treating equipment that for a comprehensive treatment to fresh urine of spacemen has been created. In this equipment, the urine solution was used as the nutrient solution for the biological parts in ecological life ensurant system, after absorbing the nutrient, it was decomposed, metabolized and purified in some distance, and created a favorable condition for the follow-up oxidation treatment by UV-Photocatalytic Oxidation. After these two processes, the treated urine solution reached the GB5749-85 standard of water quality. Some main indexes are as table one. Chroma<5-15 Feculent degree-NTU-1.20-3 --5 Total rigidity-according to CaCO3-mg/L-3.60-450 N-NO3--mg/L-0.60-20 Soluble total solid-mg/L-543-1000 Bacterial gross-cfu/ml-13-100 Coliform group-No./L-<3-3 Key words-Photocatalytic Oxidation , Ultraviolet
Potential of Azolla filiculoides in the removal of Ni and Cu from ...
African Journals Online (AJOL)
ra
Heavy metals constitute a serious health risk because they accumulate in soils, water and organisms. One of the methods of ... The aim of this study was to verify the ability of A. filiculoides to fix Ni and Cu from polluted waters. The maximum uptake ..... due to the C–O stretching vibration of ketones, aldehydes and lactones or ...
The biological control of aquatic weeds in South Africa: Current status and future challenges
Directory of Open Access Journals (Sweden)
Martin P. Hill
2017-03-01
Full Text Available Background: Aquatic ecosystems in South Africa are prone to invasion by several invasive alien aquatic weeds, most notably, Eichhornia crassipes (Mart. Solms-Laub. (Pontederiaceae (water hyacinth; Pistia stratiotes L. (Araceae (water lettuce; Salvinia molesta D.S. Mitch. (Salviniaceae (salvinia; Myriophyllum aquaticum (Vell. Conc. Verd. (parrot’s feather; and Azolla filiculoides Lam. (Azollaceae (red water fern. Objective: We review the biological control programme on waterweeds in South Africa. Results: Our review shows significant reductions in the extent of invasions, and a return on biodiversity and socio-economic benefits through the use of this method. These studies provide justification for the control of widespread and emerging freshwater invasive alien aquatic weeds in South Africa. Conclusions: The long-term management of alien aquatic vegetation relies on the correct implementation of biological control for those species already in the country and the prevention of other species entering South Africa.
Economic evaluation of the successful biological control of Azolla filiculoides in South Africa
CSIR Research Space (South Africa)
McConnachie, AJ
2003-09-01
Full Text Available that it was no longer considered a problem in South Africa. The results reflect the dynamics of biological control on site-specific survey information, and place higher benefit–cost ratios achieved in other national level studies in a better context. It also raises...
Studies on urine treatment by biological purification using Azolla and UV photocatalytic oxidation
Liu, Xiaofeng; Chen, Min; Bian, Zuliang; Liu, Chung-Chu
The amount of water consumed in space station operations is very large. In order to reduce the amount of water which must be resupplied from Earth, the space station needs to resolve the problems of water supply. For this reason, the recovery, regeneration and utilization of urine of astronauts are of key importance. Many investigations on this subject have been reported. Our research is based on biological absorption and, purification using UV photocatalytic oxidation techniques to achieve comprehensive treatment for urine. In the treatment apparatus we created, the urine solution is used as part of the nutrient solution for the biological components in our bioregenerative life support system. After being absorbed, the nutrients from the urine were then decomposed, metabolized and purified which creates a favorable condition for the follow-up oxidation treatment by UV photocatalytic oxidation. After these two processes, the treated urine solution reached Chinese national standards for drinking water quality (GB5749-1985).
Directory of Open Access Journals (Sweden)
Nattida Luangmaka
2013-09-01
Full Text Available A field study was undertaken on the residual effect of organic fertilisers applied to the preceding rice cropping on nitrogen fixation of soya in a rice-soya cropping system. The experiment was conducted on a farmer’s lowland paddy in Mae Rim district, Chiang Mai province, Thailand. Organic fertiliser treatments assigned were: 1 control (no fertiliser, 2 animal manure of cattle (AM, 3 compost (CP, 4 azolla (AZ, 5 AM + CP, 6 AM + AZ, 7 CP + AZ and 8 AM + CP + AZ. Soya seeds were planted without rhizobial inoculation in December 2011, four months after the application of organic fertilisers. Nodule weight, total shoot nitrogen accumulation and relative ureide index at various growth stages were recorded as the indices of nitrogen fixation. Results of the study demonstrate that the residues from the application the organic fertilisers of narrow C/N ratios during the land preparation for rice cropping four months before soya cultivation promoted nitrogen fixation by native rhizobia.
Directory of Open Access Journals (Sweden)
Kumar Vidhya
2014-03-01
Full Text Available This experiment was carried out to evaluate the effect of mixed algal diet on dietary profiles of copepods. The microalgae like Spirulina platensis, Chlorella vulgaris and Azolla pinnata were mass cultured in artificial medium for a period of 20 days, cells are harvested, dried, powdered and used as feed. The small freshwater cyclopoids Thermocyclops hyalinus were compared to Mesocyclops aspericornis a species of copepod genera commonly preferred by most of the fish larvae. Both species are easily maintained in culture, when fed with mixed algal diets of equal ratios (1:1:1. Biochemical composition, egg production ratios, growth performance and fatty acids profile of the two different species were analyzed after an experimental period of 15 days, all the nutritional values were found to be high and statistically variable. On the basis of biochemical composition, egg production ratio, growth performance, amino acids and fatty acids profile it is found that M. aspericornis was the suitable candidate for larval fish diets.
Inoculant production in developing countries - Problems, potentials and success
International Nuclear Information System (INIS)
Kannaiyan, S.
2001-01-01
Sustainable agriculture is a long-term goal that seeks to overcome some of problems and constraints that confront the economic viability, environmental soundness and social acceptance of agricultural production systems. In this context, bio-fertilizers assume special significance particularly because they are 'eco-friendly', but also since their alternative, chemical fertilizers are expensive. Undoubtedly, the most commonly used bio-fertilizers are soil bacteria of the genus Rhizobium, but others like Azolla, Azospirillum, various cyanobacteria also contribute significant amounts of N to e.g. rice. Other bacteria like Frankia and Acetobacter contribute N to trees of the genus Casuarina and sugarcane, respectively. Furthermore, although they are rarely used as inoculants, vesicular arbuscular mycorrhizae (VAM) and phosphobacteria help countless plants solubilise and assimilate soil phosphorus. Despite these advantages, bio-fertilizers could be more widely used in developing countries. Contingent upon greater use is improved quality of the inoculants, and all aspects of their production are discussed here. (author)
Photoproduction of hydrogen - A potential system of solar energy bioconversion
Energy Technology Data Exchange (ETDEWEB)
Das, V S.R.
1979-10-01
The photoproduction of hydrogen from water utilizing the photosynthetic capacity of green plants is discussed as a possible means of solar energy conversion. Advantages of the biological production of H/sub 2/ over various physical and chemical processes are pointed out, and the system used for the production of hydrogen by biological agents, which comprises the photosynthetic electron transport chain, ferredoxin and hydrogenase, is examined in detail. The various types of biological hydrogen production systems in bacteria, algae, symbiotic systems and isolated chloroplast-ferredoxin-hydrogenase systems are reviewed. The limitations and the scope for further improvement of the promising symbiotic Azolli-Anabena azollae and chloroplast-ferredoxin-hydrogenase are discussed, and it is concluded that future research should concern itself with the identification of the environmental conditions that would maximize solar energy conversion efficiency, the elimination of the oxygen inhibition of biological hydrogen production, and the definition of the metabolic state for the maximal production of hydrogen.
Soils Newsletter. V. 12, no. 2
International Nuclear Information System (INIS)
1989-12-01
This Newsletter includes reports of four research co-ordination meetings: on isotopic studies on nitrogen fixation and nitrogen cycling by blue-green algae and Azolla (final meeting, September 1989, IAEA, Vienna); on isotopic studies on increasing and stabilizing plant productivity in low phosphate and semi-arid and sub-humid soils of the tropics and sub-tropics (first meeting, October 1989, IAEA, Vienna); on the evaluation and calibration of nuclear techniques compared with traditional methods in soil water studies (July 1989, IAEA, Vienna); and on the use of isotopes in studies to improve the yield and nitrogen fixation of the common bean in Latin America (April 1989, Irapuato, Mexico). A new co-ordinated research programme on the use of nuclear and related techniques in the assessment of irrigation schedules of field crops to increase the effective use of water in irrigation projects is announced, and some of the technical co-operation programmes in the Latin America Region are briefly described. 2 tabs
Directory of Open Access Journals (Sweden)
Maria de Fátima Vieira
2003-12-01
Full Text Available O gafanhoto Cornops aquaticum (Bruner, 1906 (Orthoptera: Acrididae: Leptysminae completa seu ciclo de vida em Eichhornia (Pontederiaceae. Em experimentos ao ar livre, durante o período da enchente, foi verificado que a cópula pode durar entre 40 a 120 minutos. Cada postura tem em média 13,4 ovos (+/- 3,2 e o período de incubação durou 34,1 dias (+/- 1,97. A duração média do desenvolvimento de ovo a adulto foi de 156,2 dias, sendo 34,1 do estágio de ovo, 53,4 do estágio ninfal e 68,7 do estágio adulto. Alimentou-se de 6 espécies de macrófitas aquáticas dentre as 13 oferecidas. Ninfas (N e Adultos (A sobreviveram mais dias em Pistia stratiotes (N = 43 % até 30 dias e A =1 % até 27 dias e Pontederia sp. (N = 85 % e A = 40 % até 24 dias que em Limnobium sp. (N =13% e A =10 % até 12 dias, Ludwigia sp. (N =3 % até 24 dias e A =15 % até 9 dias, Azolla sp. (N =35 % até 9 dias e A =15 % até 12 dias e Paspalum repens (N =3 % até 21 dias e A =5 % até 24 dias.Life cycle of the grasshopper Cornops aquaticum (Bruner, 1906 (Orthoptera: Acrididae: Leptysminae is dependent on Eichhornia (Pontederiaceae. Experiments were carried outdoors during receding water, the Mating last for about 40 and 120 minutes. The ootheca has an average of 13.4 (+/- 3.2 eggs. Incubation lasted for 34.1 days (+/- 1.97. Mean durations of total development from egg to adult was 156.2 days, being 34.1 in the egg stage, 53.4 in the ninphal stage, and 68.7 in the adult stage. Nymphs (N and adults (A accepted only six aquatic macrophytes out of 13 species offered during 30 days; survived more time in Pistia stratiotes (N = 43 %, 30 days and A = 1 %, 27 days and Pontederia sp. (N = 85 % and A = 40 % until 24 days than Limnobium sp. (N =13% and A =10 % until 12 dias, Ludwigia sp. (N =3 %, 24 days and A =15 %, 9 days Azolla sp. (N =35 %, 9 days and A =15 %, 12 days and Paspalum repens (N =3 %, 21 days and A =5 %, 24 days.
International Nuclear Information System (INIS)
Wolterbeek, H.Th.; Meer, A.J.G.M. van der
1996-01-01
A quantitative and sensitive biosensing method has been developed for the determination of γ-ray emitting radionuclides in surface water. The method is based on the concept that at equilibrium the specific radioactivity in the biosensor is equal to the specific radioactivity in water. The method consists of the measurement of both the radionuclide and the element in the biosensor and the determination of the element level in water. This three-way analysis eliminates problems such as unpredictable biosensor behaviour, effects of water elemental composition or further abiotic parameters: what remains is the generally high enrichment (bioaccumulation factor BCF) of elements and radionuclides in the biosensor material. Measurements were performed with floating water plants (Azolla filiculoides Lamk., Spirodela polyrhiza/Lemna sp.) and the fully submerged water plant Ceratophyllum demersum L., which were sampled from ditch water. Concentrations of elements and radionuclides were determined in both water and biosensor plants, using Neutron Activation Analysis (NAA), ICP-MS, and γ-ray spectrometry, respectively. For the latter, both 1 litre samples (Marinelli-geometry) and 1 cm 3 samples (well-type detectors) were applied in measurements. (author)
2014-01-01
Ferns are the only major lineage of vascular plants not represented by a sequenced nuclear genome. This lack of genome sequence information significantly impedes our ability to understand and reconstruct genome evolution not only in ferns, but across all land plants. Azolla and Ceratopteris are ideal and complementary candidates to be the first ferns to have their nuclear genomes sequenced. They differ dramatically in genome size, life history, and habit, and thus represent the immense diversity of extant ferns. Together, this pair of genomes will facilitate myriad large-scale comparative analyses across ferns and all land plants. Here we review the unique biological characteristics of ferns and describe a number of outstanding questions in plant biology that will benefit from the addition of ferns to the set of taxa with sequenced nuclear genomes. We explain why the fern clade is pivotal for understanding genome evolution across land plants, and we provide a rationale for how knowledge of fern genomes will enable progress in research beyond the ferns themselves. PMID:25324969
Guevara, R; Armesto, J J; Caru, M
2002-08-01
The cyanobacteria belonging to the genus Nostoc fix atmospheric nitrogen, both as free-living organisms and in symbiotic associations with a wide range of hosts, including bryophytes, gymnosperms (cycads), the small water fern Azolla (Pteridophyte), the angiosperm genus Gunnera, and fungi (lichens). The Gunnera-Nostoc symbiosis is the only one that involves a flowering plant. In Chile, 12 species of Gunnera have been described with a broad distribution in the temperate region. We examined the genetic diversity of Nostoc symbionts from three populations of Gunnera tinctoria from Abtao, Chiloé Island, southern Chile, and microsymbionts from other two species of Gunnera from southern Chile, using PCR amplification of STRR (short tandemly repeated repetitive) sequences of the Nostoc infected tissue. To our knowledge, this is the first report of PCR fingerprinting obtained directly from symbiotic tissue of Gunnera. Genetic analyses revealed that Nostoc symbionts exhibit important genetic diversity among host plants, both within and between Gunnera populations. It was also found that only one Nostoc strain, or closely related strains, established symbiosis with an individual plant host.
MARKETING STRATEGY FOR START UP BUSINESS OF BROILER PEKING DUCK FARM WITH ECO-GREEN INTEGRATED
Directory of Open Access Journals (Sweden)
Silitonga N.
2018-04-01
Full Text Available The increasing number and the rate of Banten population growth from year to year make it as a potential market which is quite large for the development of broiler duck farming business in the future. In this case, intensive system broiler Peking duck farming which is integrated, economic, and eco-green intensive, eco-green commonly utilizes Azolla microphylla and flour of pluchea leaves and other germ plasmas as the feed supplements. As a company in Peking duck farming with Eco Green concept, it requires the right marketing strategy to get into the target market. Therefore, the focus of this study is the marketing strategy to start up the business of eco-green integrated Peking duck farming. The results of the analysis of this study are that the marketing strategies used are: objectives and target marketing; analysis of market situation, market size, market share, market description; strategy of marketing, segmenting, targeting, positioning; tactics of marketing, networking, interaction, common interest, experience; CRM, continuity marketing, one to one marketing, partnership; blueprint for building a winning sales force; marketing budget, sales estimation, net marketing contribution.
Directory of Open Access Journals (Sweden)
S. Radhakrishnan
2014-03-01
Full Text Available The fishmeal replaced with Spirulina platensis, Chlorella vulgaris and Azolla pinnata and the formulated diet fed to Macrobrachium rosenbergii postlarvae to assess the enhancement ability of non-enzymatic antioxidants (vitamin C and E, enzymatic antioxidants (superoxide dismutase (SOD and catalase (CAT and lipid peroxidation (LPx were analysed. In the present study, the S. platensis, C. vulgaris and A. pinnata inclusion diet fed groups had significant (P < 0.05 improvement in the levels of vitamins C and E in the hepatopancreas and muscle tissue. Among all the diets, the replacement materials in 50% incorporated feed fed groups showed better performance when compared with the control group in non-enzymatic antioxidant activity. The 50% fishmeal replacement (best performance diet fed groups taken for enzymatic antioxidant study, in SOD, CAT and LPx showed no significant increases when compared with the control group. Hence, the present results revealed that the formulated feed enhanced the vitamins C and E, the result of decreased level of enzymatic antioxidants (SOD, CAT and LPx revealed that these feeds are non-toxic and do not produce any stress to postlarvae. These ingredients can be used as an alternative protein source for sustainable Macrobrachium culture.
Energy Technology Data Exchange (ETDEWEB)
Potter, J.; Beaton, A.P.; McDougall, W.J.; Nambudiri, E.M.V.; Vigrass, L.W. (University of Regina, SK (Canada). Energy Research Unit)
1991-12-01
Coal petrology, palynology, paleobotany and mineralogy of the Hart coal indicate deposition under wet, warm-temperate to subtropical climatic conditions in low-lying backswamps with fluvial channels and locally ponded areas. The coal is dominated by mixed xylitic/attrital lithotypes and by huminite macerals with secondary inertinite macerals and minor liptinite macerals. Good correlation exists between lithotypes and maceral composition. Local and vertical variations in proportions of huminites and inertinites reflect frequent fluctuations in water levels, periodic flooding, desiccation and burning of the peat. Swamps were dominated by {ital Glyptostrobus-Taxodium} forest with {ital Betula-Myrica-Alnus} communities and, locally {ital Laevigatosporites}, which are the dominant contributors to the xylite-rich lithotypes. Attrital lithotypes with abundant {ital Pandanus}, {ital Typha} and {ital Azolla} are consistent with wetter areas of a fluvial environment, including ponds and channels. Trace elements Cr, Cu, Mo, Ni, Si, Ti, U, Se, V, W, K and Th, typically associated with syngenetic minerals kaolinite, calcite and quartz, may have a volcanic source. High concentrations of Na, Ba and Ca found in organic complexes are of secondary origin and probably originate in deep source brines rather than marine surface waters. 55 refs., 11 figs., 5 tabs.
Fluoride remediation using floating macrophytes
Directory of Open Access Journals (Sweden)
Naba Kumar Mondal
2014-04-01
Full Text Available Six aquatic macrophytes, such as Pistia stratiotes, Ceratophyllum demersum, Nymphoides indica, Lemna major, Azolla pinnata,and Eichhornia crassipes were considered for remove fluoride from aqueous solution. Five different concentrations (10, 30, 50, and 100 ppm of fluoride solution were taken in 1 L plastic container. Fixed weight (20 g of macrophytes along with 500 ml fluoride solution was taken in each plastic container for 72 hours observation. Results demonstrated all the macrophytes show highest fluoride removal during 24 h to 48 h, but after 72 h their efficiency reduced drastically. The species N. indica showed better removal efficiency than other experimental macrophytes. In general, pigment measurement data indicated higher concentration at 72 h. However, Pistia sp. showed higher concentration of pigmentation at intermediate time interval (48 h. Higher level of dry weight to fresh weight ratio was recorded for L. major and A. pinnata at all concentrations, excepting at 10 ppm. In addition, all macrophytes showed lower RGR at higher concentration. Isotherm study indicated that macrophyte C. demersum is a good fitted with Freundlich and Langmuir isotherm whereas L. major with Langmuir isotherm during 24 hours.
Energy Technology Data Exchange (ETDEWEB)
Wolterbeek, H.Th.; Meer, A.J.G.M. van der [Technische Univ. Delft (Netherlands). Interfacultair Reactor Inst.
1996-11-01
A quantitative and sensitive biosensing method has been developed for the determination of {gamma}-ray emitting radionuclides in surface water. The method is based on the concept that at equilibrium the specific radioactivity in the biosensor is equal to the specific radioactivity in water. The method consists of the measurement of both the radionuclide and the element in the biosensor and the determination of the element level in water. This three-way analysis eliminates problems such as unpredictable biosensor behaviour, effects of water elemental composition or further abiotic parameters: what remains is the generally high enrichment (bioaccumulation factor BCF) of elements and radionuclides in the biosensor material. Measurements were performed with floating water plants (Azolla filiculoides Lamk., Spirodela polyrhiza/Lemna sp.) and the fully submerged water plant Ceratophyllum demersum L., which were sampled from ditch water. Concentrations of elements and radionuclides were determined in both water and biosensor plants, using Neutron Activation Analysis (NAA), ICP-MS, and {gamma}-ray spectrometry, respectively. For the latter, both 1 litre samples (Marinelli-geometry) and 1 cm{sup 3} samples (well-type detectors) were applied in measurements. (author).
Vegetable, livestock and agroindustrial products and byproducts: An alternative tilapia feeding
Directory of Open Access Journals (Sweden)
González Salas, R.
2014-01-01
Full Text Available In the culture of tilapia limited supply and high cost of fish meal have forced nutritionists to consider alternative sources of protein. Due to the importance of the products and by-products in fish feed, this paper aims to show the alternatives that have been used to partially or totally replace fish meal and soybean meal in tilapia growing. This paper showsthe maximum or optimal use of vegetable by-products for tilapia as cottonseed meal, sunflower, canola, soybean and Leucaena. It also deals with the inclusion with agro-industrial by-product such as corn, sorghum, coffee pulp, cocoa, wheat and citrus. The present study also deals with the use of aquatic plants such as Lemna and Azolla, single-celled plant protein source as antibiotics and probiotics. Finally, this paper also refers to animal by-products as silage, manure and earthworm usage. There is a high potential for using plant, livestock and agro-industrial by-products in fresh and processed food for the tilapia, but depending on the product, pretreatment to improve its balance of nutrients or eliminate anti-nutritional factors may be required.
Prajapati, Meera; van Bruggen, Johan J. A.; Dalu, Tatenda; Malla, Rabin
2017-12-01
The study aimed to evaluate the removal of pollutants by floating treatment wetlands (FTWs) using an edible floating plant, and emergent macrophytes. All experiments were performed under ambient conditions. Physico-chemical parameters were measured, along with microbiological analysis of biofilm within the roots, water column, and sludge and gravel zone. Nitrification and denitrification rates were high in the water zone of Azolla filiculoides, Lemna minor, Lactuca sativa, P. stratiotes, and Phragmites australis. Phosphate removal efficiencies were 23, 10, and 15% for the free-floating hydrophytes, emergent macrophytes, and control and edible plants, respectively. The microbial community was relatively more active in the root zone compared to other zones. Pistia stratiotes was found to be the efficient in ammonium (70%) and total nitrogen (59%) removal. Pistia stratiotes also showed the highest microbial activity of 1306 mg day-1, which was 62% of the total volume. Microbial activity was found in the water zone of all FTWs expect for P. australis. The use of P. stratiotes and the edible plant L. sativa could be a potential option to treat domestic wastewater due to relatively high nutrient and organic matter removal efficiency.
Late cretaceous aquatic plant world in Patagonia, Argentina.
Directory of Open Access Journals (Sweden)
N Rubén Cúneo
Full Text Available In this contribution, we describe latest Cretaceous aquatic plant communities from the La Colonia Formation, Patagonia, Argentina, based on their taxonomic components and paleoecological attributes. The La Colonia Formation is a geological unit deposited during a Maastrichtian-Danian transgressive episode of the South Atlantic Ocean. This event resulted in the deposition of a series of fine-grained sediments associated with lagoon systems occurring along irregular coastal plains in northern Patagonia. These deposits preserved a diverse biota, including aquatic and terrestrial plants and animals. The aquatic macrophytes can be broadly divided into two groups: free-floating and rooted, the latter with emergent or floating leaves. Free-floating macrophytes include ferns in Salviniaceae (Azolla and Paleoazolla and a monocot (Araceae. Floating microphytes include green algae (Botryoccocus, Pediastrum and Zygnemataceae. Among the rooted components, marsileaceous water ferns (including Regnellidium and an extinct form and the eudicot angiosperm Nelumbo (Nelumbonaceae are the dominant groups. Terrestrial plants occurring in the vegetation surrounding the lagoons include monocots (palms and Typhaceae, ferns with affinities to Dicksoniaceae, conifers, and dicots. A reconstruction of the aquatic plant paleocommuniy is provided based on the distribution of the fossils along a freshwater horizon within the La Colonia Formation. This contribution constitutes the first reconstruction of a Cretaceous aquatic habitat for southern South America.
Zaporozhets, N. I.; Akhmetiev, M. A.
2013-01-01
The thorough analysis and correlation of Middle-Upper Eocene sections in the Omsk trough (southern West Siberian Platform) recovered by Borehole 9 in its axial part near the Chistoozernoe Settlement (Novosibirsk region) and Borehole 8 on the southern limb near the Russkaya Polyana Settlement (southern Omsk region) revealed hiatuses at the base and top of the Russkaya Polyana Beds, a lithostratigraphic unit defined in the Lyulinvor Formation based on its substantially fine-grained composition and poor siliceous microplankton fossil remains. The overlying Tavda Formation (Middle-Upper Eocene) is traditionally accepted to consist of two subformations. The last formation was deposited in the West Siberian inner sea isolated from the Arctic basin. Particular attention is paid to eustatic sea level fluctuation especially during the period marked by accumulation of Azolla Beds under considerable desalination of surface waters in the basin. The curve of variations in the open sea factor based on the quantitative ratio between organic-walled phytoplankton fossils and higher plant palynomorphs is correlated with the modified version of the wellknown Vail curve. It is established that the West Siberian sea level experienced a brief rise in the terminal late Eocene prior to its complete desiccation at the Eocene-Oligocene transition because of global regression in response to glaciation in Antarctica.
Late Cretaceous Aquatic Plant World in Patagonia, Argentina
Cúneo, N. Rubén; Gandolfo, María A.; Zamaloa, María C.; Hermsen, Elizabeth
2014-01-01
In this contribution, we describe latest Cretaceous aquatic plant communities from the La Colonia Formation, Patagonia, Argentina, based on their taxonomic components and paleoecological attributes. The La Colonia Formation is a geological unit deposited during a Maastrichtian-Danian transgressive episode of the South Atlantic Ocean. This event resulted in the deposition of a series of fine-grained sediments associated with lagoon systems occurring along irregular coastal plains in northern Patagonia. These deposits preserved a diverse biota, including aquatic and terrestrial plants and animals. The aquatic macrophytes can be broadly divided into two groups: free-floating and rooted, the latter with emergent or floating leaves. Free-floating macrophytes include ferns in Salviniaceae (Azolla and Paleoazolla) and a monocot (Araceae). Floating microphytes include green algae (Botryoccocus, Pediastrum and Zygnemataceae). Among the rooted components, marsileaceous water ferns (including Regnellidium and an extinct form) and the eudicot angiosperm Nelumbo (Nelumbonaceae) are the dominant groups. Terrestrial plants occurring in the vegetation surrounding the lagoons include monocots (palms and Typhaceae), ferns with affinities to Dicksoniaceae, conifers, and dicots. A reconstruction of the aquatic plant paleocommuniy is provided based on the distribution of the fossils along a freshwater horizon within the La Colonia Formation. This contribution constitutes the first reconstruction of a Cretaceous aquatic habitat for southern South America. PMID:25148081
Energy Technology Data Exchange (ETDEWEB)
Rai, P.K. [Mizoram Central University, Tanhril (India). School for Earth Science & Natural Resource Management
2008-07-01
This review addresses the global problem of heavy metal pollution originating from increased industrialization and urbanization and its amelioration by using wetland plants both in a microcosm as well as natural/field condition. This review mentions salient features of wetland ecosystems, their vegetation component, and the pros and cons involved in heavy metal removal. Wetland plants are preferred over other bio-agents due to their low cost, frequent abundance in aquatic ecosystems, and easy handling. Constructed wetlands proved to be effective for the abatement of heavy metal pollution from acid mine drainage; landfill leachate; thermal power; and municipal, agricultural, refinery, and chlor-alkali effluent. the physicochemical properties of wetlands provide many positive attributes for remediating heavy metals. Typha, Phragmites, Eichhornia, Azolla, Lemna, and other aquatic macrophytes are some of the potent wetland plants for heavy metal removal. Biomass disposal problem and seasonal growth of aquatic macrophytes are some limitations in the transfer of phytoremediation technology from the laboratory to the field. However, the disposed biomass of macrophytes may be used for various fruitful applications. An ecosustainable model has been developed through the author's various works, which may ameliorate some of the limitations. The creation of more areas for phytoremediation may also aid in wetlands conservation. Genetic engineering and biodiversity prospecting of endangered wetland plants are important future prospects in this regard.
Deciphering the factors associated with the colonization of rice plants by cyanobacteria.
Bidyarani, Ngangom; Prasanna, Radha; Chawla, Gautam; Babu, Santosh; Singh, Rajendra
2015-04-01
Cyanobacteria-rice plant interactions were analyzed using a hydroponics experiment. The activity of plant defense and pathogenesis-related enzymes, scanning electron microscopy, growth, nitrogen fixation (measured as ARA), and DNA fingerprinting assays proved useful in illustrating the nature of associations of cyanobacteria with rice plants. Microscopic analyses revealed the presence of short filaments and coiled masses of filaments of cyanobacteria near the epidermis and cortex of roots and shoot tissues. Among the six cyanobacterial strains employed, Calothrix sp. (RPC1), Anabaena laxa (RPAN8), and Anabaena azollae (C16) were the best performing strains, in terms of colonization in roots and stem. These strains also enhanced nitrogen fixation and stimulated the activity of plant defense/cell wall-degrading enzymes. A significantly high correlation was also recorded between the elicited plant enzymes, growth, and ARA. DNA fingerprinting using highly iterated palindromic sequences (HIP-TG) further helped in proving the establishment of inoculated organisms in the roots/shoots of rice plants. This study illustrated that the colonization of cyanobacteria in the plant tissues is facilitated by increased elicitation of plant enzymes, leading to improved plant growth, nutrient mobilization, and enhanced plant fitness. Such strains can be promising candidates for developing "cyanobacteria colonized-nitrogen-fixing rice plants" in the future. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Water isotopes and the Eocene. A tectonic sensitivity study
Legrande, A. N.; Roberts, C. D.; Tripati, A.; Schmidt, G. A.
2009-04-01
The early Eocene (54 Million years ago) is one of the warmest periods in the last 65 Million years. Its climate is postulated to have been the result of enhanced greenhouse gas concentration, with CO2 roughly 4 times pre-industrial and methane 7 times pre-industrial concentrations. One interesting feature of this period to emerge recently is the intermittent presence of fossilized Azolla, a type of freshwater fern, in the Arctic Ocean. Synchronous (within dating error) with this appearance were major changes in the restriction of the Arctic Ocean and the other global oceans. We investigate this time period using the Goddard Institute for Space Studies ModelE-R, a fully coupled atmosphere-ocean general circulation model that incorporates water isotopes throughout the hydrologic cycle, making it an ideal model to test hypotheses of past climate change and to compare to paleoclimate proxy data. We assess the impact of tectonic variability by using minimal and maximal levels of restriction for the Arctic Ocean seaways. We find that the modulation of connectivity of these basins dramatically alters global salinity distribution, leading to large changes in ocean circulation. Greater restriction of the Arctic Basin is associated with fresh and relatively warmer conditions. The same mechanisms responsible for this redistribution of salt also change the global distribution of water isotopes, and can alias (water isotope) proxy climate signals of warmth.
安徽省水生植物资源的调查与分析%Investigation and Conservation of Resources of Aquatic Higher Plants in Anhui
Institute of Scientific and Technical Information of China (English)
陈明林; 刘玲玲; 张小平
2004-01-01
本文研究了安徽省水生高等植物资源的种类、生境、组成特点、经济价值及植被概况,结果表明本省有水生高等植物44科、72属、138种,其中单子叶植物占优势,分别占科、属、种的40.9%、50.0%、54.4%.各科亲缘关系较远,并且许多科仅有一属的少数种为水生的.其地理成分表明,本地水生种子植物以世界分布属为主,热带成分与温带成分几乎各占一半,基本反映安徽省具有热带和温带的双重性质.水生植被以竹叶眼子菜(Potamogeton malaianus)群落,苦草(Vallisineria spiralis)群落,紫萍(Spirodela polyrrhiza)、浮萍(Lemna minor)群落,满江红(Azolla imbricata)、槐叶苹(Salvinia natans)群落,莲(Nelumbo nucifera)群落为主.
Fish growth, yield and economics of conventional feed and weed based polyculture in ponds
Directory of Open Access Journals (Sweden)
Md Asadujjaman
2016-04-01
Full Text Available Fish growth, yield and economics of polyculture were evaluated for six months from April to September, 2011 in ponds of Kushtia district, Bangladesh under 4 treatments of feeds and weeds as T0: rice bran, wheat bran and mustard oilcake; T1: Azolla; T2: Grass and T3: Banana leaf. Each treatment had 3 replications. Mean initial stocking weight of fishes like Hypophthalmichthyes molitrix, Catla catla, Labeo rohita, Cirrhinus mrigala, Cyprinus carpio, Ctenopharyngodon idella and Barbonymus gonionotus was 62, 64, 57, 54, 63, 65 and 25 g, respectively. Stocking density (11,115 fishes/ha, liming (250 kg/ha, basal fertilization (Cowdung, 1,500 kg/ha; urea, 60 kg/ha; and Triple Super Phosphate, TSP 60 kg/ha and periodic fertilization (Urea, 2.5 kg/ha/day; and TSP, 2.5 kg/ha/day were same for all the treatments. Water quality parameters (water temperature, transparency, dissolved oxygen, pH, alkalinity and free carbon dioxide were monitored fortnightly and fish growth parameters (weight gain and Specific Growth Rate, SGR were monitored monthly. Treatments did not vary significantly for the mean water quality parameters. Treatment T0 varied more significantly (P<0.05 for the mean final weight, weight gain, SGR, survival rate and yield for almost all the species except C. idella and B. gonionotus. Significantly highest CBR was recorded with treatment T1.
Mahmud, Rezwanul; Inoue, Naoto; Kasajima, Shin-Ya; Shaheen, Riffat
2008-01-01
Soil and water contaminated with arsenic (As) pose a major environmental and human health problem in Bangladesh. Phytoremediation, a plant-based technology, may provide an economically viable solution for remediating the As-polluted sites. The use of indigenous plants with a high tolerance and accumulation capacity for As may be a very convenient approach for phytoremediation. To assess the potential of native plant species for phytoremediation, plant and soil samples were collected from four As-contaminated (groundwater) districts in Bangladesh. The main criteria used for selecting plants for phytoremediation were high bioconcentration factors (BCFs) and translocation factors (TFs) of As. From the results of a screening of 49 plant species belonging to 29 families, only one species of fern (Dryopteris filix-mas), three herbs (Blumea lacera, Mikania cordata, and Ageratum conyzoides), and two shrubs (Clerodendrum trichotomum and Ricinus communis) were found to be suitable for phytoremediation. Arsenic bioconcentration and translocation factors > 1 suggest that these plants are As-tolerant accumulators with potential use in phytoextraction. Three floating plants (Eichhornia crassipes, Spirodela polyrhiza, and Azolla pinnata) and a common wetland weed (Monochoria vaginalis) also showed high BCF and TF values; therefore, these plants may be promising candidates for cleaningup As-contaminated surface water and wetland areas. The BCF of Oryza sativa, obtained from As-contaminated districts was > 1, which highlights possible food-chain transfer issues for As-contaminated areas in Bangladesh.
Effect of aquatic plants on 95Zr concentration in slightly polluted water
International Nuclear Information System (INIS)
Shi Jianjun; Yang Ziyin; Chen Hui
2004-01-01
Effect of three aquatic plants (Ceratophyllum demersum, Azolla caroliniana and Eichhornia crassipes) on 95 Zr concentration in slightly polluted water was studied by using isotope tracer techniques. The results showed that the aquatic plants had strong ability of 95 Zr concentration in water. The concentration factor (CF) were from 56.78 to 112.94, so three aquatic plants were suggested be bio-indicators for 95 Zr polluted water. The specific activity of 95 Zr in water decreased with time when the aquatic plants were put in slightly 95 Zr polluted water. The descent of specific activity of 95 Zr in water was very quick during the beginning period (0-3d). The time for the specific activity reduced to 50% was only 3 days, indicating that theres aquatic plants could be used to purge slightly 95 Zr polluted water. The effect of Eichhornia crassipes on purging 95 Zr in water was the best among the three aquatic plants. The specific activity of 95 Zr in bottom clay only decreased 5% after putting aquatic plants in water, indicating that desorption of 95 Zr from bottom clay was not easy. As the bottom clay had strong ability of adsorption and fixation to 95 Zr, the effect of aquatic plant on purging 95 Zr adsorbed by bottom clay was not visible
Biting midges (Diptera: Ceratopogonidae from Martín García Island, Argentina
Directory of Open Access Journals (Sweden)
María M Ronderos
2011-09-01
Full Text Available Nearly 230 species of biting midges have been recorded or described from Argentina; 38 of them are known from the Buenos Aires province and only one is cited from Martín García Island. This paper presents the results raised from six collecting trips which took place on the island during spring 2005, summer 2006 and autumn 2009. Diverse sampling sites including permanent and temporary aquatic environments were chosen, most of the ten sampling sites were ponds of diverse origin, some of these environments were covered with floating vegetation as Lemna gibba, Lemna minuscule, Salvinia biloba, Salvinia minima, Azolla filiculoides, Limnobium laevigatum, Pistia stratiotes, Spirodela intermedia, Wolffiella oblonga and Wolffia columbiana. Other sites were placed in urban and suburban areas. Adults were collected with sweep nets at sunrise and sunset and with light traps at intervals of four to five hours at night, depending on electricity availability on the island. Larvae and pupae were collected with different implements depending on characteristics of each surveyed aquatic habitat. In free standing water, they were captured with small sieves or hand pipettes and micropipettes, flotation techniques were utilized for sampling vegetated areas, free and rooted floating hydrophytes were extracted for removing insects among them. Thirteen species of Ceratopogonidae were collected, three of Atrichopogon Kieffer, three of Forcipomyia Meigen, two of Dasyhelea Kieffer, four of Culicoides Latreille, and one of Bezzia Kieffer, all representing new records from the island. Rev. Biol. Trop. 59 (3: 1183-1194. Epub 2011 September 01.Alrededor de 230 especies de ceratopogónidos han sido registradas o descritas en Argentina, 38 de ellas son conocidas para la provincia de Buenos Aires y sólo una ha sido previamente citada para la Isla Martín García. En este trabajo se presentan los resultados obtenidos a partir de muestreos realizados en seis viajes a la isla
Speelman, Eveline N.; Sewall, Jacob O.; Noone, David; Huber, Matthew; von der Heydt, Anna; Damsté, Jaap Sinninghe; Reichart, Gert-Jan
2010-09-01
Proxy-based climate reconstructions suggest the existence of a strongly reduced equator-to-pole temperature gradient during the Azolla interval in the Early/Middle Eocene, compared to modern. Changes in the hydrological cycle, as a consequence of a reduced temperature gradient, are expected to be reflected in the isotopic composition of precipitation (δD, δ 18O). The interpretation of water isotopic records to quantitatively reconstruct past precipitation patterns is, however, hampered by a lack of detailed information on changes in their spatial and temporal distribution. Using the isotope-enabled version of the National Center for Atmospheric Research (NCAR) atmospheric general circulation model, Community Atmosphere Model v.3 (isoCAM3), relationships between water isotopes and past climates can be simulated. Here we examine the influence of an imposed reduced meridional sea surface temperature gradient on the spatial distribution of precipitation and its isotopic composition in an Early/Middle Eocene setting. As a result of the applied forcings, the Eocene simulation predicts the occurrence of less depleted high latitude precipitation, with δD values ranging only between 0 and -140‰ (compared to Present-day 0 to -300‰). Comparison with Early/Middle Eocene-age isotopic proxy data shows that the simulation accurately captures the main features of the spatial distribution of the isotopic composition of Early/Middle Eocene precipitation over land in conjunction with the aspects of the modeled Early/Middle Eocene climate. Hence, the included stable isotope module quantitatively supports the existence of a reduced meridional temperature gradient during this interval.
Biting midges (Diptera: Ceratopogonidae from Martín García Island, Argentina
Directory of Open Access Journals (Sweden)
María M Ronderos
2011-09-01
Full Text Available Nearly 230 species of biting midges have been recorded or described from Argentina; 38 of them are known from the Buenos Aires province and only one is cited from Martín García Island. This paper presents the results raised from six collecting trips which took place on the island during spring 2005, summer 2006 and autumn 2009. Diverse sampling sites including permanent and temporary aquatic environments were chosen, most of the ten sampling sites were ponds of diverse origin, some of these environments were covered with floating vegetation as Lemna gibba, Lemna minuscule, Salvinia biloba, Salvinia minima, Azolla filiculoides, Limnobium laevigatum, Pistia stratiotes, Spirodela intermedia, Wolffiella oblonga and Wolffia columbiana. Other sites were placed in urban and suburban areas. Adults were collected with sweep nets at sunrise and sunset and with light traps at intervals of four to five hours at night, depending on electricity availability on the island. Larvae and pupae were collected with different implements depending on characteristics of each surveyed aquatic habitat. In free standing water, they were captured with small sieves or hand pipettes and micropipettes, flotation techniques were utilized for sampling vegetated areas, free and rooted floating hydrophytes were extracted for removing insects among them. Thirteen species of Ceratopogonidae were collected, three of Atrichopogon Kieffer, three of Forcipomyia Meigen, two of Dasyhelea Kieffer, four of Culicoides Latreille, and one of Bezzia Kieffer, all representing new records from the island. Rev. Biol. Trop. 59 (3: 1183-1194. Epub 2011 September 01.
Directory of Open Access Journals (Sweden)
Upma MANRAL
2013-02-01
Full Text Available Okhla Bird Sanctuary (OBS is an Important Bird Area, which comes under the protected area network of Uttar Pradesh with one-third area lying in the state of Delhi (India. OBS has widest flood plains along the Delhi stretch of river Yamuna and is important in conserving the ecological wealth of floodplains of the river. Rapid urbanization and industrialization and discharge of untreated wastewater into the river have resulted in deteriorated water quality. The present study focused on assessment of water quality, aquatic flora and avifaunal diversity in the OBS. Water quality was analyzed following methods of APHA. For vegetation analysis, sub-merged and free-floating plants were scooped up from five randomly selected sites. Total bird counts were conducted for water birds and species richness, evenness and Shannon-Weaver species diversity indices were calculated. Results indicate that the organic load is very high in the wetland as evident from low levels of dissolved oxygen (2.26 ± 1.62 mg/l and high Biological and Chemical Oxygen Demands (15.20 ± 3.75 mg/l, 44.60 ± 12.07 mg/l. Nine species of free-floating and submerged plants were recorded; Hydrilla verticillata, Vallisneria spiralis, Azolla pinnata and Ceratophyllum demersum dominated both deep and shallow water areas. 52 species of waterbirds including four near-threatened species viz., Anhinga melanogaster, Mycteria leucocephala, Threskiornis melanocephalus and Aythya nyroca were recorded. OBS provides opportunities for conservation in a metropolitan area, thus, appropriate measures should be taken to maintain its ecological integrity.
Directory of Open Access Journals (Sweden)
Leterme Pascal
2005-12-01
Full Text Available La metodología para estimar la tasa de fermentación de los forrajes se desarrolló en dos etapas. La primera, de digestibilidad enzimática, simula la digestión ocurrida en el estómago e intestino delgado, mediante el empleo de pepsina y pancreatina; en esta se determina la digestibilidad de la materia seca. La segunda etapa de fermentación simula la fermentación que ocurre en el intestino grueso utilizando como inóculo heces de cerdo; en esta se determina la cantidad de gas producido durante la fermentación de los forrajes y la degradación de la fibra detergente neutra (FDN. Las dos etapas presentaron buena repetibilidad en el tiempo. Abstract Develop of an in vitro methodology to determine the forages fermentation in to the large intestine. The methodology was developing in two phases. The first phase (enzymatic digestibility simulates the digestion occurred in the stomach and small intestine, by means of the employment of pepsin and pancreatin; and the digestibility of the dry matter is determined. The second phase (in vitro fermentation simulates the fermentation that occurs in the large intestine utilizing pig faeces; the quantity of gas produced during the fermentation of the feedstuff is determined and determine the degradation of neutral detergent fiber (NDF. All the phases show a good repeatability throw the time. Key words: digestibility in vitro, pigs, fermentación, forages (Azolla filiculoides, Xanthosoma saggitifolium, Morus alba, Trichanthera gigantea y Salvinia molesta.
Directory of Open Access Journals (Sweden)
Aaron F Collins
2013-12-01
Full Text Available The Galápagos Islands are known to have experienced significant drought during the Quaternary. The loss of mesophytic upland habitats has been suggested to underlie the relatively lower endemism of upland compared with lowland plant assemblages. A fossil pollen record spanning the last 26,000 years from an upland bog on Santa Cruz Island, revealed the persistent presence of highland pollen and spore types during the last glacial maximum and a millennial-scale series of droughts in the mid Holocene. The absence of lowland taxa and presence of mesic taxa led to the conclusion that the highland flora of the Galápagos persisted during both these periods. The resiliency of the highland flora of the Galápagos to long-term drought contradicts an earlier hypothesis that an extinction of highland taxa occurred during the last glacial maximum and that rapid Holocene speciation created the modern plant assemblage within the last 10,000 years. Based on the palynological data, we suggest that, even during the height of glacial and Holocene droughts, cool sea-surface temperatures and strong trade-wind activity would have promoted persistent ground level cloudiness that provided the necessary moisture inputs to maintain microrefugia for mesophytic plants. Although moist conditions were maintained, the lack of precipitation caused the loss of open water habitat during such events, and accounts for the known extinctions of species such as Azolla sp., and Elatine sp., while other moisture dependent taxa, i.e. Cyathea weatherbyana, persisted.
Sensitivity of aquatic organisms to ethanol and its potential use as bioindicators
Directory of Open Access Journals (Sweden)
Adilson Ferreira Silva
2016-12-01
Full Text Available The aim of this research was to evaluate the feasibility for the use of the organisms Lemna minor, Azolla caroliniana, Hyphessobrycon eques, Pomacea canaliculata and Daphnia magna as exposure bioindicators for ethanol (lethal and effective concentration 50% - LC50(I/EC50(I. Thus, the following concentrations were used 5.0; 10.0; 20.0; 30.0; 40.0 and 50.0 mg L-1 ethanol on L. minor; 25.0; 50.0; 75.0; 100.0; 150.0 and 200.0 mg L-1 on A. caroliniana; 0.3; 0.5; 1.0; 2.0 and 3.0 mg L-1 on H. eques; 0.05; 0.10; 0.20; 0.40 and 0.80 mg L-1 on P. canaliculata; and 40.0; 60.0; 80.0; 100.0; 120.0 and 140.0 mg L-1 on D. magna. An untreated control was also kept for all organisms, with three repetitions. The increase in the ethanol concentration elevated the electrical conductivity and decreased the water dissolved oxygen and pH. The ethanol LC50 for L. minor and A. caroliniana were 12.78 and 73.11 mg L-1, respectively, and was classified as slightly toxic; 1.22 mg L-1 for H. eques (moderately toxic; 0.39 mg L-1 for P. canaliculata (highly toxic and 98.85 mg L-1 for D. magna (slightly toxic. Thus, H. eques and P. canaliculata have showed good potential for the use as ethanol exposure bioindicators on water bodies.
Bercovici, A.; Vajda, V.; Lyson, T. R.; Chester, S. G. B.; Sargis, E. J.; Pearson, D. A.; Joyce, W. G.
2012-04-01
We report here the discovery of the stratigraphically youngest in situ dinosaur specimen. This ceratopsian brow horn was found in southeastern Montana, in the Western Interior of the United States in a poorly rooted, silty mudstone floodplain deposit and only 13 centimeters below the palynologically defined K-Pg boundary. The boundary is identified using three criteria: 1) substantial decrease in diversity and abundance of Cretaceous pollen and spore taxa that completely disappear from the palynological record a few meters above the boundary, 2) the presence of a "fern spike", and 3) palynostratigraphical correlation to a nearby section where primary extraterrestrial impact markers are present (e.g., iridium anomaly, spherules and shocked quartz). The palynological record in the rock sequence immediately following the K-Pg boundary consistently indicates a sudden and major loss of the Cretaceous components across the North American record. During this rapid decline, the palynological assemblages are dominated by freshwater ferns (Azolla) and algae (usually Pediastrum sp. and Penetetrapites sp.) indicating generalized flooding in the area. The onset of the Paleocene sedimentation is subsequently announced by the presence of variegated beds, multiple lignite seams and small scale meandering river systems, starting with palynological associations that attest for reworking and erosion. The destabilization of terrestrial ecosystems is coincident with the markers of the K-Pg boundary, supporting a catastrophic event taking place over a very short duration. The in situ ceratopsian brow horn demonstrates that a gap devoid of non-avian dinosaur fossils in the last meters of the Cretaceous is artificial and thus inconsistent with the hypothesis that non-avian dinosaurs were extinct prior to the K-Pg boundary asteroid impact event.
Climate sensitivity to Arctic seaway restriction during the early Paleogene
Roberts, Christopher D.; LeGrande, Allegra N.; Tripati, Aradhna K.
2009-09-01
The opening and closing of ocean gateways affects the global distribution of heat, salt, and moisture, potentially driving climatic change on regional to global scales. Between 65 and 45 million years ago (Ma), during the early Paleogene, exchange between the Arctic and global oceans occurred through two narrow and shallow seaways, the Greenland-Norway seaway and the Turgai Strait. Sediments from the Arctic Ocean suggest that, during this interval, the surface ocean was warm, brackish, and episodically enabled the freshwater fern Azolla to bloom. The precise mechanisms responsible for the development of these conditions in the Paleogene Arctic remain uncertain. Here we show results from an isotope-enabled, atmosphere-ocean general circulation model, which indicate that Northern Hemisphere climate would have been very sensitive to the degree of oceanic exchange through the Arctic seaways. We also present modelled estimates of seawater and calcite δ18O for the Paleogene. By restricting these seaways, we simulate freshening of the surface Arctic Ocean to ~ 6 psu and warming of sea-surface temperatures by 2 °C in the North Atlantic and 5-10 °C in the Labrador Sea. Our results may help explain the occurrence of low-salinity tolerant taxa in the Arctic Ocean during the Eocene and provide a mechanism for enhanced warmth in the north western Atlantic. We propose that the formation of a volcanic land-bridge between Greenland and Europe could have caused increased ocean convection and warming of intermediate waters in the Atlantic. If true, this result is consistent with the theory that bathymetry changes may have caused thermal destabilisation of methane clathrates and supports a tectonic trigger hypothesis for the Paleocene Eocene Thermal Maximum (PETM).
Institute of Scientific and Technical Information of China (English)
刘红玉; 周朴华; 杨仁斌; 廖柏寒; 鲁双庆; 余苹中
2001-01-01
采用室内培养实验方法, 以植物的生长量、过氧化氢酶(CAT)和过氧化物酶(POD)活性变化作为观测指标,研究了直链烷基苯磺酸钠(LAS)对稀脉浮萍(Lemna paucicostata L.)、满江红(Azolla imbricata(Roxb.) Nakai)、水网藻(Hydrodictyon sp.)生理生化特性的影响. 结果表明,当 LAS浓度超过 1 mg@ L-1时,稀脉浮萍的生长受到严重抑制,在 10、100 mg@ L-1下,出现负增长. CAT、POD活性变化与细胞受伤程度直接相关,可作为植物分子生态毒理学指标. LAS浓度在 0-10 mg@ L-1范围内,随着浓度升高,酶活性增加,清除细胞中由于 LAS产生的过氧化物伤害; 当浓度超过 10 mg@ L-1时,植物受到明显损伤,甚至死亡. 同时发现, CAT、POD活性水平与植物的类群直接相关, 被子植物稀脉浮萍的酶活性比蕨类植物满江红的高,藻类植物水网藻酶活性最低.
Oxygen uptake from aquatic macrophyte decomposition from Piraju Reservoir (Piraju, SP, Brazil
Directory of Open Access Journals (Sweden)
I. Bianchini Jr.
Full Text Available The kinetics of oxygen consumption related to mineralisation of 18 taxa of aquatic macrophytes (Cyperus sp, Azolla caroliniana, Echinodorus macrophyllus, Eichhornia azurea, Eichhornia crassipes, Eleocharis sp1, Eleocharis sp2, Hetereanthera multiflora, Hydrocotyle raniculoides, Ludwigia sp, Myriophyllum aquaticum, Nymphaea elegans, Oxycaryum cubense, Ricciocarpus natans, Rynchospora corymbosa, Salvinia auriculata, Typha domingensis and Utricularia foliosa from the reservoir of Piraju Hydroelectric Power Plant (São Paulo state, Brazil were described. For each species, two incubations were prepared with ca. 300.0 mg of plant (DW and 1.0 L of reservoir water sample. The incubations were maintained in the dark and at 20 ºC. Periodically the dissolved oxygen (DO concentrations were measured; the accumulated DO values were fitted to 1st order kinetic model and the results showed that: i high oxygen consumption was observed for Ludwigia sp (533 mg g-1 DW, while the lowest was registered for Eleocharis sp1 (205 mg g-1 DW mineralisation; ii the higher deoxygenation rate constants were verified in the mineralisation of A. caroliniana (0.052 day-1, H. raniculoides (0.050 day-1 and U. foliosa (0.049 day-1. The oxygen consumption rate constants of Ludwigia sp and Eleocharis sp2 mineralisation (0.027 day-1 were the lowest. The half-time of oxygen consumption varied from 9 to 26 days. In the short term, the detritus of E. macrophyllus, H. raniculoides, Ludwigia sp, N. elegans and U. foliosa were the critical resources to the reservoir oxygen demand; while in the long term, A. caroliniana, H. multiflora and T. domingensis were the resources that can potentially contribute to the benthic oxygen demand of this reservoir.
Retnaningdyah, Catur
2017-11-01
The objective of this research was to determine the effectiveness of a phytoremediation process using some local hydro macrophytes to reduce fertilizer residue in irrigation water in order to support healthy agriculture and to prevent eutrophication and algae bloom in water. A phytoremediation process was carried out in a hydroponic floating system by using transparent plastic bags of 1 m in diameter and 1 m in height that were placed in collecting ponds before they were used for agricultural activities. Paddy soils were used as substrates in this system. The irrigation water was treated with nutrient enrichment (Urea and SP-36 fertilizers). Then, the system was planted with remediation actors (Azolla sp., Ipomoea aquatica, Limnocharis flava, Marsilea crenata, polyculture of those hydro macrophytes and control). The improvement of the water quality as a result of the phytoremediation process was characterized by a decline in the concentration of some physicochemical parameters, which were measured at 7 days after incubation, as well as an increase in the plankton diversity index value. The results showed that all of the hydro macrophytes used in this research, which was grown in the hydroponic batch culture system for a period of 7 days, were able to significantly improve the irrigation water quality, which was enriched by the synthetic fertilizers Urea and SP36. This was reflected by a significant decrease in the concentration of water TSS, nitrate, BOD, COD and total phosphate and an increase in the value of water DO at 7 days after incubation. Improvement of the water quality is also reflected in the increasing plankton diversity index value as a bioindicator of water pollution indicating a change in the pollution status from moderately polluted to slightly polluted at 7 days after incubation.
Eocene climate and Arctic paleobathymetry: A tectonic sensitivity study using GISS ModelE-R
Roberts, C. D.; Legrande, A. N.; Tripati, A. K.
2009-12-01
The early Paleogene (65-45 million years ago, Ma) was a ‘greenhouse’ interval with global temperatures warmer than any other time in the last 65 Ma. This period was characterized by high levels of CO2, warm high-latitudes, warm surface-and-deep oceans, and an intensified hydrological cycle. Sediments from the Arctic suggest that the Eocene surface Arctic Ocean was warm, brackish, and episodically enabled the freshwater fern Azolla to bloom. The precise mechanisms responsible for the development of these conditions remain uncertain. We present equilibrium climate conditions derived from a fully-coupled, water-isotope enabled, general circulation model (GISS ModelE-R) configured for the early Eocene. We also present model-data comparison plots for key climatic variables (SST and δ18O) and analyses of the leading modes of variability in the tropical Pacific and North Atlantic regions. Our tectonic sensitivity study indicates that Northern Hemisphere climate would have been very sensitive to the degree of oceanic exchange through the seaways connecting the Arctic to the Atlantic and Tethys. By restricting these seaways, we simulate freshening of the surface Arctic Ocean to ~6 psu and warming of sea-surface temperatures by 2°C in the North Atlantic and 5-10°C in the Labrador Sea. Our results may help explain the occurrence of low-salinity tolerant taxa in the Arctic Ocean during the Eocene and provide a mechanism for enhanced warmth in the north western Atlantic. We also suggest that the formation of a volcanic land-bridge between Greenland and Europe could have caused increased ocean convection and warming of intermediate waters in the Atlantic. If true, this result is consistent with the theory that bathymetry changes may have caused thermal destabilisation of methane clathrates in the Atlantic.
Multiple Modes of Cell Death Discovered in a Prokaryotic (Cyanobacterial) Endosymbiont
Zheng, Weiwen; Rasmussen, Ulla; Zheng, Siping; Bao, Xiaodong; Chen, Bin; Gao, Yuan; Guan, Xiong; Larsson, John; Bergman, Birgitta
2013-01-01
Programmed cell death (PCD) is a genetically-based cell death mechanism with vital roles in eukaryotes. Although there is limited consensus on similar death mode programs in prokaryotes, emerging evidence suggest that PCD events are operative. Here we present cell death events in a cyanobacterium living endophytically in the fern Azolla microphylla, suggestive of PCD. This symbiosis is characterized by some unique traits such as a synchronized development, a vertical transfer of the cyanobacterium between plant generations, and a highly eroding cyanobacterial genome. A combination of methods was used to identify cell death modes in the cyanobacterium. Light- and electron microscopy analyses showed that the proportion of cells undergoing cell death peaked at 53.6% (average 20%) of the total cell population, depending on the cell type and host developmental stage. Biochemical markers used for early and late programmed cell death events related to apoptosis (Annexin V-EGFP and TUNEL staining assays), together with visualization of cytoskeleton alterations (FITC-phalloidin staining), showed that all cyanobacterial cell categories were affected by cell death. Transmission electron microscopy revealed four modes of cell death: apoptotic-like, autophagic-like, necrotic-like and autolytic-like. Abiotic stresses further enhanced cell death in a dose and time dependent manner. The data also suggest that dynamic changes in the peptidoglycan cell wall layer and in the cytoskeleton distribution patterns may act as markers for the various cell death modes. The presence of a metacaspase homolog (domain p20) further suggests that the death modes are genetically programmed. It is therefore concluded that multiple, likely genetically programmed, cell death modes exist in cyanobacteria, a finding that may be connected with the evolution of cell death in the plant kingdom. PMID:23822984
Review: Biological fertilization and its effect on medicinal and aromatic plants
Directory of Open Access Journals (Sweden)
KHALID ALI KHALID
2012-11-01
Full Text Available Khalid KA. 2012. Review: Biological fertilization and its effect on medicinal and aromatic plants. Nusantara Bioscience 4: 124-133. The need of increase food production in the most of developing countries becomes an ultimate goal to meet the dramatic expansion of their population. However, this is also associated many cases with a reduction of the areas of arable land which leaves no opinion for farmers but to increase the yield per unit area through the use of improved the crop varieties, irrigation and fertilization. The major problem facing the farmer is that he cannot afford the cost of these goods, particularly that of chemical fertilizers. Moreover, in countries where fertilizer production relies on imported raw materials, the costs are even higher for farmer and for the country. Besides this, chemical fertilizers production and utilization are considered as air, soil and water polluting operations. The utilization of bio-fertilizers is considered today by many scientists as a promising alternative, particularly for developing countries. Bio-fertilization is generally based on altering the rhizosphere flora, by seed or soil inoculation with certain organisms, capable of inducing beneficial effects on a compatible host. Bio-fertilizers mainly comprise nitrogen fixes (Rhizobium, Azotobacter, Azospirellum, Azolla or blue green algae, phosphate dissolvers or vesicular-arbuscular mycorrhizas and silicate bacteria. These organisms may affect their host plant by one or more mechanisms such as nitrogen fixation, production of growth promoting substances or organic acids, enhancing nutrient uptake or protection against plant pathogens. Growth characters, yield, essential oil and its constituents, fixed oil, carbohydrates, soluble sugars and nutrients contents of medicinal and aromatic plants were significantly affected by adding the biological fertilizers compared with recommended chemical fertilizers.
Multiple Modes of Cell Death Discovered in a Prokaryotic (Cyanobacterial Endosymbiont.
Directory of Open Access Journals (Sweden)
Weiwen Zheng
Full Text Available Programmed cell death (PCD is a genetically-based cell death mechanism with vital roles in eukaryotes. Although there is limited consensus on similar death mode programs in prokaryotes, emerging evidence suggest that PCD events are operative. Here we present cell death events in a cyanobacterium living endophytically in the fern Azolla microphylla, suggestive of PCD. This symbiosis is characterized by some unique traits such as a synchronized development, a vertical transfer of the cyanobacterium between plant generations, and a highly eroding cyanobacterial genome. A combination of methods was used to identify cell death modes in the cyanobacterium. Light- and electron microscopy analyses showed that the proportion of cells undergoing cell death peaked at 53.6% (average 20% of the total cell population, depending on the cell type and host developmental stage. Biochemical markers used for early and late programmed cell death events related to apoptosis (Annexin V-EGFP and TUNEL staining assays, together with visualization of cytoskeleton alterations (FITC-phalloidin staining, showed that all cyanobacterial cell categories were affected by cell death. Transmission electron microscopy revealed four modes of cell death: apoptotic-like, autophagic-like, necrotic-like and autolytic-like. Abiotic stresses further enhanced cell death in a dose and time dependent manner. The data also suggest that dynamic changes in the peptidoglycan cell wall layer and in the cytoskeleton distribution patterns may act as markers for the various cell death modes. The presence of a metacaspase homolog (domain p20 further suggests that the death modes are genetically programmed. It is therefore concluded that multiple, likely genetically programmed, cell death modes exist in cyanobacteria, a finding that may be connected with the evolution of cell death in the plant kingdom.
Energy Technology Data Exchange (ETDEWEB)
Samson, R.; Mulkins, L. [Resource Efficient Agricultural Production-Canada, Ste. Anne de Bellevue, PQ (Canada); Amongo, L.; Yap, E. [MASIPAG, Los Banos, Laguna (Philippines); Mendoza, T. [Univ. of the Philippines Los Banos, Laguna (Philippines). Dept of Agronomy
2000-07-01
A former haciendero owned sugarcane plantation in Negros Occidental, Philippines was transformed into a diversified, self-reliant, agro-ecological village, and its transition is documented in this paper. In 1995, through the Comprehensive Agrarian Reform Program, the Philippine Government awarded 87 hectares of land to 76 hacienda workers. Community organizing, farm planning, training in organic farming, and loan support from a number of social welfare agencies were all areas where the community received assistance. The sugarcane production has been reduced at Flora since the land transition, and the community diversified into the growing of organic rice, corn and vegetables. Through its transition into an agro-ecological village, the Flora community has become more self-reliant in the areas of food and energy. Most individual farms and communally farmed areas have adopted organic based farming practices. The main products sold off the farm are sugarcane and high value vegetables. The MASIPAG rice farming system is being adhered to in the production of rice, the community's staple food. Nitrogen fixed during straw decomposition and the use of azolla, a nitrogen-fixing plant, represent some of the sources of nitrogen for the rice production. Other nutrient sources used are the mudpress from sugarcane processing and rice hull ash. To encourage nitrogen fixation and soil carbon accumulation from cane litter, a system of continuous trash farming was implemented for the production of sugarcane. In excess of 140 water buffaloes (carabaos) are employed for tillage and on-farm hauling, which minimizes the requirements for fossil fuels. Liquid propane gas (LPG), kerosene and wood fuel use in home cooking are being minimized by the efficient rice hull cookers. The local environmental impacts and greenhouse gas emissions are minimized, and the Flora community largely meets its requirements in terms of food security, on-farm energy and income. refs., 1 tab., 12 figs.
Phylogeny of Marsileaceous Ferns and Relationships of the Fossil Hydropteris pinnata Reconsidered.
Pryer
1999-09-01
Recent phylogenetic studies have provided compelling evidence that confirms the once disputed hypothesis of monophyly for heterosporous leptosporangiate ferns (Marsileaceae and Salviniaceae). Hypotheses for relationships among the three genera of Marsileaceae (Marsilea, Regnellidium, and Pilularia), however, have continued to be in conflict. The phylogeny of Marsileaceae is investigated here using information from morphology and rbcL sequence data. In addition, relationships among all heterosporous ferns, including the whole-plant fossil Hydropteris pinnata are reconsidered. Data sets of 71 morphological and 1239 rbcL characters for 23 leptosporangiate ferns, including eight heterosporous ingroup taxa and 15 homosporous outgroup taxa, were subjected to maximum parsimony analysis. Morphological analyses were carried out both with and without the fossil Hydropteris, and it was excluded from all analyses with rbcL data. An annotated list of the 71 morphological characters is provided in the appendix. For comparative purposes, the Rothwell and Stockey (1994) data set was also reanalyzed here. The best estimate of phylogenetic relationships for Marsileaceae in all analyses is that Pilularia and Regnellidium are sister taxa and Marsilea is sister to that clade. Morphological synapomorphies for various nodes are discussed. Analyses that included Hydropteris resulted in two most-parsimonious trees that differ only in the placement of the fossil. One topology is identical to the relationship found by Rothwell and Stockey (1994), placing the fossil sister to the Azolla plus Salvinia clade. The alternative topology places Hydropteris as the most basal member of the heterosporous fern clade. Equivocal interpretations for character evolution in heterosporous ferns are discussed in the context of these two most-parsimonious trees. Because of the observed degree of character ambiguity, the phylogenetic placement of Hydropteris is best viewed as unresolved, and recognition of the
Directory of Open Access Journals (Sweden)
B. M. Bhanderi
2016-12-01
Full Text Available Abstract Background Deficiency of macro and micro-minerals in the ration of dairy cows adversely affects growth, milk production and reproduction efficiency. It is essential to examine mineral concentrations in feeds offered to dairy cows in practical farms. Methods Two villages from each taluka were selected at random for taking representative samples of feeds, forages and hair. Within the village, help was sought from village milk producers and district animal husbandry officer for identification of 4 to 5 farmers and collection of representative samples. All the samples were processed and analyzed for chemical composition as well as major macro and micro-minerals, using Inductively Coupled Plasma-Optical Emission Spectrometer. Results Ca content in wheat straw (0.29%, crushed maize (0.02% and wheat bran (0.12% was found to be below the critical level (0.30%. The P content in concentrate ingredients was high (0.26–0.96%, but low in dry roughages (0.06–0.12%. Cereal straws (0.14% and grains (0.12% were deficient in Mg. Feeds and forages were found to be adequate in K (1.50%. Cereals straws were found to be deficient in S (0.11%. Greens were good source of Cu (12.02 ppm. Wheat straw was found to be low in Zn (18 ppm, but high in Mn (225 ppm and Fe (509 ppm. Local grasses and azolla green were found to be rich source of Co (>1.00 ppm. Se (0.63 ppm was present in appreciable quantities in most of the feedstuffs. Conclusions From the present study, it was apparent that the feeds and forages available in the state of Jharkhand may not meet the requirements for Ca, P, Mg, Cu, Zn and Co in order to sustain a milk production of ~10 kg/day. Therefore, it is necessary to supplement these deficient minerals through area specific mineral mixture in the ration of dairy cows for improving productivity and reproduction efficiency.
Tang, Yingying; Harpenslager, Sarah F.; van Kempen, Monique M. L.; Verbaarschot, Evi J. H.; Loeffen, Laury M. J. M.; Roelofs, Jan G. M.; Smolders, Alfons J. P.; Lamers, Leon P. M.
2017-02-01
The sequestration of nutrients from surface waters by aquatic macrophytes and sediments provides an important service to both natural and constructed wetlands. While emergent species take up nutrients from the sediment, submerged and floating macrophytes filter nutrients directly from the surface water, which may be more efficient in constructed wetlands. It remains unclear, however, whether their efficiency is sufficient for wastewater purification and how plant species and nutrient loading affects nutrient distribution over plants, water and sediment. We therefore determined nutrient removal efficiencies of different vegetation (Azolla filiculoides, Ceratophyllum demersum and Myriophyllum spicatum) and sediment types (clay, peaty clay and peat) at three nutrient input rates, in a full factorial, outdoor mesocosm experiment. At low loading (0.43 mg P m-2 d-1), plant uptake was the main pathway (100 %) for phosphorus (P) removal, while sediments showed a net P release. A. filiculoides and M. spicatum showed the highest biomass production and could be harvested regularly for nutrient recycling, whereas C. demersum was outcompeted by spontaneously developing macrophytes and algae. Higher nutrient loading only stimulated A. filiculoides growth. At higher rates ( ≥ 21.4 mg P m-2 d-1), 50-90 % of added P ended up in sediments, with peat sediments becoming more easily saturated. For nitrogen (N), 45-90 % was either taken up by the sediment or lost to the atmosphere at loadings ≥ 62 mg N m-2 d-1. This shows that aquatic macrophytes can indeed function as an efficient nutrient filter but only for low loading rates (polishing) and not for high rates (purification). The outcome of this controlled study not only contributes to our understanding of nutrient dynamics in constructed wetlands but also shows the differential effects of wetland sediment types and plant species. Furthermore, the acquired knowledge may benefit the application of macrophyte harvesting to remove
Late Miocene (Pannonian) Vegetation from the Northern Part of Central Paratethys
Kováčová, M.; Doláková, N.
2009-04-01
During Late Miocene, the Western Carpathian paleogeography started to change. The Lake Pannon retreated southwards, and the northern coast of the back arc basin was slightly elevated due to progradation of deltaic and alluvial facies, especially in the lowlands. The studied „Pannonian lake" sediments come from the Czech and Slovak parts of Central Paratethys. Changes of the sedimentary environment from deep to shallow lake and deltaic environment, followed by development of alluvial plains were noticed. Salinity crisis due to Paratethys isolation led to development of total freshwater environment to the end of this period. Samples from 3 surficial localities and 15 boreholes were palynologically studied. Occasional occurences of Dinoflagellates indicate a slightly higher salinity, whereas green algae Pediastrum, aquatic ferns Azolla, and aquatic and coastal plants (Nelumbo, Nymphaea, Myriophyllum, Sparganium, Potamogeton, Cyperaceae etc.) represent a freshwater environment. Due to paleogeographic changes and climatic oscillations the number of thermophilous taxa decreased and some of them disappeared completely from this area (f. e. Sapotaceae, Palmae). Mostly broad-leaved deciduous elements of mixed mesophytic forests (Quercus, Celtis, Carya, Tilia, Carpinus, Betula, Juglans) with some thermophilous elements admixture of Engelhardia, Castanea, Trigonobalanopsis, Symplocos, Cornaceaepollis satzveyensis generally dominate. Variously high relief of the uplifted mountainy chains created ideal conditions for higher presence of extrazonal vegetation (Cedrus, Tsuga, Picea, Cathaya) in the investigated area. Zonal type of vegetation including marshes, riparian forests with Alnus, Salix, Pterocarya, Liquidambar, Betula, Fraxinus, shrubs and lianas on dryer substrates associated riparian forest (Buxus, Ericaceae, Vitaceae, Lonicera, Rosaceae type Rubus), and coastal swamps with Taxodiaceae, Nyssa, Myrica, Sciadopitys were growing in the floodplain lowlands of Vienna Basin
Roe, Helen M.; Coope, G. Russell; Devoy, Robert J. N.; Harrison, Colin J. O.; Penkman, Kirsty E. H.; Preece, Richard C.; Schreve, Danielle C.
2009-11-01
Multidisciplinary investigations of the vegetational, faunal and sea-level history inferred from the infills of buried channels on the coast of eastern Essex have a direct bearing on the differentiation of MIS 11 and MIS 9 in continental records. New data are presented from Cudmore Grove, an important site on Mersea Island that can be linked to the terrace sequence of the River Thames. The vegetational history has been reconstructed from a pollen sequence covering much of the interglacial represented. The temperate nature of the climate is apparent from a range of fossil groups, including plant remains, vertebrates (especially the rich herpetofauna), molluscs and beetles, which all have strong thermophilous components. The beetle data have been used to derive a Mutual Climatic Range reconstruction, suggesting that mean July temperatures were about 2 °C warmer than modern values for southeast England, whereas mean January temperatures may have been slightly colder. The sea-level history has been reconstructed from the molluscs, ostracods and especially the diatoms, which indicate that the marine transgression occurred considerably earlier in the interglacial cycle than at the neighbouring Hoxnian site at Clacton. There are a number of palynological similarities between the sequence at Cudmore Grove and Clacton, especially the presence of Abies and the occurrence of Azolla filiculoides megaspores. Moreover, both sites have yielded Palaeolithic archaeology, indeed the latter is the type site of the Clactonian (flake-and-core) industry. However, the sites can be differentiated on the basis of mammalian biostratigraphy, new aminostratigraphic data, as well as the differences in the sea-level history. The combined evidence suggests that the infill of the channel at Cudmore Grove accumulated during MIS 9, whereas the deposits at Clacton formed during MIS 11. The infill of a much later channel, yielding non-marine molluscs and vertebrates including Hippopotamus, appears
Speelman, E. N.; Sewall, J. O.; Noone, D. C.; Huber, M.; Sinninghe Damsté, J. S.; Reichart, G.
2009-12-01
Proxy-based climate reconstructions suggest the existence of a strongly reduced equator-to-pole temperature gradient during most of the Early Eocene. With the realization that the Eocene Arctic Ocean was covered with enormous quantities of the free floating freshwater fern Azolla, new questions related to Eocene (global) hydrological cycling facilitating these blooms arose. Changes in hydrological cycling, as a consequence of a reduced temperature gradient, are expected to be most clearly reflected in the isotopic composition (D, 18O) of precipitation. The interpretation of water isotopic records to quantitatively estimate past precipitation patterns is, however, hampered by the lack of detailed information on changes in their spatial and temporal distribution. Using the isotope-enabled global circulation model, Community Atmosphere Model v.3 (isoCAM3), relationships between water isotopes and past climates can be simulated. Here we examine the influence of a reduced meridional sea surface temperature gradient on the spatial distribution of precipitation and its isotopic composition in an Eocene setting. Overall, our combination of Eocene climate forcings, with superimposed TEX86-derived SST estimates and elevated pCO2 concentrations, produces a climate that agrees well with proxy data in locations around the globe. It shows the presence of an intensified hydrological cycle with precipitation exceeding evaporation in the Arctic region. The Eocene model runs with a significantly reduced equator-to-pole temperature gradient in a warmer more humid world predict occurrence of less depleted precipitation, with δD values ranging only between 0 and -140‰ (as opposed to the present-day range of 0 to -300‰). Combining new results obtained from compound specific isotope analyses on terrestrially derived n-alkanes extracted from Eocene sediments, and model calculations, shows that the model not only captures the main features, but reproduces isotopic values
Directory of Open Access Journals (Sweden)
Eduardo A. Morales
2012-06-01
Full Text Available Alalay Pond is a 230-hectare, shallow aquatic ecosystem within Cochabamba, the third largest city in Bolivia. With the aim to determine the suitability of epiphytic diatoms for water quality assessment in the pond and to choose a substrate that would hold a representative bioindicator epiphytic community, the macrophytes Schoenoplectus californicus subsp. tatora (Kunth T. Koyama, Typha dominguensis Pers., Myriophyllum verticillatum L. and Azolla filiculoides Lam. were selected and differences in diatom community composition and structure were tested. Diatoms were collected during four sampling campaigns in the March-September, 2011 period, from three stations contiguous to the pelagic zone and prepared for analysis using standard, internationally used protocols. In all, 27 samples were collected from which 28 taxa characteristic of eutrophic environments were identified and 17 others could not be assigned names from the literature. Although many of the species are shared among sampling sites, the epiphytic communities developing at each station were different in structure and composition. Although, there are marked temporal variations in community features on each of the macrophytes, Shannon-Wiener and Pielou indexes, as well as canonical correspondence analysis, showed no marked differences within a single campaign and station among the 4 macrophytes. Shifts in structure and composition are denoted less commonly by species replacement and more often by changes in percent relative abundance of dominant and rare species. Very few species are restricted to a station or seem to show strong preference for a particular substrate. Taking into account growth, structural and ecological characteristics, as well as some phenological features of the macrophytes, S. californicus subsp. tatora and T. dominguensis are the most suitable substrates for water quality assessments in the pond. As demonstrated by multivariate analyses, among-site and time
The Heidelberg Basin Drilling Project - Sedimentology and Stratigraphy of the Quaternary succession
Ellwanger, Dietrich; Gabriel, Gerald; Hahne, Jürgen; Hoselmann, Christian; Menzies, John; Simon, Theo; Weidenfeller, Michael; Wielandt-Schuster, Ulrike
2010-05-01
Within the context of the Heidelberg Basin Drilling Project (Gabriel et al. 2008), a detailed sediment succession is presented here based upon deep drillings taken at Heidelberg UniNord and Mannheim Käfertal. Sediment structures, and micromorphological and pollen analyses were conducted and used to reconsider some of the climate transitions within the lower Pleistocene. A new and novel scenario is postulated regarding the preservation of Quaternary sediment packages within the Cenozoic Graben environment of the Heidelberg basin. The palynological evidence comprises the periods of warm climate of the Holsteinian (mainly Abies (fir), some Fagus (beech), Pterocarya & Azolla); the Cromerian (Pinus-Picea-QM (pine-spruce-QM)); the Bavelian (Abies, Tsuga (hemlock fir), QM & phases of increased NAP including Pinus); the Waalian (Abies, Tsuga, QM); and the Tiglian (Fagus & early Pleistocene taxa especially Sciadopytis, downward increasing Tertiary taxa). The sediment package was studied both macroscopically and microscopically. Both techniques provide evidence of fluvial, lacustrine and mass movement sedimentary processes. Some include evidence of periglacial processes (silt droplets within fine grained sands indicative of frozen ground conditions). The periglacial structures are often, not always, accompanied by pollen spectra dominated by pine and NAP. E.g. the Tiglian part of the succession shows periglacial sediment structures at its base and top but not in its middle sections. I.e. it appears not as a series of warm and cold phases but rather as a constant warm period with warm-cold-alternations at its bottom and top. All results illustrate sediment preservation in the Heidelberg basin almost throughout the Quaternary. This may be due to tectonic subsidence, but also to compaction by sediment loading of underlying fine sediments (Oligocene to Quaternary) leading to incomplete but virtually continuous sediment preservation (Tanner et al. 2009). References Gabriel, G
Pengaruh Macam dan Waktu Aplikasi Bahan Organik pada Tanaman Ubi Jalar (Ipomoea batatas L. Var. Kawi
Directory of Open Access Journals (Sweden)
Nur Edy Suminarti
2015-07-01
Full Text Available Diversifikasi pangan merupakan langkah tepat untuk mengantisipasi kondisi rawan pangan. Hal ini menjadi penting karena setiap tahun luas lahan basah telah mengalami penyusutan sekitar 0,1% dari total luas lahan di Indonesia. Sehubungan dengan hal tersebut, dan dalam upaya untuk memenuhi kebutuhan pangan nasional, maka pemanfaatan ubi jalar sebagai sumber bahan pangan alternatif perlu dilakukan. Penelitian yang bertujuan untuk mendapatkan informasi tentang macam dan waktu aplikasi bahan organik yang tepat telah dilakukan di Desa Landungsari, Kabupaten Malang. Rancangan yang digunakan adalah Petak Terpisah, macam bahan organik ditempatkan pada petak utama, terdiri dari 3 macam, yaitu pupuk kandang sapi, kompos azolla dan kompos sampah kota. Waktu aplikasi bahan organik sebagai anak petak, terdiri dari 3 macam, yaitu : 30 hari sebelum tanam, 15 hari sebelum tanam dan bersamaan tanam. Pengumpulan data dilakukan secara destruktif, meliputi komponen pertumbuhan dan panen, analisis pertumbuhan tanaman dan analisis tanah. Uji F taraf 5% ditujukan untuk menguji pengaruh perlakuan, sedang perbedaan diantara rata-rata perlakuan didasarkan pada nilai BNT taraf 5%. Interaksi nyata terjadi pada sebagian besar parameter yang diamati, dan hasil umbi tertinggi didapatkan pada kompos sampah kota yang waktu aplikasinya dilakukan 30 hari sebelum tanam : 28,03 ton umbi ha-1. Food diversification is a precise step to anticipate food shortage condition. It becomes important because wetland area is decreasing of approximately 0,1% each year of total area in Indonesia. Related to that point, also in order to meet food national demand, utilization of sweet potato as alternative food resource needs to be done. Research aimed to get information about proper kind and application time of organic matter had been done at Landungsari, Malang. The design used was Split Plot, kind of organic matter was placed as main plot, consisting of 3 kinds, ie: cow manure, azzola
Directory of Open Access Journals (Sweden)
Sukhendu Dey
2016-12-01
Full Text Available Present study deals with the effects of glyphosate-based herbicide, Excel Mera 71 on Anabas testudineus, Heteropnestes fossilis and Oreochromis niloticus in field conditions (1.85 kg/ha based on anti-oxidative, metabolic and digestive responses. For this study following biomarkers viz., acetylcholinesterase (AChE, lipid peroxidation (LPO, catalase (CAT, glutathione-S-transferase (GST, alkaline phosphatase (ALP, aspartate aminotransferase (AST, alanine aminotransferase (ALT, amylase, lipase and protease were investigated in gill, stomach, intestine, liver, kidney, brain, muscle and spinal cord of the concerned fish species. Enzyme activities were significantly altered by glyphosate exposure after 30 days, these activities were tissue as well as species specific. The results suggested that these biomarkers could be used to assess the ecological risks of glyphosate on fish. Bioaccumulation factor (BAF studied in different aquatic natural macrophytes showed order of Alternanthera philoxeroides > Azolla pinnata > Lemna sp. (Minor > Lemna sp. (Major > Pistia stratiotes, while transfer factor (TF showed the order of Pistia stratiotes > Alternanthera philoxeroides > Lemna sp. Bioconcentration factor (BCF study showed maximum accumulation of glyphosate in liver, kidney or intestine, and minimum either in bone or stomach irrespective of fish species. An integrated biomarker response (IBR, which uses a battery of biomarkers to calculate the standardized scores for each biomarker responses ranging from physiological to biochemical/molecular responses, was evaluated by combining the multiple biomarkers into a single value to evaluate quantitatively the toxicological effects of glyphosate. In general, the multiple indices exhibited variations and A. testudineus was more affected than other fish species; maximum IBR value was observed for LPO and minimum in case of ALT. The order of integrated biomarkers caused by glyphosate treatment was
Paleoclimate records at high latitude in Arctic during the Paleogene
Salpin, Marie; Schnyder, Johann; Baudin, François; Suan, Guillaume; Labrousse, Loïc; Popescu, Speranta; Suc, Jean-Pierre
2015-04-01
Paleoclimate records at high latitude in Arctic during the Paleogene SALPIN Marie1,2, SCHNYDER Johann1,2, BAUDIN François1,2, SUAN Guillaume3, LABROUSSE Loïc1,2, POPESCU Speranta4, SUC Jean-Pierre1,4 1: Sorbonne Universités, UPMC Univ Paris 06, UMR 7193, Institut des Sciences de la Terre Paris (iSTeP), F 75005, Paris, France 2: CNRS, UMR 7193, Institut des Sciences de la Terre Paris (iSTeP), F 75005 Paris, France 3: UCB Lyon 1, UMR 5276, LGLTPE, 69622 Villeurbanne Cedex, France 4: GEOBIOSTRATDATA.CONSULTING, 385 Route du Mas Rillier 69140 Rillieux la Pape, France The Paleogene is a period of important variations of the Earth climate system either in warming or cooling. The climatic optima of the Paleogene have been recognized both in continental and marine environment. This study focus on high latitudes of the northern hemisphere, in the Arctic Basin. The basin has had an influence on the Cenozoic global climate change according to its polar position. Is there a specific behaviour of the Arctic Basin with respect to global climatic stimuli? Are there possible mechanisms of coupling/decoupling of its dynamics with respect to the global ocean? To answer these questions a unique collection of sedimentary series of Paleogene age interval has been assembled from the Laurentian margin in Northern Yukon (Canada) and from the Siberian margin (New Siberian Islands). Selected continental successions of Paleocene-Eocene age were used to study the response of the Arctic system to known global events, e.g. the climatic optima of the Paleogene (the so-called PETM, ETM2 or the Azolla events). Two sections of Paleocene-Eocene age were sampled near the Mackenzie delta, the so-called Coal Mine (CoMi) and Caribou Hills (CaH) sections. The aim of the study is to precise the climatic fluctuations and to characterise the source rock potential of the basin, eventually linked to the warming events. This study is based on data of multi-proxy analyses: mineralogy on bulk and clay
Influence of fertilization on the capability of rice resistance to diseases
Hu, Xue-Feng; Chang, Yue-Ya; Jiang, Ying; Yan, Xiao-Juan; Luo, Fan
2013-04-01
Organic cultivation of rice requires no use of any agricultural chemicals during the entire period of growth, and so the rice's self-prevention of diseases and pests is vitally important. A field experiment was carried out to study the possible influence of different fertilization on the capability of rice resistance to diseases and pests. A rice variety used for this experiment is Jia-He 218. Four treatments (A, B, C and D) were designed: A is a control, without using any fertilizers; B, after manuring of green azolla, 0.67 kg/m2; C, after manuring of rapeseed cake, 0.30 kg/m2; D, after fertilizing of ammonium bicarbonate, 0.025 kg/m2, and urea, 0.025 kg/m2. The experiment plot is 66.7 m2, with three replicates. The results indicated that the fertilization patterns significantly influence the growth of rice seedlings: The heights by A, B, C and D are 37 cm, 40 cm , 42 cm and 45 cm on average, respectively; the spike numbers, 45, 65, 73 and 75, respectively; chlorophyll contents in leaves, 1.84 mg/g, 2.42 mg/g, 3.02 mg/g and 3.97 mg/g, respectively. The rice with the different fertilization also varies in nutrient concentration in leaves: NH4-N concentration in leaves by A, B, C and D is 47.5 mg/kg, 61.1 mg/kg, 74.7 mg/kg and 135.8 mg/kg on average, respectively; NO3-N in leaves, 138.9 mg/kg, 185.2 mg/kg, 154.3 mg/kg and 293.2 mg/kg, respectively. The fertilization patterns, moreover, show a significant influence on the incidence of diseases and pests to rice seedlings: The incidence of rice cnaphalocrocis medinalis by A, B, C and D is 1.33 %, 1.50 %, 1.75 % and 89.0 % on average, respectively; that of bacterial leaf blight, 0, 1.25 %, 1.75 % and 85.0 %, respectively; number of rice planthopper in each plant, 20, 21, 21 and 30, respectively. As a result, the yield of rice grain by A, B, C and D is 4540 kg/ha, 4606 kg/ha, 4503 kg/ha and 4092 kg/ha on average, respectively. In conclusion, the rice seedlings treated with chemical fertilizers grow large and tender
Hashimoto, S.; Yamaguchi, K. E.; Takahashi, K.
2012-12-01
The modern Arctic Ocean plays crucial roles in controlling global climate system with the driving force of global thermohaline circulation through the formation of dense deep water and high albedo due to the presence of perennial sea-ice. However, the Arctic sea-ice has not always existed in the past. Integrated Ocean Drilling Program (IODP) Expedition 302 Arctic Coring Expedition (ACEX) has clarified that global warming (water temperature: ca. 14~16○C) during 48~49 Ma Azolla Event induced the loss of sea-ice and desalination of surface ocean, and that sea-ice formed again some million years later (45 Ma). In the Arctic Ocean, warming and cooling events repeated over and over (e.g., Brinkhuis et al., 2006; Moran et al., 2006; März et al., 2010). Large variations in the extent of thermohaline circulation through time often caused stagnation of seawater and appearance of anaerobic environment where hydrogen sulfide was produced by bacterial sulfate reduction. Ogawa et al. (2009) confirmed occurrence of framboidal pyrite in the ACEX sediments, and suggested that the Arctic Ocean at the time was anoxic, analogous to the modern Black Sea, mainly based on sulfur isotope analysis. To further clarify the variations in the nutrient status of the Arctic Ocean, we focus on the geochemical cycle of phosphorus. We performed sequential extraction analysis of sedimentary phosphorus in the ACEX sediments, using the method that we improvped based on the original SEDEX method by Ruttenberg (1992) and Schenau et al. (2000). In our method, phosphorus fractions are divided into five forms; (1) absorbed P, (2) Feoxide-P, (4) carbonate fluorapatite (CFAP) + CaCO3-P + hydroxylapatite (HAP), (4) detrital P, and (5) organic P. Schenau et al. (2000) divided the (3) fraction into non-biological CFAP and biological HAP and CaCO3-P. When the Arctic Ocean was closed and in its warming period, the water mass was most likely stratified and an anaerobic condition would have prevailed where
Directory of Open Access Journals (Sweden)
Henrik Nøhr-Hansen
2016-12-01
Full Text Available New analyses of the palynological assemblages in 13 offshore wells on the Canadian margin and six on the West Greenland Margin, in conjunction with onshore data, have led to a new biostratigraphic framework for the Cretaceous–Cenozoic strata of the Labrador Sea – Davis Strait – Baffin Bay (Labrador–Baffin Seaway region and the first broad biostratigraphic correlation of the Canadian and Greenland margins. This framework is based on 167 last occurrences and 18 local/regional peak/common-occurrence events for dinocysts, miospores, fungal spores and Azolla. Detailed biostratigraphic evidence has confirmed the following hiatuses: pre-Aptian in the Hopedale Basin; pre-Albian in the Saglek Basin; Albian–Turonian in some wells of the Hopedale Basin; Turonian–Santonian/Campanian in some areas; pre-Campanian and late Campanian – Thanetian on the Greenland Margin; late Maastrichtian and Danian in some wells of the Hopedale Basin and in the Saglek Basin; Selandian in part of the Hopedale Basin, in all the Saglek Basin wells and in two wells on the West Greenland Margin; late Ypresian and/or Lutetian on both sides; Oligocene to middle Miocene of considerable variability on both margins, with all of the Oligocene and the lower Miocene missing in all the West Greenland Margin wells; and middle to late Miocene on the western side. On the Canadian margin, the hiatuses can be partially matched with the five previously recognised regional unconformities; on the Greenland margin, however, the relationship to the five unconformities is more tenuous. Palynomorph assemblages show that most Aptian to Albian sediments were deposited in generally non-marine to marginal marine settings, interrupted by a short-lived shallow marine episode in the Aptian. A marine transgression started in the Cenomanian–Turonian and led to the most open-marine, oceanic conditions in the Campanian–Lutetian; shallowing probably started in the late Lutetian and continued into
Directory of Open Access Journals (Sweden)
Henrik Nøhr-Hansen
2016-12-01
Full Text Available New analyses of the palynological assemblages in 13 offshore wells on the Canadian margin and six on the West Greenland Margin, in conjunction with onshore data, have led to a new biostratigraphic framework for the Cretaceous–Cenozoic strata of the Labrador Sea – Davis Strait – Baffin Bay (Labrador–Baffin Seaway region and the first broad biostratigraphic correlation of the Canadian and Greenland margins. This framework is based on 167 last occurrences and 18 local/regional peak/common-occurrence events for dinocysts, miospores, fungal spores and Azolla. Detailed biostratigraphic evidence has confirmed the following hiatuses: pre-Aptian in the Hopedale Basin; pre-Albian in the Saglek Basin; Albian–Turonian in some wells of the Hopedale Basin; Turonian–Santonian/Campanian in some areas; pre-Campanian and late Campanian – Thanetian on the Greenland Margin; late Maastrichtian and Danian in some wells of the Hopedale Basin and in the Saglek Basin; Selandian in part of the Hopedale Basin, in all the Saglek Basin wells and in two wells on the West Greenland Margin; late Ypresian and/or Lutetian on both sides; Oligocene to middle Miocene of considerable variability on both margins, with all of the Oligocene and the lower Miocene missing in all the West Greenland Margin wells; and middle to late Miocene on the western side. On the Canadian margin, the hiatuses can be partially matched with the five previously recognised regional unconformities; on the Greenland margin, however, the relationship to the five unconformities is more tenuous. Palynomorph assemblages show that most Aptian to Albian sediments were deposited in generally non-marine to marginal marine settings, interrupted by a short-lived shallow marine episode in the Aptian. A marine transgression started in the Cenomanian–Turonian and led to the most open-marine, oceanic conditions in the Campanian–Lutetian; shallowing probably started in the late Lutetian and continued into
Directory of Open Access Journals (Sweden)
Henrik Nøhr-Hansen
2016-12-01
Full Text Available New analyses of the palynological assemblages in 13 offshore wells on the Canadian margin and six on the West Greenland Margin, in conjunction with onshore data, have led to a new biostratigraphic framework for the Cretaceous–Cenozoic strata of the Labrador Sea – Davis Strait – Baffin Bay (Labrador–Baffin Seaway region and the first broad biostratigraphic correlation of the Canadian and Greenland margins. This framework is based on 167 last occurrences and 18 local/regional peak/common-occurrence events for dinocysts, miospores, fungal spores and Azolla. Detailed biostratigraphic evidence has confirmed the following hiatuses: pre-Aptian in the Hopedale Basin; pre-Albian in the Saglek Basin; Albian–Turonian in some wells of the Hopedale Basin; Turonian–Santonian/Campanian in some areas; pre-Campanian and late Campanian – Thanetian on the Greenland Margin; late Maastrichtian and Danian in some wells of the Hopedale Basin and in the Saglek Basin; Selandian in part of the Hopedale Basin, in all the Saglek Basin wells and in two wells on the West Greenland Margin; late Ypresian and/or Lutetian on both sides; Oligocene to middle Miocene of considerable variability on both margins, with all of the Oligocene and the lower Miocene missing in all the West Greenland Margin wells; and middle to late Miocene on the western side. On the Canadian margin, the hiatuses can be partially matched with the five previously recognised regional unconformities; on the Greenland margin, however, the relationship to the five unconformities is more tenuous. Palynomorph assemblages show that most Aptian to Albian sediments were deposited in generally non-marine to marginal marine settings, interrupted by a short-lived shallow marine episode in the Aptian. A marine transgression started in the Cenomanian–Turonian and led to the most open-marine, oceanic conditions in the Campanian–Lutetian; shallowing probably started in the late Lutetian and continued into
Directory of Open Access Journals (Sweden)
Y.V. SINGH
2013-03-01
Full Text Available The system of rice intensification (SRI is reported to have advantages like lower seed requirement, less pest attack, shorter crop duration, higher water use efficiency and the ability to withstand higher degree of moisture stress than traditional method of rice cultivation. With this background, SRI was compared with traditional transplanting technique at Indian Agricultural Research Institute, New Delhi, India during two wet seasons (2009–2011. In the experiment laid out in a factorial randomized block design, two methods of rice cultivation [conventional transplanting (CT and SRI] and two rice varieties (Pusa Basmati 1 and Pusa 44 were used under seven crop nutrition treatments, viz. T1, 120 kg/hm2 N, 26.2 kg/hm2 P and 33 kg/hm2 K; T2, 20 t/hm2 farmyard manure (FYM; T3, 10 t/hm2 FYM + 60 kg/hm2 N; T4, 5 t/hm2 FYM + 90 kg/hm2 N; T5, 5 t/hm2 FYM + 60 kg/hm2 N + 1.5 kg/hm2 blue green algae (BGA; T6, 5 t/hm2 FYM + 60 kg/hm2 N + 1.0 t/hm2 Azolla, and T7, N0P0K0 (control, no NPK application to study the effect on seed quality, yield and water use. In SRI, soil was kept at saturated moisture condition throughout vegetative phase and thin layer of water (2–3 cm was maintained during the reproductive phase of rice, however, in CT, standing water was maintained in crop growing season. Results revealed that CT and SRI gave statistically at par grain yield but straw yield was significantly higher in CT as compared to SRI. Seed quality was superior in SRI as compared to CT. Integrated nutrient management (INM resulted in higher plant height with longer leaves than chemical fertilizer alone in both the rice varieties. Grain yield attributes such as number of effective tillers per hill, panicle length and panicle weight of rice in both the varieties were significantly higher in INM as compared to chemical fertilizer alone. Grain yields of both the varieties were the highest in INM followed by the recommended doses of chemical fertilizer. The grain yield
Directory of Open Access Journals (Sweden)
F.P. Guimaraes
2012-12-01
Full Text Available The potential of three aquatic macrophytes, Azoll caroliniana, Salvinia minima and Lemna gibba, was evaluated in this work aimed at selection of plants to be used in remediation of environments contaminated by arsenic (As. The experiments were carried out in a greenhouse during six days in pots containing Hoagland solution (¼ ionic strength at As concentrations of 0.5; 2.5 and 5.0 mg L-1. The three species showed greater As accumulation as the concentration of the metalloid in solution increased. However, a reduction was detected in fresh and dry mass gain when the plants were exposed to high As concentrations. The macrophytes showed differences in efficiency of removal of As in solution. A. caroliniana, S. minima and L. gibba accumulated, on average, 0.130; 0.200; and 1.397 mg mDM-1, respectively, when exposed to 5.0 mg L-1 of As. The macrophytes absorbed a greater quantity of As in solution with low phosphate content. The greater As concentration in L. gibba tissues lowered the chlorophyll and carotenoid contents as shown by the high chlorosis incidence. Lemna gibba also exhibited a decrease in leaf size, with the total chlorophyll and carotenoid synthesis not being affected by As in A. caroliniana. This species exhibited purplish leaves with high concentration of anthocyanin, whose presence suggested association to phosphate deficiency. Marginal necrosis occurred on S. minima floating leaves, with the released daughter-plants not showing any visual symptoms during the treatment. The percentage of As removed from the solution decreased when the plants were exposed to high concentrations of the pollutant. Among the three species studied, only L. gibba could be considered an As hyper-accumulator. The use of this plant species for remediation of aquatic environments was shown to be limited and requires further investigation.O potencial de três macrófitas aquáticas - Azolla caroliniana, Salvinia mínima e Lemna gibba - foi avaliado neste