International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Mediation. 218.33 Section 218.33 Foreign... § 218.33 Mediation. (a) Referral of complaints for mediation. The agency will refer to the Federal Mediation and Conciliation Service all complaints that: (1) fall within the jurisdiction of these...
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Review. 218.32 Section 218.32 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Procedures § 218.32 Review. (a) Purpose and scope. This subpart establishes the procedures for the filing of an application for review of a supply order...
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Pricing. 218.12 Section 218.12 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Supply Orders § 218.12 Pricing. The price for oil subject to a supply order issued pursuant to this subpart shall be based on the price conditions...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH218 (Link to dictyBase) - - - Contig-U16325-1 SLH218F (Link to Original site) SLH2...18F 419 - - - - - - Show SLH218 Library SL (Link to library) Clone ID SLH218 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH218Q.Seq.d/ Representative seq. ID SLH21...8F (Link to Original site) Representative DNA sequence >SLH218 (SLH218Q) /CSM/SL/SLH2-A/SLH218Q.Seq.d/ CCATG...) /CSM/SL/SLI3-C/SLI370Q.Seq.d/ 831 0.0 SLI170 (SLI170Q) /CSM/SL/SLI1-C/SLI170Q.Seq.d/ 831 0.0 SLH218 (SLH218Q) /CSM/SL/SLH2-A/SLH2
29 CFR 1910.218 - Forging machines.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Forging machines. 1910.218 Section 1910.218 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.218 Forging machines. (a... other identifier, for the forging machine which was inspected. (ii) Scheduling and recording the...
42 CFR 438.218 - Enrollee information.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollee information. 438.218 Section 438.218 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... and Operation Standards § 438.218 Enrollee information. The requirements that States must meet under...
49 CFR 218.37 - Flag protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Flag protection. 218.37 Section 218.37..., DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Trains and Locomotives § 218.37 Flag protection. (a) After August 1, 1977, each railroad must have in effect an operating rule which complies with...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 218.9 Section 218.9 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES General § 218.9 Civil penalty. Any person (an entity of any type... requirement of this part or causes the violation of any such requirement is subject to a civil penalty of at...
10 CFR 218.11 - Supply orders.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Supply orders. 218.11 Section 218.11 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Supply Orders § 218.11 Supply orders. (a) A supply order shall require that the firm to which it is issued take actions specified therein relating to...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Sick pay. 218.28 Section 218.28 Employees... Beginning Date § 218.28 Sick pay. (a) From railroad employer. If the employee is carried on the payroll while sick, the annuity can begin no earlier than the day after the last day of sick pay. However, sick...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Vacation pay. 218.27 Section 218.27 Employees... Beginning Date § 218.27 Vacation pay. (a) From railroad employer. Vacation pay may be credited to the... vacation pay is credited to the vacation period, the annuity can begin no earlier than the day after the...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
2010-10-01
... system of transportation, or (2) Rapid transit operations in an urban area that are not connected with... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 218.3 Section 218.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...
30 CFR 218.152 - Fishermen's Contingency Fund.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Fishermen's Contingency Fund. 218.152 Section 218.152 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE..., Offshore § 218.152 Fishermen's Contingency Fund. Upon the establishment of the Fishermen's Contingency Fund...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Person. 93.218 Section 93.218 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Enforcement. 31.218 Section 31.218 Money and Finance: Treasury Office of the Secretary of the Treasury TROUBLED ASSET RELIEF PROGRAM... more of the following sanctions: (1) Rejection of work tainted by an organizational conflict of...
14 CFR 21.8 - Approval of articles.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Approval of articles. 21.8 Section 21.8 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.8 Approval of articles. If an article is required to be...
48 CFR 218.201 - Contingency operation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contingency operation. 218... Flexibilities 218.201 Contingency operation. (1) Selection, appointment, and termination of appointment... in a contingency contracting force. See 201.603-2(2). (2) Policy for unique item identification...
36 CFR 218.14 - Judicial proceedings.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Judicial proceedings. 218.14... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects Authorized by the Healthy Forests Restoration Act of 2003 § 218.14 Judicial proceedings. The objection...
49 CFR 218.99 - Shoving or pushing movements.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Shoving or pushing movements. 218.99 Section 218... Derails § 218.99 Shoving or pushing movements. (a)(1) Each railroad shall adopt and comply with an... violated the requirements of this section. (2) The following requirements for shoving or pushing movements...
22 CFR 218.23 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Self-evaluation. 218.23 Section 218.23 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF AGE IN PROGRAMS OR... the agency and to the public for a period of three years following its completion. ...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Other wine. 24.218 Section... THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.218 Other wine. (a) General. Other than standard wine not included in other sections in this subpart are considered other wine. Those...
MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications
Energy Technology Data Exchange (ETDEWEB)
Lu, Ying-fei [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Zhang, Li [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Department of Anatomical and Cellular Pathology, State Key Laboratory of Oncology in South China, Prince of Wales Hospital, The Chinese University of Hong Kong, Hong Kong (China); Waye, Mary Miu Yee [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Fu, Wei-ming, E-mail: wm.fu@giat.ac.cn [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Zhang, Jin-fang, E-mail: zhangjf06@cuhk.edu.hk [Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Shenzhen Research Institute, The Chinese University of Hong Kong, Shenzhen (China)
2015-05-15
MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.
MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications
International Nuclear Information System (INIS)
Lu, Ying-fei; Zhang, Li; Waye, Mary Miu Yee; Fu, Wei-ming; Zhang, Jin-fang
2015-01-01
MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways
49 CFR 218.22 - Utility employee.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Utility employee. 218.22 Section 218.22... employee. (a) A utility employee shall be subject to the Hours of Service Act, and the requirements for... parts 217, 219, and 228 of this chapter. (b) A utility employee shall perform service as a member of...
49 CFR 218.80 - Movement of occupied camp cars.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of occupied camp cars. 218.80 Section 218... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.80 Movement of occupied camp cars. Occupied cars may not be humped or flat switched unless coupled to...
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
24 CFR 972.218 - Conversion assessment components.
2010-04-01
... development as public housing for the remainder of its useful life. The cost methodology necessary to conduct... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conversion assessment components. 972.218 Section 972.218 Housing and Urban Development Regulations Relating to Housing and Urban...
40 CFR 86.218-94 - Dynamometer calibration.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer calibration. 86.218-94 Section 86.218-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
Research on polonium-218 survey technique for uranium
International Nuclear Information System (INIS)
Zhou, R.
1985-01-01
This article makes an exposition of the principles and procedures of 218 Po survey technique for uranium. The experiments done with 218 Po method on a large scale on the deposits of granite, volcanic rock and carbon-silliceous slate types showed that the method of not only as effective as track method and 210 Po method, but also has the characteristics of its own. The device has higher working efficiency with only 5 minutes needed at each measurement point, and its sensitivity is higher, about 0.7 pulse/136.S (P ci /L). The results of measurement by 218 Po method will not be affected by thorium emanation and there will be no contamination of the scintillation chamber by radon daughter. The ratio of anomalous peak value to the bottom for 218 Po method is proved to be higher than that for track method and 210 Po method. In order to avoid the influence of moisture, the measurement by 218 Po method should be planned to do when it is not a rainy day and the holes must be dug some distance off the ditches and rice fields, thus ensuring the success in applying the method
22 CFR 218.39 - Alternate funds disbursal procedure.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Alternate funds disbursal procedure. 218.39 Section 218.39 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF... recipient, any public or non-profit private organization or agency, or State or political subdivision of the...
49 CFR 218.97 - Good faith challenge procedures.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Good faith challenge procedures. 218.97 Section... Derails § 218.97 Good faith challenge procedures. (a) Employee responsibility. An employee shall inform the railroad or employer whenever the employee makes a good faith determination that the employee has...
30 CFR 218.580 - When do I submit Form MMS-4444?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When do I submit Form MMS-4444? 218.580 Section 218.580 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... Correspondence § 218.580 When do I submit Form MMS-4444? Initially, you must submit MMS Form-4444 by November 29...
The electrical and diffusive properties of unattached 218Po in argon gas
International Nuclear Information System (INIS)
Leung, H.M.-Y.; Phillips, C.R.
1987-01-01
Electrical and diffusive properties of unattached 218 Po were investigated in argon Parameters determined in electrostatic collection experiments were radon concentration, the fraction of 218 Po having a positive charge at the end of the recoil path, the diffusion coefficient of the neutral 218 Po species, and the ratio of the neutralisation rate constant of charged 218 Po species to the electrical mobility of charged 218 Po species. Independent electrical mobility data were obtained using a pulse width modulated ion mobility analyser. The neutralisation rate constant for charged 218 Po species was then determined from the electrostatic collection data together with the independent mobility data. Relative humidity (RH) and radon concentration were found to affect the neutralisation mechanism. Following recoil of the charged 218 Po species, neutralisation through recombination with small negative ions is important for radon concentrations greater than about 1.0 x 10 5 atoms cm -3 . The neutralisation rate constant is proportional to about the 0.6 power of the radon concentration for all relative humidities. At a radon concentration less than about 1.0 x 10 5 atoms cm -3 , the neutralisation rate constant is independent of radon concentration. (author)
The electrical and diffusive properties of unattached 218Po in air systems
International Nuclear Information System (INIS)
Leung, H.M.-Y.; Phillips, C.R.
1988-01-01
The electrical and diffusive properties of unattached 218 Po were determined in air environments containing traces of other gases. Of particular interest was the neutralisation of charged, unattached 218 Po. An electrostatic collection apparatus and a pulse width modulated ion mobility analyser were used to determine the fraction of the unattached 218 Po having a positive charge at the end of the recoil path (f); the diffusion coefficient of the neutral, unattached 218 Po Dsub(Α): the mobility of the charged, unattached 218 Po (B); and the neutralisation rate constant of charged, unattached 218 Po (K). Average values found for f, Dsub(Α), B and K were similar to those determined earlier for the argon system. Two mechanisms may be responsible for neutralisation, namely, scavenging of electrons from trace gases (charge transfer), and recombination with negative small ions. Which neutralisation mechanism is dominant depends on the amount and type of trace gas or organic vapour present and the degree of gas ionisation. (author)
Measurement of airborne 218Po - A Bayesian approach
International Nuclear Information System (INIS)
Groer, P.G.; Lo, Y.
1996-01-01
The standard mathematical treatment of the buildup and decay of airborne radionuclides on a filter paper uses the solutions of the so-called bateman equations adapted to the sampling process. The equations can be interpreted as differential equations for the expectation of an underlying stochastic process, which describes the random fluctuations in the accumulation and decay of the sampled radioactive atoms. The process for the buildup and decay of airborne 218 Po can be characterized as an open-quotes immigration-death processclose quotes in the widely adopted, biologically based jargon. The probability distribution for the number of 218 Po atoms, accumulated after sampling time t, is Poisson. We show that the distribution of the number of counts, registered by a detector with efficiency ε during a counting period T after the end of sampling, it also Poisson, with mean dependent on ε,t,T, the flowrate and N o , the number of airborne 218 Po atoms per unit volume. This Poisson distribution was used to construct the likelihood given the observed number of counts. After inversion with Bayes' Theorem we obtained the posterior density for N o . This density characterizes the remaining uncertainty about the measured under of 218 Po atoms per unit volume of air. 6 refs., 3 figs., 1 tab
218-E-8 Borrow Pit Demolition Site closure plan. Revision 1
International Nuclear Information System (INIS)
Ruck, F.R.
1994-01-01
The 218-E-8 Demolition Site was the site of a single demolition event in November of 1984. This demolition event was a form of thermal treatment for discarded explosive chemical products. Because the 218-E-8 Demolition Site will no longer be used for this thermal activity, the site will be closed. Closure will be conducted pursuant to the requirements of the Washington State Department of Ecology (Ecology) ''Dangerous Waste Regulations,'' Washington Administrative Code (WAC) 173-303-610 and 40 Code of Federal Regulations (CFR) 270.1. The 218-E-8 Borrow Pit Demolition Site Closure Plan consists of a Hanford Facility Dangerous Waste Part A Permit Application, Form 3, Revision 4, and a closure plan. An explanation of the Part A Form 3, submitted with this closure plan is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. This closure plan presents a description of the 218-E-8 Demolition Site, the history of the waste treated, and the approach that will be followed to close the 218-E-8 Demolition Site. Because there were no radioactively contaminated chemicals involved in t he demolitions at the 218-E-8 Borrow Pit site, the information on radionuclides is provided for ''information only.'' Remediation of any radioactive contamination is not within the scope of this closure plan. Only dangerous constituents derived from 218-E-8 Demolition Site operations will be addressed in this closure plan in accordance with WAC 173-303-610(2)(b)(i)
218 E-8 Borrow Pit Demolition Site clean closure soil evaluation report
International Nuclear Information System (INIS)
Korematsu-Olund, D.M.
1995-01-01
This report summarizes the sampling activities undertaken and the analytical results obtained in a soil sampling and analyses study performed for the 218 E-8 Borrow Pit Demolition Site (218 E-8 Demolition Site). The 218 E-8 Demolition Site is identified as a Resource Conservation and Recovery Act (RCRA) treatment unit that will be closed in accordance with the applicable laws and regulations. The site was used for the thermal treatment of discarded explosive chemical products. No constituents of concern were found in concentrations indicating contamination of the soil by 218 E-8 Demolition Site activities
49 CFR 173.218 - Fish meal or fish scrap.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Fish meal or fish scrap. 173.218 Section 173.218... Fish meal or fish scrap. (a) Except as provided in Column (7) of the HMT in § 172.101 of this subchapter, fish meal or fish scrap, containing at least 6%, but not more than 12% water, is authorized for...
2010-10-01
... Mitigation. (a) When conducting training and utilizing the sound sources or explosives identified in § 218... Handbook (Naval Education and Training Command [NAVEDTRA] 12968-D). (iii) Lookout training shall include on... Lookout Training Handbook (NAVEDTRA 12968-D). (vi) After sunset and prior to sunrise, lookouts shall...
2010-07-01
... NUCLEAR TEST PROGRAM (1945-1962) § 218.1 Policies. (a) Upon request by the Veterans Administration in... done upon request from the individual, the individual's representative, the Veterans Administration, or... to arrive at a radiation dose. Such reconstruction is not a new concept; it is standard scientific...
36 CFR 223.218 - Consistency with plans, environmental standards, and other management requirements.
2010-07-01
..., environmental standards, and other management requirements. 223.218 Section 223.218 Parks, Forests, and Public... Special Forest Products § 223.218 Consistency with plans, environmental standards, and other management... with applicable land management plans. Each contract, permit, or other authorizing instrument shall...
5 CFR 591.218 - How does OPM compute price indexes?
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How does OPM compute price indexes? 591.218 Section 591.218 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...
47 CFR 25.218 - Off-axis EIRP envelopes for FSS earth station operations.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Off-axis EIRP envelopes for FSS earth station operations. 25.218 Section 25.218 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.218 Off-axis EIRP envelopes for FSS...
2010-10-01
... § 214.353 of this chapter for the purpose of establishing on-track safety for roadway work groups... TRANSPORTATION RAILROAD OPERATING PRACTICES Handling Equipment, Switches, and Fixed Derails § 218.93 Definitions... classification yard where rolling equipment is placed and made ready for an outgoing train movement. Employee...
49 CFR 218.75 - Methods of protection for camp cars.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Methods of protection for camp cars. 218.75... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.75 Methods of protection for camp cars. When camp cars requiring protection are on either main track...
Design criteria for the 218-group criticality safety reference library
International Nuclear Information System (INIS)
Westfall, R.M.; Ford, W.E. III; Webster, C.C.
1978-01-01
The generation of a 218-group neutron cross-section library from ENDF/B-IV data is described. Experience in selecting broad-group subsets and applying them in the analysis of critical experiments is related. Recommendations on the use of the 218-group library are made. 3 figures, 5 tables
International Nuclear Information System (INIS)
Shivakumaraswamy, G.; Umesh, T.K.
2012-01-01
The phenomenon of spontaneous emission of charged particles heavier than alpha particle and lighter than a fission fragment from radioactive nuclei without accompanied by the emission of neutrons is known as cluster radioactivity or exotic radioactivity. The process of emission of charged particles heavier than alpha particle and lighter than a fission fragment is called exotic decay or cluster decay. The phenomenon of cluster radioactivity was first predicted theoretically by Sandulescu et al in 1980. Rose and Jones made first experimental observations of 14 C emission from 223 Ra in 1984. Several cluster decay modes in trans-lead region have been experimentally observed. The half-life values for different modes of cluster decay from different isotopes of uranium have been calculated using different theoretical models such as the analytical super asymmetric model (ASAFM), Preformed cluster model (PCM) and Coulomb and Proximity potential model (CPPM) etc. Recently some semi-empirical formulae, i.e, single line of universal curve (UNIV), Universal decay law (UDL) for both alpha and cluster radioactivity have also been proposed to explain cluster decay data. The alpha decay half-life of 218-219 U isotopes has been experimentally measured in 2007. The half-life values for different cluster decay modes of 218 U isotopes have been calculated PCM model. Recently in 2011, the half-life values have also been calculated for some cluster decay modes of 222-236 U isotopes using the effective liquid drop description with the varying mass asymmetry (VMAS) shape and effective inertial coefficient. In the light of this, in the present work we have studied the cluster radioactivity of 218 U isotope. The logarithmic half-lives for few cluster decay modes from 218 U isotope have been calculated by using three different approaches, i.e, UNIV proposed by Poenaru et al in 2011, UDL proposed by Qi et al in 2009 and the CPPM model proposed by Santhosh et al in 2002. The CPPM based
Dong, Ruofan; Qiu, Haifeng; Du, Guiqiang; Wang, Yuan; Yu, Jinjin; Mao, Caiping
2014-12-01
We previously reported frequent loss of microRNA‑218 (miR‑218) in human cervical cancer, which was associated with tumor progression and poor prognosis. In this study, we investigated whether restoration of the miR‑218 level is a valid strategy for the treatment of cervical cancer. The expression of miR‑218 in cervical cancer samples and cell lines was quantified by reverse transcription TaqMan quantitative (RT‑q)PCR. Overexpression of miR‑218 was achieved by both transient and stable transfection, using a miR‑218 mimic and a miR‑218‑expressing plasmid, respectively. Alterations in cellular proliferation and cell‑cycle progression were measured by the MTT assay and flow cytometry analysis. Nude mice bearing SiHa xenografts were used to investigate the functions of miR‑218 and carboplatin on tumor growth and weight. The expression of cycle‑related proteins was detected by western blotting and immunohistochemical staining. In vitro, miR‑218 significantly inhibited cellular growth in all four cell lines tested (P=0.021 for CaSki, P=0.009 for HeLa, P=0.016 for SiHa, and P=0.029 for C33A). Overexpression of miR‑218 induced G1 phase arrest and reduced expression of cyclin D1 and CDK4. In vivo, restoration of miR‑218 notably inhibited tumor growth and decreased tumor weight. In primary cultured samples, tumors with high levels of miR‑218 were more sensitive to carboplatin (R2=0.3319, P=0.0026); consistently, miR‑218 overexpression suppressed tumor growth, induced cell‑cycle arrest, and reduced the cyclin D1 level. Based on these and previous results, we conclude that restoration of the miR‑218 level inhibits the growth of cervical cancer cells both in vitro and in vivo; furthermore, overexpression of miR‑218 sensitizes cervical cancer cells to carboplatin. Our findings suggest a novel therapy for cervical cancer based on miR‑218, especially in patients with reduced levels of miR‑218.
MicroRNA-218 inhibits cell invasion and migration of pancreatic cancer via regulating ROBO1.
He, Hang; Hao, Si-Jie; Yao, Lie; Yang, Feng; Di, Yang; Li, Ji; Jiang, Yong-Jian; Jin, Chen; Fu, De-Liang
2014-10-01
miRNA-218 is a highlighted tumor suppressor and its underlying role in tumor progression is still unknown. Here, we restored the expression of miRNA-218 in pancreatic cancer to clarify the function and potent downstream pathway of miRNA-218. The expressions of both miRNA-218 and its potent target gene ROBO1 were revealed by RT-PCR and western blotting analysis. Transfection of miRNA-218 precursor mimics and luciferase assay were performed to elucidate the regulation mechanism between miRNA-218 and ROBO1. Cells, stably expressing miRNA-218 followed by forced expression of mutant ROBO1, were established through co-transfections of both lentivirus vector and plasmid vector. The cell migration and invasion abilities were evaluated by migration assay and invasion assay respectively. An increased expression of ROBO1 was revealed in cell BxPC-3-LN compared with cell BxPC-3. Elevated expression of miRNA-218 would suppress the expression of ROBO1 via complementary binding to a specific region within 3'UTR of ROBO1 mRNA (sites 971-978) in pancreatic cancer cells. Stably restoring the expression of miRNA-218 in pancreatic cancer significantly downregulated the expression of ROBO1 and effectively inhibited cell migration and invasion. Forced expression of mutant ROBO1 could reverse the repression effects of miRNA-218 on cell migration and invasion. Consequently, miRNA-218 acted as a tumor suppressor in pancreatic cancer by inhibiting cell invasion and migration. ROBO1 was a functional target of miRNA-218's downstream pathway involving in cell invasion and migration of pancreatic cancer.
B218 Weld Filler Wire Characterization for Al-Li Alloy 2195
Bjorkman, Gerry; Russell, Carolyn
2000-01-01
NASA Marshall Space Flight Center, Lockheed Martin Space Systems- Michoud Operations, and McCook Metals have developed an aluminum-copper weld filler wire for fusion welding aluminum lithium alloy 2195. The aluminum-copper based weld filler wire has been identified as B218, a McCook Metals designation. B218 is the result of six years of weld filler wire development funded by NASA, Lockheed Martin, and McCook Metals. The filler wire chemistry was developed to produce enhanced 2195 weld and repair weld mechanical properties over the 4043 aluminum-silicon weld filler wire, which is currently used to weld 2195 on the Super Lightweight External Tank for the NASA Space Shuttle Program. An initial characterization was performed consisting of a repair weld evaluation using B218 and 4043 weld filler wires. The testing involved room temperature and cryogenic repair weld tensile testing along with fracture toughness testing. From the testing, B218 weld filler wire produce enhanced repair weld tensile strength, ductility, and fracture properties over 4043. B218 weld filler wire has proved to be a superior weld filler wire for welding aluminum lithium alloy 2195 over 4043.
12 CFR 218.741 - Exemption for banks effecting transactions in money market funds.
2010-01-01
... money market funds. 218.741 Section 218.741 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS... EXCHANGE ACT OF 1934 (REGULATION R) § 218.741 Exemption for banks effecting transactions in money market... issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or...
2010-01-01
... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...
Quantitative evaluation of 218Po behaviour in air in an artificial environment
International Nuclear Information System (INIS)
Yajima, K.; Hirao, S.; Moriizumi, J.; Yamazawa, H.
2015-01-01
Experiments were carried out in a small enclosed booth for the purpose of understanding and modelling 218 Po behaviour. The experiment was conducted under two kinds of conditions without and with injection of incense smoke. A working model of 218 Po behaviour was applied to analyse the measured data. Under the condition without incense smoke, temporal changes in aerosol-attached and unattached 218 Po concentrations were successfully reproduced by the model. The deposition rate of unattached fraction and the rate of attachment were determined by the working model. Under the condition with incense smoke, temporal changes in 218 Po concentration were poorly simulated by the model. This can be attributed to the significantly increased aerosol concentration in small size ranges which is not properly considered in the attachment rate calculation in the model. (authors)
Improving the yield of 2-[18F]fluoro-2-deoxyglucose using a microwave cavity.
Taylor, M D; Roberts, A D; Nickles, R J
1996-07-01
We have investigated the use of a microwave cavity (Labwell AB, Sweden) to improve the radiochemical yield of 2-[18F]fluoro-2-deoxyglucose (2-[18F]FDG). After characterizing the heating properties of the cavity, three steps of the Hamacher 2-[18F]FDG synthesis which require heating--azeotropic distillation of the target water, nucleophilic substitution, and hydrolysis of the product--were investigated separately. The average radiochemical yield of 2-[18F]FDG for the microwave synthesis, using the phase transfer reagent tetrabutylammonium bicarbonate, was 62 +/- 4% (72 +/- 5%, decay corrected, synthesis time = 31 min).
9 CFR 93.218 - Import permits and applications for inspection for poultry.
2010-01-01
... inspection for poultry. 93.218 Section 93.218 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY...
30 CFR 218.560 - How do I submit Form MMS-4444?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit Form MMS-4444? 218.560 Section... Correspondence § 218.560 How do I submit Form MMS-4444? A copy of Form MMS-4444 and instructions may be obtained from MMS. It will also be posted on the MMS Web site. Submit the completed, signed form to the address...
14 CFR 93.218 - Slots for transborder service to and from Canada.
2010-01-01
... Canada. 93.218 Section 93.218 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... service to and from Canada. (a) Except as otherwise provided in this subpart, international slots...'Hare in the Winter season. (c) Any modification to the slot base by the Government of Canada or the...
2010-07-01
... MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND INCENTIVES Oil, Gas and Sulfur, Offshore § 218.151 Rental... this section. Discovery means one or more wells on the lease that meet the requirements in 250, subpart... (c) of this section. For— Issued as a result of a sale held— The lessee must pay rental— (1) An oil...
30 CFR 218.42 - Cross-lease netting in calculation of late-payment interest.
2010-07-01
...-payment interest. 218.42 Section 218.42 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT COLLECTION OF MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND...; (3) The payor submits production reports, pipeline allocation reports, or other similar documentary...
Neutron spectrometer using NE218 liquid scintillator
International Nuclear Information System (INIS)
Dance, J.B.; Francois, P.E.
1976-01-01
A neutron spectrometer has been constructed using NE218 liquid scintillator. Discrimination against electron-gamma events was obtained usng a charge-comparison pulse shape discrimination system. The resolution obtained was about 0.25 MeV F.W.H.M. at 2.0 MeV
50 CFR 216.218 - Letters of Authorization.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.218 Letters of...
Fu, Wei-Ming; Zhu, Xiao; Wang, Wei-Mao; Lu, Ying-Fei; Hu, Bao-Guang; Wang, Hua; Liang, Wei-Cheng; Wang, Shan-Shan; Ko, Chun-Hay; Waye, Mary Miu-Yee; Kung, Hsiang-Fu; Li, Gang; Zhang, Jin-Fang
2015-10-01
Long non-coding RNA Hotair has been considered as a pro-oncogene in multiple cancers. Although there is emerging evidence that reveals its biological function and the association with clinical prognosis, the precise mechanism remains largely elusive. We investigated the function and mechanism of Hotair in hepatocellular carcinoma (HCC) cell models and a xenograft mouse model. The regulatory network between miR-218 and Hotair was elucidated by RNA immunoprecipitation and luciferase reporter assays. Finally, the correlation between Hotair, miR-218 and the target gene Bmi-1 were evaluated in 52 paired HCC specimens. In this study, we reported that Hotair negatively regulated miR-218 expression in HCC, which might be mediated through an EZH2-targeting-miR-218-2 promoter regulatory axis. Further investigation revealed that Hotair knockdown dramatically inhibited cell viability and induced G1-phase arrest in vitro and suppressed tumorigenicity in vivo by promoting miR-218 expression. Oncogene Bmi-1 was shown to be a functional target of miR-218, and the main downstream targets signaling, P16(Ink4a) and P14(ARF), were activated in Hotair-suppressed tumorigenesis. In primary human HCC specimens, Hotair and Bmi-1 were concordantly upregulated whereas miR-218 was downregulated in these tissues. Furthermore, Hotair was inversely associated with miR-218 expression and positively correlated with Bmi-1 expression in these clinical tissues. Hotair silence activates P16(Ink4a) and P14(ARF) signaling by enhancing miR-218 expression and suppressing Bmi-1 expression, resulting in the suppression of tumorigenesis in HCC. Copyright © 2015 European Association for the Study of the Liver. Published by Elsevier B.V. All rights reserved.
A pri-miR-218 variant and risk of cervical carcinoma in Chinese women
International Nuclear Information System (INIS)
Shi, Ting-Yan; Cheng, Xi; Wu, Xiaohua; Wei, Qingyi; Chen, Xiao-Jun; Zhu, Mei-Ling; Wang, Meng-Yun; He, Jing; Yu, Ke-Da; Shao, Zhi-Ming; Sun, Meng-Hong; Zhou, Xiao-Yan
2013-01-01
MicroRNA (miRNA)-related single nucleotide polymorphisms (SNPs) may compromise miRNA binding affinity and modify mRNA expression levels of the target genes, thus leading to cancer susceptibility. However, few studies have investigated roles of miRNA-related SNPs in the etiology of cervical carcinoma. In this case–control study of 1,584 cervical cancer cases and 1,394 cancer-free female controls, we investigated associations between two miR-218-related SNPs involved in the LAMB3-miR-218 pathway and the risk of cervical carcinoma in Eastern Chinese women. We found that the pri-miR-218 rs11134527 variant GG genotype was significantly associated with a decreased risk of cervical carcinoma compared with AA/AG genotypes (adjusted OR=0.77, 95% CI=0.63-0.95, P=0.015). However, this association was not observed for the miR-218 binding site SNP (rs2566) on LAMB3. Using the multifactor dimensionality reduction analysis, we observed some evidence of interactions of these two SNPs with other risk factors, especially age at primiparity and menopausal status, in the risk of cervical carcinoma. The pri-miR-218 rs11134527 SNP was significantly associated with the risk of cervical carcinoma in Eastern Chinese women. Larger, independent studies are warranted to validate our findings
Yang, Po-Yu; Hsieh, Pei-Ling; Wang, Tong Hong; Yu, Cheng-Chia; Lu, Ming-Yi; Liao, Yi-Wen; Lee, Tzu-Hsin; Peng, Chih-Yu
2017-01-17
Current evidence suggests that oral cancer stem cells (OCSCs) possess high tumorigenic and metastatic properties as well as chemo- and radioresistance. In this study, we demonstrated that andrographolide, the main bioactive component in the medicinal plant Andrographis, significantly reduced oncogenicity and restored radio-sensitivity of ALDH1+CD44+ OCSCs. Mechanistic studies showed that andrographolide treatment increased the expression of microRNA-218 (miR-218), leading to the downregulation of Bmi1. We showed that knockdown of miR-218 in ALDH1-CD44- non-OCSCs enhanced cancer stemness, while silencing of Bmi1 significantly counteracted it. Furthermore, we found tumor growth was reduced in mice bearing xenograft tumors after andrographolide treatment via activation of miR-218/Bmi1 axis. Together, these data demonstrated that the inhibition of tumor aggressiveness in OCSCs by andrographolide was mediated through the upregulation of miR-218, thereby reducing Bmi1 expression. These findings suggest that andrographolide may be a valuable natural compound for anti-CSCs treatment of OSCC.
Energy Technology Data Exchange (ETDEWEB)
Tu, Lin; Wang, Ming; Zhao, Wen-Yi; Zhang, Zi-Zhen; Tang, De-Feng; Zhang, Ye-Qian [Department of Gastrointestinal Surgery, Ren Ji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200127 (China); Cao, Hui, E-mail: caohui10281@163.com [Department of Gastrointestinal Surgery, Ren Ji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200127 (China); Zhang, Zhi-Gang, E-mail: zhangzhiganggz@hotmail.com [State Key Laboratory for Oncogenes and Related Genes, Shanghai Cancer Institute, Ren Ji Hospital, School of Medicine, Shanghai Jiaotong University, Shanghai 200240 (China)
2017-03-01
Gastrointestinal stromal tumors (GIST) are one of the most common forms of mesenchymal cancers of the gastrointestinal tract. Although chemotherapeutic drugs inhibited the proliferation of GIST, however, sizable proportion of people developed resistance and therefore difficult to treat. In the present study, O-carboxymethyl chitosan (OCMC)-tocopherol polymer conjugate was synthesized and formulated into stable polymeric nanoparticles. The main aim of present study was to increase the therapeutic efficacy of miR-218 in GIST. The mean size of nanoparticles was ~ 110 nm with a spherical shape. The miR-218 NP has been shown inhibit the cell proliferation and exhibited a superior cell apoptosis. The miR-218 NP inhibited the cell invasion and promoted the apoptosis of GIST cancer cells. In the present study, we have successfully showed that KIT1 is the target gene of miR-218 as shown by the luciferase reporter assay. These findings collectively suggest the miR-218 loaded nanoparticle by virtue of effective transfection could act as a tumor suppressor miRNA in the treatment of GIST. - Highlights: • O-carboxymethyl chitosan (OCMC)-tocopherol polymer conjugate was synthesized and formulated in nanoparticles. • The miR-218 NP has been shown inhibit the cell proliferation and exhibited a superior cell apoptosis. • We have successfully showed that KIT1 is the target gene of miR-218 as shown by the luciferase reporter assay.
18 CFR 157.218 - Changes in customer name.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Changes in customer... Act for Certain Transactions and Abandonment § 157.218 Changes in customer name. (a) Automatic... reflect the change in the name of an existing customer, if the certificate holder has filed any necessary...
20 CFR 725.218 - Conditions of entitlement; child.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Conditions of entitlement; child. 725.218... Conditions of entitlement; child. (a) An individual is entitled to benefits where he or she meets the... the child of a deceased miner who: (1) Was receiving benefits under section 415 or part C of title IV...
Lack of association between miR-218 rs11134527 A>G and Kawasaki disease susceptibility.
Pi, Lei; Fu, Lanyan; Xu, Yufen; Che, Di; Deng, Qiulian; Huang, Xijing; Li, Meiai; Zhang, Li; Huang, Ping; Gu, Xiaoqiong
2018-05-01
Abstract Kawasaki disease (KD) is a type of disease that includes the development of a fever that lasts at least five days and involves the clinical manifestation of multicellular vasculitis. KD has become one of the most common pediatric cardiovascular diseases. Previous studies have reported that miR-218 rs11134527 A>G is associated with susceptibility to various cancer risks. However, there is a lack of evidence regarding the relationship between this polymorphism and KD risk. This study explored the correlation between the miR-218 rs11134527 A>G polymorphism and the risk of KD. We recruited 532 patients with KD and 623 controls to genotype the miR-218 rs11134527 A>G polymorphism with a TaqMan allelic discrimination assay. Our results illustrated that the miR-218 rs11134527 A>G polymorphism was not associated with KD risk. In an analysis stratified by age, sex, and coronary artery lesions, we found only that the risk of KD was significantly decreased for children older than 5 years (GG vs. AA/AG: adjusted OR=0.26, 95% CI=0.07-0.94, P =0.041). This study demonstrated that the miR-218 rs1113452 A>G polymorphism may have an age-related relationship with KD susceptibility that has not previously been revealed. ©2018 The Author(s).
48 CFR 218.270 - Head of contracting activity determinations.
2010-10-01
... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 218.270 Head of contracting activity determinations. For contract... contracting activity,” as defined in FAR 2.101, in the following locations: (a) FAR 2.101: (1) Definition of...
Ferguson, Daniel C; Cheng, Qiuying; Blanco, Javier G
2015-07-01
The anthracyclines doxorubicin and daunorubicin are used in the treatment of various human and canine cancers, but anthracycline-related cardiotoxicity limits their clinical utility. The formation of anthracycline C-13 alcohol metabolites (e.g., doxorubicinol and daunorubicinol) contributes to the development of anthracycline-related cardiotoxicity. The enzymes responsible for the synthesis of anthracycline C-13 alcohol metabolites in canines remain to be elucidated. We hypothesized that canine carbonyl reductase 1 (cbr1), the homolog of the prominent anthracycline reductase human CBR1, would have anthracycline reductase activity. Recombinant canine cbr1 (molecular weight: 32.8 kDa) was purified from Escherichia coli. The enzyme kinetics of "wild-type" canine cbr1 (cbr1 D218) and a variant isoform (cbr1 V218) were characterized with the substrates daunorubicin and menadione, as well as the flavonoid inhibitor rutin. Canine cbr1 catalyzes the reduction of daunorubicin to daunorubicinol, with cbr1 D218 and cbr1 V218 displaying different kinetic parameters (cbr1 D218 Km: 188 ± 144 μM versus cbr1 V218 Km: 527 ± 136 μM, P < 0.05, and cbr1 D218 Vmax: 6446 ± 3615 nmol/min per milligram versus cbr1 V218 Vmax: 15539 ± 2623 nmol/min per milligram, P < 0.01). Canine cbr1 also metabolized menadione (cbr1 D218 Km: 104 ± 50 μM, Vmax: 2034 ± 307 nmol/min per milligram). Rutin acted as a competitive inhibitor for the reduction of daunorubicin (cbr1 D218 Ki: 1.84 ± 1.02 μM, cbr1 V218 Ki: 1.38 ± 0.47 μM). These studies show that canine cbr1 metabolizes daunorubicin and provide the necessary foundation to characterize the role of cbr1 in the variable pharmacodynamics of anthracyclines in canine cancer patients. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.
2010-04-01
... and verify Social Security and Employer Identification Numbers. 5.218 Section 5.218 Housing and Urban... REQUIREMENTS; WAIVERS Disclosure and Verification of Social Security Numbers and Employer Identification Numbers; Procedures for Obtaining Income Information Disclosure and Verification of Social Security...
Ruan, Qiang; Fang, Zhi-Yuan; Cui, Shu-Zhong; Zhang, Xiang-Liang; Wu, Yin-Bing; Tang, Hong-Sheng; Tu, Yi-Nuo; Ding, Yan
2015-08-01
Thermo-chemotherapy has been proven to reduce the invasion capability of cancer cells. However, the molecular mechanism underlying this anti-invasion effect is still unclear. In this study, the role of thermo-chemotherapy in the inhibition of tumor invasion was studied. The results demonstrated that expression of miR-218 was downregulated in gastric cancer tissues, which had a positive correlation with tumor invasion and metastasis. In vitro thermo-chemotherapy increased miR-218 expression in SGC7901 cells and inhibited both proliferation and invasion of cancer cells. Gli2 was identified as a downstream target of miR-218, and its expression was negatively regulated by miR-218. The thermo-chemotherapy induced miR-218 upregulation was also accompanied by increasing of E-cadherin expression. In conclusion, the present study indicates that thermo-chemotherapy can effectively decrease the invasion capability of cancer cells and increase cell-cell adhesion. miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process.
Directory of Open Access Journals (Sweden)
Bastaki SM
2018-01-01
Full Text Available Salim M Bastaki,1 Yousef M Abdulrazzaq,2 Mohamed Shafiullah,1 Małgorzata Więcek,3 Katarzyna Kieć-Kononowicz,3 Bassem Sadek1 1Department of Pharmacology and Therapeutics, College of Medicine and Health Science, United Arab Emirates University, Al Ain, 2Department of Medical Education, Dubai Health Authority, Dubai, UAE; 3Department of Technology and Biotechnology of Drugs, Faculty of Pharmacy, Jagiellonian University Medical College, Medyczna, Kraków, Poland Abstract: The imidazole-based H3R antagonist 2-18 with high in vitro H3R antagonist affinity, excellent in vitro selectivity profile, and high in vivo H3R antagonist potency was tested for its anticonvulsant effect in maximal electroshock (MES-induced convulsions in mice having valproic acid (VPA as a reference antiepileptic drug (AED. Additionally, H3R antagonist 2-18 was evaluated for its reproductive toxicity in the same animal species. The results show that acute systemic administration (intraperitoneal; i.p. of H3R antagonist 2-18 (7.5, 15, 30, and 60 mg/kg, i.p. significantly and dose dependently protected male as well as female mice against MES-induced convulsion. The protective action observed for H3R antagonist 2-18 in both mice sexes was comparable to that of VPA and was reversed when mice were pretreated with the selective H3R agonist (R-alpha-methylhistamine (RAMH, 10 mg/kg, i.p.. Moreover, the results show that acute systemic administration of single (7.5, 15, 30, or 60 mg/kg, i.p. or multiple doses (15×3 mg/kg, i.p. of H3R antagonist 2-18 on gestation day (GD 8 or 13 did not affect the maternal body weight of mice when compared with the control group. Furthermore, no significant differences were observed in the average number of implantations and resorptions between the control and H3R antagonist 2-18-treated group at the early stages of gestation and the organogenesis period. However, oral treatment with H3R antagonist 2-18 (15 mg/kg on GD 8 induced a reduced number of
27 CFR 28.218 - Disposition of Forms 1582-A (5120.24).
2010-04-01
... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.218 Disposition of Forms 1582-A (5120.24). On removal of the wines from the...
2010-10-01
... format as attachments to electronic mail. 67.218 Section 67.218 Shipping COAST GUARD, DEPARTMENT OF... format as attachments to electronic mail. (a) Any instrument identified as eligible for filing and recording under § 67.200 may be submitted in portable document format (.pdf) as an attachment to electronic...
Yang, Yan; Ding, Lili; Hu, Qun; Xia, Jia; Sun, Junjie; Wang, Xudong; Xiong, Hua; Gurbani, Deepak; Li, Lianbo; Liu, Yan; Liu, Aiguo
2017-08-22
Aberrant expression of microRNAs in different human cancer types has been widely reported. MiR-218 acts as a tumor suppressor in diverse human cancer types impacting regulation of multiple genes in oncogenic pathways. Here, we evaluated the expression and function of miR-218 in human lung cancer and ALDH positive lung cancer cells to understand the potential mechanisms responsible for disease pathology. Also, the association between its host genes and the target genes could be useful towards the better understanding of prognosis in clinical settings. Publicly-available data from The Cancer Genome Atlas (TCGA) was mined to compare the levels of miR-218 and its host gene SLIT2/3 between lung cancer tissues and normal lung tissues. Transfection of miR-218 to investigate its function in lung cancer cells was done and in vivo effects were determined using miR-218 expressing lentiviruses. Aldefluor assay and Flow cytometry was used to quantify and enrich ALDH positive lung cancer cells. Levels of miR-218, IL-6R, JAK3 and phosphorylated STAT3 were compared in ALDH1A1 positive and ALDH1A1 negative cells. Overexpression of miR-218 in ALDH positive cells was carried to test the survival by tumorsphere culture. Finally, utilizing TCGA data we studied the association of target genes of miR-218 with the prognosis of lung cancer. We observed that the expression of miR-218 was significantly down-regulated in lung cancer tissues compared to normal lung tissues. Overexpression of miR-218 decreased cell proliferation, invasion, colony formation, and tumor sphere formation in vitro and repressed tumor growth in vivo. We further found that miR-218 negatively regulated IL-6 receptor and JAK3 gene expression by directly targeting the 3'-UTR of their mRNAs. In addition, the levels of both miR-218 host genes and the components of IL-6/STAT3 pathway correlated with prognosis of lung cancer patients. MiR-218 acts as a tumor suppressor in lung cancer via IL-6/STAT3 signaling pathway
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
KDG218, a nearby ultra-diffuse galaxy
Karachentsev, I. D.; Makarova, L. N.; Sharina, M. E.; Karachentseva, V. E.
2017-10-01
We present properties of the low-surface-brightness galaxy KDG218 observed with the HST/ACS. The galaxy has a half-light (effective) diameter of a e = 47″ and a central surface brightness of SB V (0) = 24.m4/□″. The galaxy remains unresolved with the HST/ACS, which implies its distance of D > 13.1 Mpc and linear effective diameter of A e > 3.0 kpc. We notice that KDG218 is most likely associated with a galaxy group around the massive lenticular NGC4958 galaxy at approximately 22 Mpc, or with the Virgo Southern Extension filament at approximately 16.5 Mpc. At these distances, the galaxy is classified as an ultra-diffuse galaxy (UDG) similar to those found in the Virgo, Fornax, and Coma clusters. We also present a sample of 15 UDG candidates in the Local Volume. These sample galaxies have the following mean parameters: 〈 D〉 = 5.1 Mpc, 〈 A e 〉 = 4.8 kpc, and 〈 SB B ( e)〉 = 27.m4/□″. All the local UDG candidates reside near massive galaxies located in the regions with the mean stellar mass density (within 1 Mpc) about 50 times greater than the average cosmic density. The local fraction of UDGs does not exceed 1.5% of the Local Volume population. We notice that the presented sample of local UDGs is a heterogeneous one containing irregular, transition, and tidal types, as well as objects consisting of an old stellar population.
Characterizing the Resolved M6 Dwarf Twin LP 318-218AB
Moreno Hilario, Elizabeth; Burgasser, Adam J.; Bardalez Gagliuffi, Daniella; Tamiya, Tomoki
2017-01-01
The lowest-mass stars and brown dwarfs are among the most common objects in the Milky Way Galaxy, but theories of their formation and evolution remain poorly constrained. Binary systems are important for understanding the formation of these objects and for making direct orbit and mass measurements to validate evolutionary theories. We report the discovery of LP 318-218, a high proper motion late M dwarf, as a near equal-brightness binary system with a separation of 0.72 arcseconds. Resolved near-infrared spectroscopy confirms the components as nearly identical M6 twins. We using our resolved photometry and spectroscopy to estimate the distance, projected separation and tangential velocity of the system, and confirm common proper motion. We also perform atmosphere model fits to the resolved spectra to assess their physical properties. We place LP 318-218 in context with other widely-separated late M dwarf binaries.
Li, Ying-jie; Yu, Chang-hai; Li, Jing-bo; Wu, Xi-ya
2013-12-01
Andrographolide is a major bioactive labdane diterpenoid isolated from Andrographis paniculata and has protective effects against cigarette smoke (CS)-induced lung injury. This study was done to determine whether such protective effects were mediated through modulation of microRNA (miR)-218 expression. Therefore, we exposed human alveolar epithelial A549 cells to cigarette smoke extract (CSE) with or without andrographolide pretreatment and measured the level of glutathione, nuclear factor-kappaB (NF-κB) activation, proinflammatory cytokine production, and miR-218 expression. We found that andrographolide pretreatment significantly restored the glutathione level in CSE-exposed A549 cells, coupled with reduced inhibitor κB (IκB)-α phosphorylation and p65 nuclear translocation and interleukin (IL)-8 and IL-6 secretion. The miR-218 expression was significantly upregulated by andrographolide pretreatment. To determine the biological role of miR-218, we overexpressed and downregulated its expression using miR-218 mimic and anti-miR-218 inhibitor, respectively. We observed that miR-218 overexpression led to a marked reduction in IκB-α phosphorylation, p65 nuclear accumulation, and NF-κB-dependent transcriptional activity in CSE-treated A549 cells. In contrast, miR-218 silencing enhanced IκB-α phosphorylation and p65 nuclear accumulation in cells with andrographolide pretreatment and reversed andrographolide-mediated reduction of IL-6 and IL-8 production. In addition, depletion of miR-218 significantly reversed the upregulation of glutathione levels in A549 cells by andrographolide. Taken together, our results demonstrate that andrographolide mitigates CSE-induced inflammatory response in A549 cells, largely through inhibition of NF-κB activation via upregulation of miR-218, and thus has preventive benefits in CS-induced inflammatory lung diseases.
12 CFR 218.700 - Defined terms relating to the networking exception from the definition of “broker.”
2010-01-01
... the average of the minimum and maximum hourly wage established by the bank for the current or prior... exception from the definition of âbroker.â 218.700 Section 218.700 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER IN...
30 CFR 218.101 - Royalty and rental remittance (naval petroleum reserves).
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty and rental remittance (naval petroleum... INCENTIVES Oil and Gas, Onshore § 218.101 Royalty and rental remittance (naval petroleum reserves). Remittance covering payments of royalty or rental on naval petroleum reserves must be accomplished by...
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
Kinetics of neutralization of Po-218
International Nuclear Information System (INIS)
Chu, K.D.
1987-01-01
In a well-defined experimental system the neutralization of polonium-218 ions was investigated as a function of the physical and chemical properties of the controlled composition atmosphere. The mobilities of Po + and PoO 2 + are determined by combining experimental results with a computer model of the system. Three neutralization mechanisms were individually studied. The small ion recombination rate has been found to be proportional to the square root of radon concentration. The electron scavenging mechanism is responsible for the neutralization of Po + in NO 2 or H 2 O in nitrogen. When PoO 2 + is formed, the electron transfer mechanism dominates the neutralization process. The electron is transferred to PoO 2 + from molecules with lower ionization potentials. The ionization potential of PoO 2 + is also determined to be 10.44 +/- 0.05 eV
22 CFR Appendix B to Part 218 - List of Types of Federal Financial Assistance
2010-04-01
... by the United States International Communication Agency Subject to Age Discrimination Regulations... BASIS OF AGE IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Pt. 218, App. B Appendix B...
Study at high angular momentum of the reflection asymmetry in the 218 Ra transition nuclei
International Nuclear Information System (INIS)
Aiche, M.
1990-07-01
The investigations concerning the 218 Ra nuclei at high angular momentum are discussed. The aim of the study is to enlarge the knowledge on the octupolar phenomena and to analyse its evolution as a funcion of the angular momentum. The 218 Ra nuclei is obtained from the ( 14 C, 4n) reaction. The gamma angular distribution and the gamma-gamma coincidence were measured by means of the Chateau de Cristal multicounter. The reflection asymmetric mean field theory and the bosons interaction model were applied to analyze the data and obtain the structure at high angular moments. The results show the existence of dipole-octupole correlations in the nuclei [fr
12 CFR 218.781 - Exemption from the definition of “broker” for banks for a limited period of time.
2010-01-01
...” for banks for a limited period of time. A bank is exempt from the definition of the term “broker... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exemption from the definition of âbrokerâ for banks for a limited period of time. 218.781 Section 218.781 Banks and Banking FEDERAL RESERVE SYSTEM...
International Nuclear Information System (INIS)
Eatough, J.P.; Worley, A.; Moss, G.R.
1999-01-01
Personal dosemeters have been utilized to monitor the deposition of the radon decay products 218 Po and 214 Po onto individuals under normal environmental exposure conditions. Each detector consists of TASTRAK alpha-sensitive plastic incorporated into an ordinary working wristwatch. Subsequent analysis provides energy discrimination of the detected alpha-particle decays, and allows events from the individual radon decay products 218 Po and 214 Po, attached to the detector surface, to be uniquely identified. Assuming similar deposition onto skin and detector surfaces, the activity per unit area of deposited radionuclides can be determined for exposed skin. Forty-one personal dosemeters were issued to volunteers selected through the hospital medical physics departments at Reading, Northampton, Exeter and Plymouth. Each volunteer was also issued with a personal radon dosemeter to determine their individual radon exposure. The volunteers wore the two dosemeters simultaneously and continuously for a period of around one month. Correlations were observed between the radon exposure of the individual and the activity per unit area of 218 Po and 214 Po on the detector surface. From these correlations it can be estimated that at the UK average radon exposure of 20 Bq m -3 , the number of decays/cm 2 /year on continuously exposed skin surface is between 3500 and 28 000 for 218 Po, and between 7000 and 21 000 for 214 Po. These results can be combined with theoretical modelling of the dose distribution in the skin to yield the alpha-particle radiation dose to any identified target cells. (author)
MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2
Energy Technology Data Exchange (ETDEWEB)
Simion, Alexandru; Laudadio, Ilaria; Prevot, Pierre-Paul; Raynaud, Peggy; Lemaigre, Frederic P. [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium); Jacquemin, Patrick, E-mail: patrick.jacquemin@uclouvain.be [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium)
2010-01-01
MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.
MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2
International Nuclear Information System (INIS)
Simion, Alexandru; Laudadio, Ilaria; Prevot, Pierre-Paul; Raynaud, Peggy; Lemaigre, Frederic P.; Jacquemin, Patrick
2010-01-01
MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.
Monteleone, Palmiero; Tortorella, Alfonso; Martiadis, Vassilis; Serino, Ismene; Di Filippo, Carmela; Maj, Mario
2007-06-21
Genes involved in serotonin transmission are likely involved in the biological predisposition to bulimia nervosa. We investigated whether the A218C polymorphism of the tryptophan-hydroxylase-1 gene was associated to bulimia nervosa and/or to some phenotypic aspects of the disorder. One hundred eighty Caucasian women (91 patients with bulimia nervosa and 89 healthy controls) were enrolled into the study. They underwent a blood sample collection for A218C polymorphism of the tryptophan-hydroxylase-1 genotyping and a clinical evaluation assessing comorbidity for Axis I and II psychiatric disorders, harm avoidance personality dimension and bulimic symptoms. The distribution of both tryptophan-hydroxylase-1 A218C genotypes and alleles did not significantly differ between patients and controls. Bulimic women with the AA genotype exhibited a more severe binge eating behavior and higher harm avoidance scores than those with CC genotype. These findings support the idea that tryptophan-hydroxylase-1 A218C polymorphism does not play a part in the genetic susceptibility to bulimia nervosa, but it seems to be involved in predisposing bulimic patients to a more disturbed eating behavior and higher harm avoidance.
Fu, Wei-Ming; Tang, Li-Peng; Zhu, Xiao; Lu, Ying-Fei; Zhang, Yan-Ling; Lee, Wayne Yuk-Wai; Wang, Hua; Yu, Yang; Liang, Wei-Cheng; Ko, Chun-Hay; Xu, Hong-Xi; Kung, Hsiang-Fu; Zhang, Jin-Fang
2015-01-01
Traditional Chinese medicine is recently emerged as anti-cancer therapy or adjuvant with reduced side-effects and improved quality of life. In the present study, an active ingredient, 1,6,7-trihydroxyxanthone (THA), derived from Goodyera oblongifolia was found to strongly suppress cell growth and induce apoptosis in liver cancer cells. MicroRNAs are a group of small non-coding RNAs that regulate gene expression at post-transcriptional levels. Our results demonstrated that miR-218 was up-regulated and oncogene Bmi-1 was down-regulated by THA treatment. Further investigation showed that THA-induced-miR-218 up-regulation could lead to activation of tumor suppressor P16(Ink4a) and P14(ARF), the main down-stream targets of Bmi-1. In conclusion, THA might be a potential anti-cancer drug candidate, at least in part, through the activation of miR-218 and suppression of Bmi-1 expression.
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
Mourier, Pierre A J; Guichard, Olivier Y; Herman, Fréderic; Viskov, Christian
2012-01-01
The ¹H nuclear magnetic resonance (NMR) acceptance criteria in the new heparin US Pharmacopeia (USP) monograph do not take into account potential structural modifications responsible for any extra signals observed in ¹H NMR spectra, some purified heparins may be non-compliant under the proposed new USP guidelines and incorrectly classified as unsuitable for pharmaceutical use. Heparins from the "ES" source, containing an extra signal at 2.18 ppm, were depolymerized under controlled conditions using heparinases I, II, and III. The oligosaccharides responsible for the 2.18 ppm signal were enriched using orthogonal chromatographic techniques. After multiple purification steps, we obtained an oligosaccharide mixture containing a highly enriched octasaccharide bearing the structural modification responsible for the extra signal. Following heparinase I depolymerization, a pure tetrasaccharide containing the fingerprint structural modification was isolated for full structural determination. Using 1D and 2D ¹H NMR spectroscopy, the structural moiety responsible for the extra signal at 2.18 ppm was identified as an acetyl group on the heparin backbone, most likely resulting from a very minor manufacturing process side reaction that esterifies the uronic acid at position 3. Such analytical peculiarity has always been present in this heparin source and it was used safety over the years. Copyright © 2012 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
Cloutier, R.; Astudillo-Defru, N.; Doyon, R.; Bonfils, X.; Almenara, J.-M.; Benneke, B.; Bouchy, F.; Delfosse, X.; Ehrenreich, D.; Forveille, T.; Lovis, C.; Mayor, M.; Menou, K.; Murgas, F.; Pepe, F.; Rowe, J.; Santos, N. C.; Udry, S.; Wünsche, A.
2017-12-01
Aims: The bright M2.5 dwarf K2-18 (Ms = 0.36 M⊙, Rs = 0.41 R⊙) at 34 pc is known to host a transiting super-Earth-sized planet orbiting within the star's habitable zone; K2-18b. Given the superlative nature of this system for studying an exoplanetary atmosphere receiving similar levels of insolation as the Earth, we aim to characterize the planet's mass which is required to interpret atmospheric properties and infer the planet's bulk composition. Methods: We have obtained precision radial velocity measurements with the HARPS spectrograph. We then coupled those measurements with the K2 photometry to jointly model the observed radial velocity variation with planetary signals and a correlated stellar activity model based on Gaussian process regression. Results: We measured the mass of K2-18b to be 8.0 ± 1.9M⊕ with a bulk density of 3.3 ± 1.2 g/cm3 which may correspond to a predominantly rocky planet with a significant gaseous envelope or an ocean planet with a water mass fraction ≳50%. We also find strong evidence for a second, warm super-Earth K2-18c (mp,csinic = 7.5 ± 1.3 M⊕) at approximately nine days with a semi-major axis 2.4 times smaller than the transiting K2-18b. After re-analyzing the available light curves of K2-18 we conclude that K2-18c is not detected in transit and therefore likely has an orbit that is non-coplanar with the orbit of K2-18b although only a small mutual inclination is required for K2-18c to miss a transiting configuration; | Δi| 1-2°. A suite of dynamical integrations are performed to numerically confirm the system's dynamical stability. By varying the simulated orbital eccentricities of the two planets, dynamical stability constraints are used as an additional prior on each planet's eccentricity posterior from which we constrain eb multi-planet systems around M dwarfs. The characterization of the density of K2-18b reveals that the planet likely has a thick gaseous envelope which, along with its proximity to the solar
Zhao, Junhong; Zheng, Mingbo; Run, Zhen; Xia, Jing; Sun, Mengjun; Pang, Huan
2015-07-01
1D Co2.18Ni0.82Si2O5(OH)4 architectures assembled by ultrathin nanoflakes are synthesized for the first time by a hydrothermal method. We present a self-reacting template method to synthesize 1D Co2.18Ni0.82Si2O5(OH)4 architectures using Ni(SO4)0.3(OH)1.4 nanobelts. A high-performance flexible asymmetric solid-state supercapacitor can be successfully fabricated based on the 1D Co2.18Ni0.82Si2O5(OH)4 architectures and graphene nanosheets. Interestingly, the as-assembled 1D Co2.18Ni0.82Si2O5(OH)4 architectures//Graphene nanosheets asymmetric solid-state supercapacitor can achieve a maximum energy density of 0.496 mWh cm-3, which is higher than most of reported solid state supercapacitors. Additionally, the device shows high cycle stability for 10,000 cycles. These features make the 1D Co2.18Ni0.82Si2O5(OH)4 architectures as one of the most promising candidates for high-performance energy storage devices.
Electronic Structures of Reduced and Superreduced Ir2(1,8-diisocyanomenthane)4 n+ Complexes
Czech Academy of Sciences Publication Activity Database
Záliš, Stanislav; Hunter, B. M.; Gray, H. B.; Vlček, Antonín
2017-01-01
Roč. 56, č. 5 (2017), s. 2874-2883 ISSN 0020-1669 R&D Projects: GA MŠk LD14129 Grant - others:COST(XE) CM1405; COST(XE) CM1202 Institutional support: RVO:61388955 Keywords : electronic structure * electrochemistry * Ir2(1,8-diisocyanomenthane)4 n+ Complexes Subject RIV: CG - Electrochemistry OBOR OECD: Physical chemistry Impact factor: 4.857, year: 2016
International Nuclear Information System (INIS)
Hopke, P.K.
1987-01-01
The chemical and physical properties of 218 Po immediately following its formation from 222 Rn decay are important in determining its behavior in indoor atmospheres and plays a major part in determining its potential health effects. In 88% of the decays, a singly charged, positive ion of 218 Po is obtained at the end of its recoil path. The modes of neutralization, small ion recombination, electron transfer, and electron scavenging are reviewed. In typical indoor air, the ion will be rapidly neutralized by transfer of electrons from lower ionization potential gases such as NO 2 . The neutral molecule can then become incorporated in ultrafine particles formed by the radiolytic processes in the recoil path. The evidence for these particles is presented
Qin, Yiwen; Peng, Yuanzhen; Zhao, Wei; Pan, Jianping; Ksiezak-Reding, Hanna; Cardozo, Christopher; Wu, Yingjie; Divieti Pajevic, Paola; Bonewald, Lynda F; Bauman, William A; Qin, Weiping
2017-06-30
Muscle and bone are closely associated in both anatomy and function, but the mechanisms that coordinate their synergistic action remain poorly defined. Myostatin, a myokine secreted by muscles, has been shown to inhibit muscle growth, and the disruption of the myostatin gene has been reported to cause muscle hypertrophy and increase bone mass. Extracellular vesicle-exosomes that carry microRNA (miRNA), mRNA, and proteins are known to perform an important role in cell-cell communication. We hypothesized that myostatin may play a crucial role in muscle-bone interactions and may promote direct effects on osteocytes and on osteocyte-derived exosomal miRNAs, thereby indirectly influencing the function of other bone cells. We report herein that myostatin promotes expression of several bone regulators such as sclerostin (SOST), DKK1, and RANKL in cultured osteocytic (Ocy454) cells, concomitant with the suppression of miR-218 in both parent Ocy454 cells and derived exosomes. Exosomes produced by Ocy454 cells that had been pretreated with myostatin could be taken up by osteoblastic MC3T3 cells, resulting in a marked reduction of Runx2, a key regulator of osteoblastic differentiation, and in decreased osteoblastic differentiation via the down-regulation of the Wnt signaling pathway. Importantly, the inhibitory effect of myostatin-modified osteocytic exosomes on osteoblast differentiation is completely reversed by expression of exogenous miR-218, through a mechanism involving miR-218-mediated inhibition of SOST. Together, our findings indicate that myostatin directly influences osteocyte function and thereby inhibits osteoblastic differentiation, at least in part, through the suppression of osteocyte-derived exosomal miR-218, suggesting a novel mechanism in muscle-bone communication. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
A mobility spectrometer for measurement of initial properties of 218Po
International Nuclear Information System (INIS)
Strydom, R.; Leuschner, A.H.; Stoker, P.H.
1990-01-01
This paper describes the development of a mobility spectrometer with adequate resolution to study the clustering processes (in ion-induced nucleation) that may occur. The first results of measurements of pure water clustering around 218 Po ions using the spectrometer are presented. It is found that the radius of the ion increases with relative humidity. The results are compared with predictions of two representations of the clustering theory. The theory qualitatively explains the results obtained, but there are considerable differences between the experimental measurements and the theoretical predictions, as well as between the two representations of the theory. (author)
Production and identification of an isomeric state in 217Pa and the new isotope 218Pa
International Nuclear Information System (INIS)
Schmidt, K.H.; Faust, W.; Muenzenberg, G.; Ewald, H.; Guettner, K.; Clerc, H.G.; Lang, W.; Wohlfarth, H.; Pielenz, K.
1977-02-01
Evaporation residues produced in the reaction 40Ar(176 MeV) + 181Ta were separated from the primary beam by the velocity filter SHIP and detected by a ΔE-E counter telescope. The technique of delayed coincidences was applied to individually identify the reaction products implanted into a Si-surface barrier detector by their subsequent alpha decays. The previously unknown nucleus 218Pa was identified by its known daughter decays. 218Pa was found to decay with Esub(α) = (9.614 +- 0.015) MeV, T(1/2) = (140 +- 50) μs and probably also with Esub(α) = (9.535 +- 0.020) MeV, T(1/2) = (150 + 100 - 50) μs. The half-life of the 8.33 MeV alpha decay of 217Pa was determined to be (o.2 +- 0.4) ms. Anew isomer in 217 Pa was found which decays with Esub(α) = (10.16 +- 0.02) MeV and T(1/2) = (1.8 +- 0.5) ms. (orig./BJ) [de
Directory of Open Access Journals (Sweden)
Dania eVecchia
2015-02-01
Full Text Available Familial hemiplegic migraine type 1 (FHM1 is caused by gain-of-function mutations in CaV2.1 (P/Q-type Ca2+ channels. Knockin (KI mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD in R192Q KI mice. It, however, remains unknown how other FHM1 mutations affect cortical synaptic transmission. Here, we studied neurotransmission in cortical neurons in microculture from KI mice carrying the S218L mutation, which causes a severe FHM syndrome in humans and an allele-dosage dependent facilitation of experimental CSD in KI mice, which is larger than that caused by the R192Q mutation. We show gain-of-function of excitatory neurotransmission, due to increased action-potential evoked Ca2+ influx and increased probability of glutamate release at pyramidal cell synapses, but unaltered inhibitory neurotransmission at multipolar interneuron synapses in S218L KI mice. In contrast with the larger gain-of-function of neuronal CaV2.1 current in homozygous than heterozygous S218L KI mice, the gain-of-function of evoked glutamate release, the paired-pulse ratio and the Ca2+ dependence of the EPSC were all similar in homozygous and heterozygous S218L KI mice, suggesting compensatory changes in the homozygous mice. Furthermore, we reveal a unique feature of S218L KI cortical synapses which is the presence of a fraction of mutant CaV2.1 channels being open at resting potential. Our data suggest that, while the gain-of-function of evoked glutamate release may explain the facilitation of CSD in heterozygous S218L KI mice, the further facilitation of CSD in homozygous S218L KI mice is due to other CaV2.1-dependent mechanisms, that likely include Ca2+ influx at voltages sub-threshold for action
Qu, Bo; Xia, Xun; Yan, Ming; Gong, Kai; Deng, Shaolin; Huang, Gang; Ma, Zehui; Pan, Xianming
2015-10-15
The increased osteoclastic activity accounts for pathological bone loss in diseases including osteoporosis. MicroRNAs are widely accepted to be involved in the regulation of osteopenic diseases. Recently, the low expression of miR-218 was demonstrated in CD14(+) peripheral blood mononuclear cells (PBMCs) from patients with postmenopausal osteoporosis. However, its role and the underlying mechanism in osteoporosis are still undefined. Here, an obvious decrease in miR-218 expression was observed during osteoclastogenesis under receptor activator of nuclear factor κB ligand (RANKL) stimulation, in both osteoclast precursors of bone marrow macrophages (BMMs) and RAW 264.7. Further analysis confirmed that overexpression of miR-218 obviously attenuated the formation of multinuclear mature osteoclasts, concomitant with the decrease in Trap and Cathepsin K levels, both the master regulators of osteoclastogenesis. Moreover, miR-218 up-regulation dramatically inhibited osteoclast precursor migration, actin ring formation and bone resorption. Mechanism assay demonstrated that miR-218 overexpression attenuated the expression of p38MAPK, c-Fos and NFATc1 signaling molecules. Following preconditioning with P79350, an agonist of p38MAPK, the inhibitor effect of miR-218 on osteoclastogenesis and bone-resorbing activity was strikingly ameliorated. Together, this study revealed a crucial role of miR-218 as a negative regulator for osteoclastogenesis and bone resorption by suppressing the p38MAPK-c-Fos-NFATc1 pathway. Accordingly, this research will provide a promising therapeutic agent against osteopenic diseases including osteoporosis. Copyright © 2015 Elsevier Inc. All rights reserved.
Vecchia, Dania; Tottene, Angelita; van den Maagdenberg, Arn M.J.M.; Pietrobon, Daniela
2015-01-01
Familial hemiplegic migraine type 1 (FHM1) is caused by gain-of-function mutations in CaV2.1 (P/Q-type) Ca2+ channels. Knockin (KI) mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD) in R192Q KI mice. It, however, remains unknown how other FHM1 mutations affect cortical synaptic transmission. Here, we studied neurotransmission in cortical neurons in microculture from KI mice carrying the S218L mutation, which causes a severe FHM syndrome in humans and an allele-dosage dependent facilitation of experimental CSD in KI mice, which is larger than that caused by the R192Q mutation. We show gain-of-function of excitatory neurotransmission, due to increased action-potential evoked Ca2+ influx and increased probability of glutamate release at pyramidal cell synapses, but unaltered inhibitory neurotransmission at multipolar interneuron synapses in S218L KI mice. In contrast with the larger gain-of-function of neuronal CaV2.1 current in homozygous than heterozygous S218L KI mice, the gain-of-function of evoked glutamate release, the paired-pulse ratio and the Ca2+ dependence of the excitatory postsynaptic current were similar in homozygous and heterozygous S218L KI mice, suggesting compensatory changes in the homozygous mice. Furthermore, we reveal a unique feature of S218L KI cortical synapses which is the presence of a fraction of mutant CaV2.1 channels being open at resting potential. Our data suggest that, while the gain-of-function of evoked glutamate release may explain the facilitation of CSD in heterozygous S218L KI mice, the further facilitation of CSD in homozygous S218L KI mice is due to other CaV2.1-dependent mechanisms, that likely include Ca2+ influx at voltages sub-threshold for action
International Nuclear Information System (INIS)
Lu, Lu; Xu, Hui; Luo, Fei; Liu, Xinlu; Lu, Xiaolin; Yang, Qianlei; Xue, Junchao; Chen, Chao; Shi, Le; Liu, Qizhan
2016-01-01
Cigarette smoking is the strongest risk factor for the development of lung cancer, the leading cause of cancer-related deaths. However, the molecular mechanisms leading to lung cancer are largely unknown. A long-noncoding RNA (lncRNA), CCAT1, regarded as cancer-associated, has been investigated extensively. Moreover, the molecular mechanisms of lncRNAs in regulation of microRNAs (miRNAs) induced by cigarette smoke remain unclear. In the present investigation, cigarette smoke extract (CSE) caused an altered cell cycle and increased CCAT1 levels and decreased miR-218 levels in human bronchial epithelial (HBE) cells. Depletion of CCAT1 attenuated the CSE-induced decreases of miR-218 levels, suggesting that miR-218 is negatively regulated by CCAT1 in HBE cells exposed to CSE. The CSE-induced increases of BMI1 levels and blocked by CCAT1 siRNA were attenuated by an miR-218 inhibitor. Moreover, in CSE-transformed HBE cells, the CSE-induced cell cycle changes and elevated neoplastic capacity were reversed by CCAT1 siRNA or BMI1 siRNA. This epigenetic silencing of miR-218 by CCAT1 induces an altered cell cycle transition through BMI1 and provides a new mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure induces increases of CCAT1 levels and decreases of miR-218 levels. • CCAT1 negatively regulates miR-218 expression. • CCAT1, regulated by miR-218, via BMI1, is involved in the CSE-induced altered cell cycle transition.
Energy Technology Data Exchange (ETDEWEB)
Lu, Lu; Xu, Hui; Luo, Fei; Liu, Xinlu; Lu, Xiaolin; Yang, Qianlei; Xue, Junchao; Chen, Chao; Shi, Le; Liu, Qizhan, E-mail: drqzliu@hotmail.com
2016-08-01
Cigarette smoking is the strongest risk factor for the development of lung cancer, the leading cause of cancer-related deaths. However, the molecular mechanisms leading to lung cancer are largely unknown. A long-noncoding RNA (lncRNA), CCAT1, regarded as cancer-associated, has been investigated extensively. Moreover, the molecular mechanisms of lncRNAs in regulation of microRNAs (miRNAs) induced by cigarette smoke remain unclear. In the present investigation, cigarette smoke extract (CSE) caused an altered cell cycle and increased CCAT1 levels and decreased miR-218 levels in human bronchial epithelial (HBE) cells. Depletion of CCAT1 attenuated the CSE-induced decreases of miR-218 levels, suggesting that miR-218 is negatively regulated by CCAT1 in HBE cells exposed to CSE. The CSE-induced increases of BMI1 levels and blocked by CCAT1 siRNA were attenuated by an miR-218 inhibitor. Moreover, in CSE-transformed HBE cells, the CSE-induced cell cycle changes and elevated neoplastic capacity were reversed by CCAT1 siRNA or BMI1 siRNA. This epigenetic silencing of miR-218 by CCAT1 induces an altered cell cycle transition through BMI1 and provides a new mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure induces increases of CCAT1 levels and decreases of miR-218 levels. • CCAT1 negatively regulates miR-218 expression. • CCAT1, regulated by miR-218, via BMI1, is involved in the CSE-induced altered cell cycle transition.
Energy Technology Data Exchange (ETDEWEB)
Wan, William; Bian, Wen; McDonald, Michele; Kijac, Aleksandra; Wemmer, David E.; Stubbs, Gerald [UCB; (Vanderbilt); (LBNL)
2013-11-13
The fungal prion-forming domain HET-s(218–289) forms infectious amyloid fibrils at physiological pH that were shown by solid-state NMR to be assemblies of a two-rung β-solenoid structure. Under acidic conditions, HET-s(218–289) has been shown to form amyloid fibrils that have very low infectivity in vivo, but structural information about these fibrils has been very limited. We show by x-ray fiber diffraction that the HET-s(218–289) fibrils formed under acidic conditions have a stacked β-sheet architecture commonly found in short amyloidogenic peptides and denatured protein aggregates. At physiological pH, stacked β-sheet fibrils nucleate the formation of the infectious β-solenoid prions in a process of heterogeneous seeding, but do so with kinetic profiles distinct from those of spontaneous or homogeneous (seeded with infectious β-solenoid fibrils) fibrillization. Several serial passages of stacked β-sheet-seeded solutions lead to fibrillization kinetics similar to homogeneously seeded solutions. Our results directly show that structural mutation can occur between substantially different amyloid architectures, lending credence to the suggestion that the processes of strain adaptation and crossing species barriers are facilitated by structural mutation.
Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose
International Nuclear Information System (INIS)
Cantero, Miguel; Iglesias, Rocio; Aguilar, Juan; Sau, Pablo; Tardio, Evaristo; Narrillos, Marcos
2003-01-01
The main of validation of production process of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipment's and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operation qualification, process qualification and validation report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because is done in a repetitive way according predefined parameters (Au)
Subsidence evaluation in 218-E-E12B, trench 38
International Nuclear Information System (INIS)
Streit, J.J.
1995-01-01
An area in Trench 38 of the 218-E-12B Burial Ground has been gradually sinking over the past few years. The area spans the width of the trench and extends approximately 80 feet down the trench. The depth of the depression is approximately 3 feet in the center and gradually rises to existing grade at the trench edge. It has been determined that the most likely cause of the subsidence is decomposition of buried waste material. Fifty-six percent of the waste buried in the subject area is decomposable and has been in the ground for nine years. Waste packaging is largely plastic lined dump trucks and fiberboard boxes. It is recommended that this area be treated with dynamic compaction to stabilize the waste and minimize the reoccurrence of subsidence in this area
2010-01-01
... 218.760 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... services provided by the bank to the account; and (6) Investment advice and recommendations. The bank does not provide investment advice or research concerning securities to the account, make recommendations...
Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose
International Nuclear Information System (INIS)
Cantero, Miguel; Iglesias, Rocio; Aguilar, Juan; Sau, Pablo; Tardio, Evaristo; Narrillos, Marcos
2003-01-01
The aim of production process validation of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipments and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operational qualification, performance qualification and validation final report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because consistently produced FDG meeting its pre-determined specifications and quality characteristics (Au)
De Witte, H; Borzov, I N; Caurier, E; Cederkäll, J; De Smet, A; Eckhaudt, S; Fedorov, D V; Fedosseev, V; Franchoo, S; Górska, M; Grawe, H; Huber, G; Huyse, M; Janas, Z; Köster, U; Kurcewicz, W; Kurpeta, J; Plochocki, A; Van Duppen, P; Van de Vel, K; Weissman, L
2004-01-01
The neutron-rich isotope /sup 218/Bi has been produced in proton- induced spallation of a uranium carbide target at the ISOLDE facility at CERN, extracted from the ion source by the pulsed-release technique and resonant laser ionization, and its beta decay is studied for the first time. A half-life of 33(1)s was measured and is discussed in the self-consistent continuum-quasi particle-random- phase approximation framework that includes Gamow-Teller and first- forbidden transitions. A level scheme was constructed for /sup 218 /Po, and a deexcitation pattern of stretched E2 transitions 8/sup +/ to 6/sup +/ to 4/sup +/ to 2/sup +/ to 0/sup +/ to the ground state is suggested. Shell-model calculations based on the Kuo-Herling interaction reproduce the experimental results satisfactorily. (28 refs).
BRAŠIĆ, JAMES ROBERT; CASCELLA, NICOLA; KUMAR, ANIL; ZHOU, YUN; HILTON, JOHN; RAYMONT, VANESSA; CRABB, ANDREW; GUEVARA, MARIA RITA; HORTI, ANDREW G.; WONG, DEAN FOSTER
2012-01-01
Utilizing postmortem data (Breese, et al., 2000), we hypothesized that the densities of high-affinity neuronal α4β2 nicotinic acetylcholine receptors (nAChRs) in the brain exist in a continuum from highest to lowest as follows: smokers without schizophrenia > smokers with schizophrenia > nonsmokers without schizophrenia > nonsmokers with schizophrenia. Application of the Kruskal-Wallis Test (Stata, 2003) to the postmortem data (Breese, et al., 2000) confirmed the hypothesized order in the cortex and the hippocampus and attained significance in the caudate and the thalamus. Positron emission tomography (PET) was performed for 60 minutes at 6 hours after the intravenous administration of 444 megabequerels [MBq] (12 mCi) 2-[18F]fluoro-3-(2(S)-azetidinylmethoxy)pyridine (2-[18F]FA), a radiotracer for high-affinity neuronal α4β2 nAChRs, as a bolus plus continuous infusion to 10 adults (7 men and 3 women) (6 smokers including 5 with paranoid schizophrenia and 4 nonsmokers) ranging in age from 22 to 56 years (mean 40.1, standard deviation 13.6). The thalamic nondisplaceable binding potential (BPND) was 1.32 ± 0.19 (mean ± standard deviation) for healthy control nonsmokers; 0.50 ± 0.19 for smokers with paranoid schizophrenia; and 0.51 for the single smoker without paranoid schizophrenia. The thalamic BPNDs of nonsmokers were significantly higher than those of smokers who smoked cigarettes a few hours before the scans (P = 0.0105) (StataCorp, 2003), which was likely due to occupancy of nAChRs by inhaled nicotine in smokers. Further research is needed to rule out the effects of confounding variables. PMID:22169936
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in investment company securities. 218.775... EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER IN THE SECURITIES EXCHANGE ACT OF 1934 (REGULATION R...
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
Directory of Open Access Journals (Sweden)
Laura Julia Starost
2016-10-01
Full Text Available Pertussis toxin (PTx, the major virulence factor of the whooping cough-causing bacterial pathogen Bordetella pertussis, permeabilizes the blood–brain barrier (BBB in vitro and in vivo. Breaking barriers might promote translocation of meningitis-causing bacteria across the BBB, thereby facilitating infection. PTx activates several host cell signaling pathways exploited by the neonatal meningitis-causing Escherichia coli K1-RS218 for invasion and translocation across the BBB. Here, we investigated whether PTx and E. coli K1-RS218 exert similar effects on MAPK p38, NF-κB activation and transcription of downstream targets in human cerebral endothelial TY10 cells using qRT-PCR, Western blotting, and ELISA in combination with specific inhibitors. PTx and E. coli K1-RS218 activate MAPK p38, but only E. coli K1-RS218 activates the NF-κB pathway. mRNA and protein levels of p38 and NF-κB downstream targets including IL-6, IL-8, CxCL-1, CxCL-2 and ICAM-1 were increased. The p38 specific inhibitor SB203590 blocked PTx-enhanced activity, whereas E. coli K1-RS218’s effects were inhibited by the NF-κB inhibitor Bay 11-7082. Further, we found that PTx enhances the adherence of human monocytic THP-1 cells to human cerebral endothelial TY10 cells, thereby contributing to enhanced translocation. These modulations of host cell signaling pathways by PTx and meningitis-causing E. coli support their contributions to pathogen and monocytic THP-1 cells translocation across the BBB.
Panel 2.18: logistics, information technology (IT), and telecommunications in crisis management.
De Silva, Terrence; Chikersal, Jyotsna; Snoad, Nigel; Woodworth, Brent; Ghaly, Cherif; Catterall, Martin
2005-01-01
This is a summary of the presentations and discussion of Panel 2.18, Logistics, Information Technology, and Telecommunications in Crisis Management of the Conference, Health Aspects of the Tsunami Disaster in Asia, convened by the World Health Organization (WHO) in Phuket, Thailand, 04-06 May 2005. The topics discussed included issues related to logistics, information technology (IT), and crisis communication pertaining to the responses to the damage created by the Tsunami. It is presented in the following major sections: (1) issues; (2) lessons learned; (3) what was done well; (4) what could have been done better; and (5) conclusions and recommendations. Each major section is presented in four sub-sections: (1) needs assessments; (2) coordination; (3) filling the gaps; and (4) capacity building.
Discovery of a probable galaxy with a redshift of 3.218
International Nuclear Information System (INIS)
Djorgovski, S.; Spinard, H.; McCarthy, P.; Strauss, M.A.
1985-01-01
We report the discovery of a narrow emission line object, probably a galaxy, with a redshift of 3.218. The object is a companion to the quasar PKS 1614+051, which is at a redshift of 3.209. This is the most distant non--QSO, non--gravitationally lensed object presently known by a large margin. Its properties are consistent with those expected of a high-redshift galaxy. This object has an age of only a few percent of the present age of the universe. The object was discovered with a novel technique, which promises to push studies of distant galaxies to redshifts as high as those of the most distant quasars known, and which may eventually lead to the discovery of primeval galaxies. This discovery opens the way for studies of galaxies beyond z = 3, which should prove invaluable for observational cosmology
Mass flow rate correlation for two-phase flow of R218 through a capillary tube
Czech Academy of Sciences Publication Activity Database
Vinš, Václav; Vacek, V.
2009-01-01
Roč. 29, 14-15 (2009), s. 2816-2823 ISSN 1359-4311 Institutional research plan: CEZ:AV0Z20760514 Keywords : artificial neural network * capillary tube * mass flow rate correlation * R218 Subject RIV: BK - Fluid Dynamics Impact factor: 1.922, year: 2009 http://www.sciencedirect.com/science?_ob=PublicationURL&_cdi=5687&_pubType=J&_acct=C000034318&_version=1&_urlVersion=0&_userid=640952&md5=fc314a471a010545ee185394a6c8f5f7&jchunk=29#29
VizieR Online Data Catalog: ACT high significance 148 and 218GHz sources (Marsden+, 2014)
Marsden, D.; Gralla, M.; Marriage, T. A.; Switzer, E. R.; Partridge, B.; Massardi, M.; Morales, G.; Addison, G.; Bond, J. R.; Crichton, D.; Das, S.; Devlin, M.; Dunner, R.; Hajian, A.; Hilton, M.; Hincks, A.; Hughes, J. P.; Irwin, K.; Kosowsky, A.; Menanteau, F.; Moodley, K.; Niemack, M.; Page, L.; Reese, E. D.; Schmitt, B.; Sehgal, N.; Sievers, J.; Staggs, S.; Swetz, D.; Thornton, R.; Wollack, E.
2014-11-01
The ACT experiment (Swetz et al., 2011ApJS..194...41S) is situated on the slopes of Cerro Toco in the Atacama Desert of Chile at an elevation of 5190m. ACT's latitude gives access to both the northern and southern celestial hemispheres. Observations occurred simultaneously in three frequency bands, at 148GHz (2.0mm), 218GHz (1.4mm) and 277GHz (1.1mm) with angular resolutions of roughly 1.4 , 1.0 and 0.9-arcmin, respectively. (1 data file).
Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients
International Nuclear Information System (INIS)
Liu, Wei; Wang, Yu-Feng; Zhou, Hai-Wei; Shi, Peng; Zhou, Zeng-Tong; Tang, Guo-Yao
2010-01-01
Oral leukoplakia (OL) is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Among 218 cases, 39 (17.9%) OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P < 0.001) increased risk of malignant transformation, compared with low-risk dysplasia. Consistent with this result, high-risk dysplastic OL had signicantly higher malignant incidence than low-risk dysplasia, particularly during the first 2-3 years of follow-up, by Kaplan-Meier analysis (Log-rank test, P < 0.001). The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice
HAZES, B; MAGNUS, KA; BONAVENTURA, C; BONAVENTURA, J; DAUTER, Z; KALK, KH; HOL, WGJ
The crystal structure of Limulus polyphemus subunit type II hemocyanin in the deoxygenated state has been determined to a resolution of 2.18 angstrom. Phase information for this first structure of a cheliceratan hemocyanin was obtained by molecular replacement using the crustacean hemocyanin
Palazzini, Juan M; Dunlap, Christopher A; Bowman, Michael J; Chulze, Sofía N
2016-11-01
Bacillus subtilis RC 218 was originally isolated from wheat anthers as a potential antagonist of Fusarium graminearum, the causal agent of Fusarium head blight (FHB). It was demonstrated to have antagonist activity against the plant pathogen under in vitro and greenhouse assays. The current study extends characterizing B. subtilis RC 218 with a field study and genome sequencing. The field study demonstrated that B. subtilis RC 218 could reduce disease severity and the associated mycotoxin (deoxynivalenol) accumulation, under field conditions. The genome sequencing allowed us to accurately determine the taxonomy of the strain using a phylogenomic approach, which places it in the Bacillus velezensis clade. In addition, the draft genome allowed us to use bioinformatics to mine the genome for potential metabolites. The genome mining allowed us to identify 9 active secondary metabolites conserved by all B. velezensis strains and one additional secondary metabolite, the lantibiotic ericin, which is unique to this strain. This study represents the first confirmed production of ericin by a B. velezensis strain. The genome also allowed us to do a comparative genomics with its closest relatives and compare the secondary metabolite production of the publically available B. velezensis genomes. The results showed that the diversity in secondary metabolites of strains in the B. velezensis clade is driven by strains making different antibacterials. Copyright © 2016 Elsevier GmbH. All rights reserved.
International Nuclear Information System (INIS)
1992-10-01
This document has been prepared and is being submitted to the respective agencies to satisfy three objectives of the US Department of Energy (DOE) Richland Field Office (DOE-RL) concerning Trench 94 of the 218-E-12B Burial Ground. The 218-E-12B Burial Ground is located in the 200 East Area of the Hanford Facility. Figure 1-1 shows the general location of the Hanford Site. The 218-E-12B Burial Ground is one of eight burial grounds included in the Low-Level Burial Grounds (LLBG), a treatment, storage and/or disposal (TSD) unit. Decommissioned, defueled naval submarine reactor compartments (SRCs) contain radioactivity caused by exposure of structural components to neutrons during normal operation of the submarines. After all the alternatives were evaluated in the US Department of the Navy 1984 environmental impact statement (EIS) (USN 1984), land burial of the SRCs was selected as the preferred disposal option. The SRCs currently are sent to Trench 94 of the 218-E-12B Burial Ground. In addition to radioactivity, the SRCs disposed in. The DOE-RL's three objectives in preparing and submitting this document are as follows. Request from Ecology an exemption from dangerous waste landfill liner and leachate collection and removal system (hereinafter referred to as liner/leachate system) requirements for Trench 94 of the 218-E-12B Burial Ground. Petition Ecology to exempt residual liquid in the SRCs from land disposal restrictions. Obtain EPA Region 10 review and comment on the request to Ecology for exemption from liner/leachate system requirements
International Nuclear Information System (INIS)
Li, Qiaoyan; Zhu, Fufan; Chen, Puxiang
2012-01-01
Highlights: ► Both miR-7 and miR-218 down-regulates HoxB3 expression by targeting the 3′-UTR of HoxB3 mRNA. ► A reverse correlation between the levels of endogenous miR-7, miR218 and HoxB3 expression. ► Epigenetic changes involve in the reactivation of HoxB3. ► Both miRNAs inhibits the cell cycle and clone formation of breast cancer cells. -- Abstract: Many microRNAs have been implicated as key regulators of cellular growth and differentiation and have been found to dysregulate proliferation in human tumors, including breast cancer. Cancer-linked microRNAs also alter the epigenetic landscape by way of DNA methylation and post-translational modifications of histones. Aberrations in Hox gene expression are important for oncogene or tumor suppressor during abnormal development and malignancy. Although recent studies suggest that HoxB3 is critical in breast cancer, the putative role(s) of microRNAs impinging on HoxB3 is not yet fully understood. In this study, we found that the expression levels of miR-7 and miR-218 were strongly and reversely associated with HoxB3 expression. Stable overexpression of miR-7 and miR-218 was accompanied by reactivation of tumor suppressor genes including RASSF1A and Claudin-6 by means of epigenetic switches in DNA methylation and histone modification, giving rise to inhibition of the cell cycle and clone formation of breast cancer cells. The current study provides a novel link between overexpression of collinear Hox genes and multiple microRNAs in human breast malignancy.
2010-07-01
... HERZEGOVINA SANCTIONS REGULATIONS Prohibitions § 585.218 Trade in United Nations Protected Areas of Croatia... importation from, exportation to, or transshipment of goods through the United Nations Protected Areas in the... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Trade in United Nations Protected...
Measurement of initial clustering on the radon decay product 218Po
International Nuclear Information System (INIS)
Strydom, R.
1989-01-01
The formation of water clusters on 218 Po ions is studied. The formation of the water clusters is discussed in the light of the classical theory of clustering, the clustering theory of Hawrynski and a kinetic model of clustering. The design of a specialized electric mobility spectrometer to measure the electric mobilities of the water clusters at various humidity levels is discussed. From the mobilities the radii of, and a number of water molecules in, the clusters are calculated using kinetic gas theory. The determinations were done for humidity levels between 0,16 and 96% relative humidity, and the results compared with the theoretical predictions. It was found that the classical theory underestimates the sizes of the clusters and the theory of Hawrynski overestimates the cluster sizes. It is concluded that the spectrometer is capable of high resolution measurement of the electric mobility of the small clusters. The underlying result of the clustering theories is that stable clusters with particular radii are formed at each humidity level. 91 refs., 70 figs., 11 tabs
Geophysical investigation of trench 4, Burial Ground 218-W-4C, 200 west area
International Nuclear Information System (INIS)
Kiesler, J.P.
1994-01-01
This report contains the results of a geophysical investigation conducted to characterize Trench 4, located in Burial Ground 218-W-4C, 200 West Area. Trench 4 is where transuranic (TRU) waste is stored. The primary objective of these geophysical investigations was to determine the outer edges of the trench/modules and select locations for plate-bearing tests. The test locations are to be 5 to 8 ft. beyond the edges of the trench. Secondary objectives include differentiating between the different types of waste containers within a given trench, determining the amount of soil cover over the waste containers, and to locate the module boundaries. Ground-penetrating radar (GPR) and electromagnetic induction (EMI) were the methods selected for this investigation
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
Yousuf, Farzana Abubakar; Yousuf, Zuhair; Iqbal, Junaid; Siddiqui, Ruqaiyyah; Khan, Hafsa; Khan, Naveed Ahmed
2014-01-01
Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin), adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (IbeA, CNF1), metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism) showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (CNF1), metabolism (D-serine catabolism) abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity. PMID:24818136
Directory of Open Access Journals (Sweden)
Farzana Abubakar Yousuf
2014-01-01
Full Text Available Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin, adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (IbeA, CNF1, metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (CNF1, metabolism (D-serine catabolism abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity.
International Nuclear Information System (INIS)
Tashkun, S.A.; Perevalov, V.I.; Karlovets, E.V.; Kassi, S.; Campargue, A.
2016-01-01
In a recent work (Karlovets et al., 2016 [1]), we reported the measurement and rovibrational assignments of more than 3300 transitions belonging to 64 bands of five nitrous oxide isotopologues ("1"4N_2"1"6O, "1"4N"1"5N"1"6O, "1"5N"1"4N"1"6O, "1"4N_2"1"8O and "1"4N_2"1"7O) in the high sensitivity CRDS spectrum recorded in the 7915–8334 cm"−"1 spectral range. The assignments were performed by comparison with predictions of the effective Hamiltonian models developed for each isotopologue. In the present paper, the large amount of measurements from our previous work mentioned above and literature are gathered to refine the modeling of the nitrous oxide spectrum in two ways: (i) improvement of the intensity modeling for the principal isotopologue, "1"4N_2"1"6O, near 8000 cm"−"1 from a new fit of the relevant effective dipole moment parameters, (ii) global modeling of "1"4N_2"1"8O line positions from a new fit of the parameters of the global effective Hamiltonian using an exhaustive input dataset collected in the literature in the 12–8231 cm"−"1 region. The fitted set of 81 parameters allowed reproducing near 5800 measured line positions with an RMS deviation of 0.0016 cm"−"1. The dimensionless weighted standard deviation of the fit is 1.22. As an illustration of the improvement of the predictive capabilities of the obtained effective Hamiltonian, two new "1"4N_2"1"8O bands could be assigned in the CRDS spectrum in the 7915–8334 cm"−"1 spectral range. A line list at 296 K has been generated in the 0–10,700 cm"−"1 range for "1"4N_2"1"8O in natural abundance with a 10"−"3"0 cm/molecule intensity cutoff. - Highlights: • Line parameters of two new "1"4N_2"1"8O bands centered at 7966 cm"−"1 and at 8214 cm"−"1. • Refined sets of the "1"4N_2"1"6O effective dipole moment parameters for ΔP=13,14 series. • Global modeling of "1"4N_2"1"8O line positions and intensities in the 12–8231 cm"−"1 range. • 5800 observed of "1"4N_2"1"8O line positions
Measurement of the activity size distribution of the polonium-218 under laboratory conditions
International Nuclear Information System (INIS)
Yoon, Suk Chul; Ha, Chung Woo
1992-01-01
A number of investigators have reported the formation of the radiolytic ultrafine particles produced by the interaction of ionizing radiation with water vapor. Previous studies have suggested that a very high localized concentration of the OH radical produced by the radiolysis of water can react with trace gas like organic vapors and produce lower vapor pressure compounds that can then nucleate. In order to determine water vapor and trace gas dependence of the active, positive-charged, first radon daughter, an experiment was conducted using a radon chamber. The activity size distribution of the radon daughter in the range of 0.5 - 100 nm was measured using the stacked wire screens sampler. Measurements were taken for different relative humidity. The resultant activity size distributions were analyzed. The addition of water vapor to the radon carrier gases resulted in the formation of ultrafine particles by OH radicals formed radon radiolysis. It may be due to the neutralization of charged Po-218 ion with water vapor through the radiolysis
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
Energy Technology Data Exchange (ETDEWEB)
Kraut, W.; Schwarz, W. [Duale Hochschule Baden-Wuerttemberg (DHBW), Karlsruhe (Germany). Studiengang Sicherheitswesen; Kraut, B. [Berthold Technologies GmbH und Co.KG, Bad Wildbad (Germany)
2015-07-01
Pseudo-coincidence-technique is applied to continuous monitoring of α-activity on aerosolfilters by proportional counters. Filter activity can markedly increase or decrease by changing air conditions especially by the amount of short lived Po-218 activity. Conditions of constant proportions of activity concentrations for the short lived species for operating this technique are seldom fulfilled. The dynamic behavior of artificial (long lived) and natural (short lived) activity is mathematically modelled and the measured moving count rates are analyzed under this model by a multivariate regression analysis for activity concentrations of artificial resp. short lived activity. Results are compared to standard recommendations of DIN ISO 11929.
Yoon, Young Hyun; Jeong, Jae Min; Kim, Hyung Woo; Hong, Sung Hyun; Lee, Yun-Sang; Kil, Hee Sup; Chi, Dae Yoon; Lee, Dong Soo; Chung, June-Key; Lee, Myung Chul
2003-07-01
We describe the synthesis of 2'-[(18)F]fluoroflumazenil (FFMZ), which differs from the typically used [(18)F]fluoroethylflumazenil (FEFMZ) for benzodiazepine receptor imaging. For one-pot one-step labeling, the precursors, 2'-tosyloxyflumazenil (TFMZ) and 2'-mesyloxyflumazenil (MFMZ), were synthesized in three steps. The precursors were successfully labeled with no-carrier-added (18)F-fluoride which was activated by repeated azeotropic distillation with Kryptofix 2.2.2./potassium carbonate in MeCN. An automated system for labeling and purification of [(18)F]FFMZ was developed. Labeling efficiency and radiochemical purity of [(18)F]FFMZ after synthesis by the automated system were 68% and 98%, respectively. Specific binding of [(18)F]FFMZ to central benzodiazepine receptor of rats was demonstrated by phosphoimaging.
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
Partially-deuterated samples of HET-s(218–289) fibrils: assignment and deuterium isotope effect
Energy Technology Data Exchange (ETDEWEB)
Smith, Albert A.; Ravotti, Francesco; Testori, Emilie; Cadalbert, Riccardo; Ernst, Matthias, E-mail: maer@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland); Böckmann, Anja, E-mail: a.bockmann@ibcp.fr [Institut de Biologie et Chimie des Protéines, Bases Moléculaires et Structurales des Systèmes Infectieux, Labex Ecofect, UMR 5086 CNRS, Université de Lyon (France); Meier, Beat H., E-mail: beme@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland)
2017-02-15
Fast magic-angle spinning and partial sample deuteration allows direct detection of {sup 1}H in solid-state NMR, yielding significant gains in mass sensitivity. In order to further analyze the spectra, {sup 1}H detection requires assignment of the {sup 1}H resonances. In this work, resonance assignments of backbone H{sup N} and Hα are presented for HET-s(218–289) fibrils, based on the existing assignment of Cα, Cβ, C’, and N resonances. The samples used are partially deuterated for higher spectral resolution, and the shifts in resonance frequencies of Cα and Cβ due to the deuterium isotope effect are investigated. It is shown that the deuterium isotope effect can be estimated and used for assigning resonances of deuterated samples in solid-state NMR, based on known resonances of the protonated protein.
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
International Nuclear Information System (INIS)
Gai, M.
1984-01-01
The high spin states of 218 Ra exhibit a band of alternating parity states with enhanced E1 decay mode (B(E1) >=10 -2 W.u.). Various theoretical models are discussed, such as the octupole model, f and g boson model, second order E1 operator in IBA1 model, and the cluster model. The enhanced E1 deexcitation favors the cluster model. The low spin negative parity states lie on a J(J+1) trajectory contrary to the assumed vibrational character of the negative parity states in 218 Ra. A change in the character of states above the 11 - state is observed via a change in the moment of inertia and a decrease in the B(E1)/B(E2) branch ratios. Two quasi-particle 11 - states systematically occurring in the Ra-isotopes may be responsible for this change. The well known effect of loss of collectivity arising from two quasi-particle states, as observed in the hindrance of B(E2), is suggested to more dramatically hinder the B(E1) and lead to a reduction in the branch ratio B(E1)/B(E2). This observation suggests that the E1 enhancement is of collective character
International Nuclear Information System (INIS)
1997-07-01
This environmental assessment (EA) has been prepared to assess potential environmental impacts associated with the US Department of Energy''s proposed action: to widen and operated the unused Trench 33 in the 218-W-5 Low-Level Burial Ground. Information contained herein will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No significant Impact will be issued and the action may proceed
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-07-01
This environmental assessment (EA) has been prepared to assess potential environmental impacts associated with the US Department of Energy`s proposed action: to widen and operated the unused Trench 33 in the 218-W-5 Low-Level Burial Ground. Information contained herein will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No significant Impact will be issued and the action may proceed.
International Nuclear Information System (INIS)
Fazal-ur-Rehman; Jamil, K.; Ali, S.; Khan, H.A.
1996-01-01
Passive radon /sup 222/Rn dosimeters employing particle detectors are widely used in concentration (p Ci/l) measurement in houses, mines and other areas of activity. These dosimeters yield track density which is needed to be converted into physically meaningful parameter of radon concentration in either p Ci/l or Bq m/sup -3/. Therefore, it is required to know the separate contributions of /sup 222/Rn and its progeny. In the present study we have measured the concentration of /sup 222/Rn and its daughters (/sup 218/Po and /sup 214/Po) separately in the Karlsruhe diffusion chamber radon dosimeter, with and without a filter, as a function of time by an active method using a surface barrier detector. The build up behavior of radon and its two daughters (/sup 218/Po and /sup 214/Po) as a function of time was studied by plotting the area under each peak versus collection time. The differential curves and the relative concentration of radon daughters as a function of time were also studied. The concentration of radon and its daughters shows a somewhat linear build up as a function of time for the presently studied time periods. The results of this experiment are expected to be useful in converting the integrated alpha track density as measured by a particle track detector, (used in passive radon dosimetry) to radon concentration levels and for determination of equilibrium factor. (author)
Whole-body distribution and dosimetry of O-(2-[18F]fluoroethyl)-L-tyrosine.
Pauleit, Dirk; Floeth, Frank; Herzog, Hans; Hamacher, Kurt; Tellmann, Lutz; Müller, Hans-W; Coenen, Heinz H; Langen, Karl-J
2003-04-01
The whole-body distribution of O-(2-[(18)F]fluoroethyl)- l-tyrosine (FET) was studied in seven patients with brain tumours by positron emission tomography (PET). Based on the IMEDOSE and MIRDOSE procedures, radiation absorbed doses were estimated from whole-body PET scans acquired approximately 70 and 200 min after i.v. injection of 400 MBq FET. After injection of FET, the peak of radioactivity in the blood was observed after 1.5 min, and a plateau of nearly constant radioactivity was reached at 20 min. The whole-body distribution of FET showed the highest activities in the urinary tract. All other organs exhibited only moderate FET uptake (SUV =1.6) which remained constant between early and late PET scans. No increased uptake was seen in the bone, the biliary tract or the pancreas. Twenty-two percent of the injected activity was excreted 5 h p.i. (approx. 5.3% ID/h). The highest absorbed dose was found for the urinary bladder wall. The effective dose according to ICRP 60 was 16.5 micro Sv/MBq for adults, which would lead to an effective dose of 6.1 mSv in a PET study using 370 MBq FET.
International Nuclear Information System (INIS)
Angenete, Oskar W.; Augdal, Thomas A.; Jellestad, Stig; Rygg, Marite; Rosendahl, Karen
2018-01-01
Knowledge of normal appearances of the temporomandibular joint (TMJ) is paramount when assessing the joint for disease in juvenile idiopathic arthritis. Reliable features defining normal TMJs in children are limited. To establish reliable normal standards for the TMJ at magnetic resonance imaging (MRI). We included children and young adults aged 2-18 years undergoing a head MRI for reasons not believed to affect the TMJs. We assessed TMJ anatomy and contrast enhancement using a high-resolution 3-D T1-weighted sequence. We noted joint fluid and bone marrow oedema based on a T2-weighted sequence. Three experienced radiologists read all examinations twice in consensus and defined intraobserver consensus agreement. We evaluated the TMJs in 101 children and young adults (45 female), mean age 10.7 years (range 2-18 years). The intraobserver consensus agreement for the assessment of anterior condylar inclination in the sagittal/oblique plane was moderate to good (Cohen κ=0.7 for the right side). Cohen κ for intraobserver consensus agreement for condylar shape in the coronal plane on a 0-2 scale was 0.4 for the right and 0.6 for the left. Intraobserver agreement for measurement of joint space height and assessment of bone marrow oedema was poor. There was a statistically significant increase in anterior inclination by age in the sagittal plane on a 0-2 scale (P<0.0001). Eighty percent of the condyles showed a rounded shape in the coronal plane while 20% showed mild flattening. Thirty-five of 36 right TMJs showed contrast enhancement (mild enhancement in 32 joints, moderate in 3 joints). Subjective assessment of the anterior condylar inclination in the sagittal/oblique plane and condylar flattening in the coronal plane can be considered precise features for describing TMJ anatomy in healthy children. There is an increasing anterior inclination by age. Mild contrast enhancement of the TMJs should be considered a normal finding. (orig.)
O'Neil, Carol E; Nicklas, Theresa A; Fulgoni, Victor L; DiRienzo, Maureen A
2015-01-01
None of the studies of whole grains that have looked either at diet or weight/adiposity measures have focused exclusively on oatmeal. The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2-18. A nationally representative sample of children aged 2-18 (N=14,690) participating in National Health and Nutrition Examination Survey 2001-2010 was used. Intake was determined from a single 24-h dietary recall. Diet quality was measured using the Healthy Eating Index-2010 (HEI-2010). Covariate-adjusted regression analyses, using appropriate sample weights, were used to determine differences between oatmeal consumers and non-consumers for demographics, nutrient intakes, diet quality, and weight/adiposity measures (pempty calories. Children consuming oatmeal were at lower risk for having central adiposity and being obese. Consumption of oatmeal by children was associated with better nutrient intake, diet quality, and reduced risk for central adiposity and obesity and should be encouraged as part of an overall healthful diet.
Directory of Open Access Journals (Sweden)
Stuart F. McDaniel
2013-04-01
Full Text Available Premise of the study: We developed and tested primers for 218 nuclear loci for studying population genetics, phylogeography, and genome evolution in bryophytes. Methods and Results: We aligned expressed sequence tags (ESTs from Ceratodon purpureus to the Physcomitrella patens genome sequence, and designed primers that are homologous to conserved exons but span introns in the P. patens genome. We tested these primers on four isolates from New York, USA; Otavalo, Ecuador; and two laboratory isolates from Austria (WT4 and GG1. The median genome-wide nucleotide diversity was 0.008 substitutions/site, but the range was large (0–0.14, illustrating the among-locus heterogeneity in the species. Conclusions: These loci provide a valuable resource for finely resolved, genome-wide population genetic and species-level phylogenetic analyses of C. purpureus and its relatives.
Study of the atmospheric chemistry of 218Po. Progress report, August 21, 1983-March 14, 1984
International Nuclear Information System (INIS)
Hopke, P.K.
1984-03-01
Studies have been completed that have demonstrated that there are two mechanisms for the neutralization of 218 Po + ions formed by the decay of 222 Rn. In the presence of oxygen, an oxide species is formed. It has been determined as part of the present work that this oxide species has an ionization potential in the range of 10.35 to 10.53 eV and that it can be neutralized by extracting electrons from lower ionization potential trace gases. It has also been found that a second mechanism is responsible for neutralization in the absence of oxygen. The behavior of NO 2 in the range of 50 ppB to 1 ppM in N 2 was explored. For NO 2 concentrations above 700 ppB, complete neutralization was observed. For lower concentrations, a concentration dependent degree of neutralization was observed. Studies are now being initiated to examine the kinetics of these neutralization processes. 27 references, 3 figures, 4 tables
Sarkis, Paula; Henning, Thomas; Kürster, Martin; Trifonov, Trifon; Zechmeister, Mathias; Tal-Or, Lev; Anglada-Escudé, Guillem; Hatzes, Artie P.; Lafarga, Marina; Dreizler, Stefan; Ribas, Ignasi; Caballero, José A.; Reiners, Ansgar; Mallonn, Matthias; Morales, Juan C.; Kaminski, Adrian; Aceituno, Jesús; Amado, Pedro J.; Béjar, Victor J. S.; Hagen, Hans-Jürgen; Jeffers, Sandra; Quirrenbach, Andreas; Launhardt, Ralf; Marvin, Christopher; Montes, David
2018-06-01
K2-18 is a nearby M2.5 dwarf, located at 34 pc and hosting a transiting planet that was first discovered by the K2 mission and later confirmed with Spitzer Space Telescope observations. With a radius of ∼2 R ⊕ and an orbital period of ∼33 days, the planet lies in the temperate zone of its host star and receives stellar irradiation similar to that of Earth. Here we perform radial velocity follow-up observations with the visual channel of CARMENES with the goal of determining the mass and density of the planet. We measure a planetary semi-amplitude of K b ∼ 3.5 {{m}} {{{s}}}-1 and a mass of M b ∼ 9 M ⊕, yielding a bulk density around {ρ }b∼ 4 {{g}} {cm}}-3. This indicates a low-mass planet with a composition consistent with a solid core and a volatile-rich envelope. A signal at 9 days was recently reported using radial velocity measurements taken with the HARPS spectrograph. This was interpreted as being due to a second planet. We see a weaker, time- and wavelength-dependent signal in the CARMENES data set and thus favor stellar activity for its origin. K2-18 b joins the growing group of low-mass planets detected in the temperate zone of M dwarfs. The brightness of the host star in the near-infrared makes the system a good target for detailed atmospheric studies with the James Webb Space Telescope.
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
Institute of Scientific and Technical Information of China (English)
John; Freebody; Eva; A; Wegner; Monica; A; Rossleigh
2014-01-01
Positron emission tomography(PET) is a minimally in-vasive technique which has been well validated for the diagnosis, staging, monitoring of response to therapy, and disease surveillance of adult oncology patients. Tra-ditionally the value of PET and PET/computed tomogra-phy(CT) hybrid imaging has been less clearly defined for paediatric oncology. However recent evidence has emerged regarding the diagnostic utility of these mo-dalities, and they are becoming increasingly important tools in the evaluation and monitoring of children with known or suspected malignant disease. Important indi-cations for 2-deoxy-2-(18F)fluoro-D-glucose(FDG) PET in paediatric oncology include lymphoma, brain tumours, sarcoma, neuroblastoma, Langerhans cell histiocytosis, urogenital tumours and neurofibromatosis type Ⅰ. This article aims to review current evidence for the use of FDG PET and PET/CT in these indications. Attention will also be given to technical and logistical issues, the description of common imaging pitfalls, and dosimetric concerns as they relate to paediatric oncology.
Miller, R. D.; Anderson, L. R.
1979-01-01
The LOADS program L218, a digital computer program that calculates dynamic load coefficient matrices utilizing the force summation method, is described. The load equations are derived for a flight vehicle in straight and level flight and excited by gusts and/or control motions. In addition, sensor equations are calculated for use with an active control system. The load coefficient matrices are calculated for the following types of loads: translational and rotational accelerations, velocities, and displacements; panel aerodynamic forces; net panel forces; shears and moments. Program usage and a brief description of the analysis used are presented. A description of the design and structure of the program to aid those who will maintain and/or modify the program in the future is included.
Oyama, Hirofumi; Miwa, Shigeru; Noda, Tomoyuki; Sobajima, Atsuhiro; Kito, Akira; Maki, Hideki; Hattori, Kenichi; Wada, Kentaro
2012-01-01
A 51-year-old female with a history of rheumatoid arthritis rapidly developed anterior neck pain and paresis in the left upper and lower extremities and right lower extremity, sensory disturbance in the left upper and lower extremities, and bladder and rectal disorder. Adduction of the left eye and abduction of the right eye were also disturbed. Spinal magnetic resonance imaging demonstrated severe edema in the C1-T5 levels, which then deteriorated rapidly over 3 days, and lesions enhanced with gadolinium in the C1-C3 and C5-T3 levels. 2-Deoxy-2-[18F]fluoro-D-glucose positron emission tomography study demonstrated the inflammatory sites as segmental enhanced accumulation in the C1-C3, C5-C6, and T1 levels. The serum anti-aquaporin 4 antibody level was positive and she was diagnosed with neuromyelitis optica spectrum disorder. Marked improvement in the neurological conditions, concomitant with reduced spinal cord edema, was obtained by steroid pulse therapy.
DEFF Research Database (Denmark)
Keiding, S; Munk, O L; Schiøtt, K M
2000-01-01
Positron emission tomography (PET) using 2-[18F]fluoro-2-deoxy-D-glucose (FDG) is a useful diagnostic tool for the detection of tumours. Using dynamic FDG PET, net metabolic clearance of FDG, K, can be calculated by Gjedde-Patlak analysis of the time course of the radioactivity concentrations...... in tissue and arterial blood. We examined whether time-activity curves (TACs) based on arterial blood sampling could be replaced by TACs obtained from the descending aorta in dynamic PET scans of patients with liver tumours. The study was performed in two parts, using data from dynamic liver scans......, and 2.1-8.4:1 (mean, 4.6:1) based on blood sample TACs (P>0.3). We conclude that arterial blood sampling can be replaced by the present AORTA-VOI in the calculation of the net metabolic clearance of FDG in dynamic PET studies of liver tumours in human subjects. Udgivelsesdato: 2000-Apr...
Effect of Shot Peening on the Fatigue Strength of Automotive Tubular Stabilizer Bars DC 218
Directory of Open Access Journals (Sweden)
Wittek A.M.
2016-12-01
Full Text Available This paper concerns issues related to the development of designs of stabilizer bars for new motor vehicle models. It involves not only the designing of a stabilizer bar with the shape required by the manufacturer, but also the preparation of bending and heat treatment processes as well as the performance of strength and fatigue tests. In the prototype development phase, the simulations techniques (FEM may be used to assess the design. The article contains a detailed analysis of a stabilizer bar designated with the DC 218 VA symbol. Performed numerical strength and fatigue calculations showed that the developed stabilizer bar design with the desired shape did not achieve the required number of fatigue cycles. It was also proven at the test stand by testing a prototype stabilizer bar. Therefore, it was suggested to supplement the technological process with an additional shot peening operation whose main aim was to reduce the length of microcracks on the stabilizer bar’s surface. This effect was confirmed during comparative metallographic tests of not shot – peened and shot – peened stabilizer bars. After shot peening, the analysed stabilizer bar reached a fatigue strength which exceeded the limits set by the manufacturer.
International Nuclear Information System (INIS)
PAWLAK, M.W.
1998-01-01
The purpose of this report is to compile the records generated during the Packaging and Shipping of WESF Hot-Cell Waste from the 225-B Facility to 200W (218-W-3AE) burial grounds. A total of six 55-gallon drums were packaged and shipped using the Chem-Nuc Cask in accordance with WHC-SD-TP-SARP-025, Rev.0 ''Safety Analysis Report for Packaging (Onsite) for Type B Material in the CNS-14-215H Cask''
International Nuclear Information System (INIS)
Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.
1994-05-01
An assessment was performed to evaluate release and transport of nickel from large metal components containing nickel-bearing alloys at the Hanford Site 218-E-12B Burial Ground. The potential for nickel within the components to enter groundwater under the burial site was investigated by examining available data on the site's geology, geochemistry, and geohydrology to develop a conceptual model for release and transport of nickel from the components. In addition, laboratory studies were performed to provide information needed for the model, but which was not available from existing databases. Estimates of future concentrations of nickel radioisotopes ( 59 Ni and 63 Ni) and total elemental nickel in the unconfined aquifer and in the Columbia River were developed based on this information
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
Electromagnetic characteristics of manganese oxide-coated Fe3O4 nanoparticles at 2-18 GHz
Yang, R. B.; Liang, W. F.; Lin, C. K.
2011-04-01
The dielectric and magnetic properties of manganese oxide-coated Fe3O4 nanoparticles (NPs) were measured by the transmission/reflection method in 2-18 GHz. MnOx-coated Fe3O4 NPs were prepared by sol-gel method followed by heat-treating at 300, 400, and 500 °C, respectively. The heat-treated powders were then used as magnetic fillers and added to an epoxy resin to prepare MnOx-coated Fe3O4 composites for the complex permittivity (ɛ'-jɛ″) and permeability (μ'-jμ″) measurements. After the sol-gel process, the coating of manganese oxide (mixture of major Mn2O3 and minor Mn3O4) reduced the value of ɛ'. The lower the heat-treating temperature, the larger the decrease in ɛ'. The relative decrease in ɛ', compared with uncoated Fe3O4 nanoparticles, is 28.7, 23.5, and 20.0% for coated MnOx heat-treated at 300, 400, and 500 °C, respectively, while the relative decrease in ɛ″ is 74.1, 68.8, and 65.2%, respectively. In the present study, MnOx-coated Fe3O4 exhibited a significant decrease in dielectric loss tangent of ˜100% compared to that of uncoated NPs and can be of practical use for microwave components.
Directory of Open Access Journals (Sweden)
Erik Årstad
2013-05-01
Full Text Available 2-[18F]Fluoroethyl azide ([18F]FEA can readily be obtained by nucleophilic substitution of 2-azidoethyl-4-toluenesulfonate with [18F]fluoride (half-life 110 min, and has become widely used as a reagent for ‘click’ labeling of PET tracers. However, distillation of [18F]FEA is typically required, which is time-consuming and unpractical for routine applications. In addition, copper(I-catalyzed cycloaddition of [18F]FEA with non-activated alkynes, and with substrates containing labile functional groups, can be challenging. Herein, we report a highly efficient and practical ligand-accelerated one-pot/two-step method for ‘click’ labeling of small molecule tracers with [18F]FEA. The method exploits the ability of the copper(I ligand bathophenanthrolinedisulfonate to accelerate the rate of the cycloaddition reaction. As a result, alkynes can be added directly to the crude reaction mixture containing [18F]FEA, and as cyclisation occurs almost immediately at room temperature, the reaction is tolerant to labile functional groups. The method was demonstrated by reacting [18F]FEA with a series of alkyne-functionalized 6-halopurines to give the corresponding triazoles in 55–76% analytical radiochemical yield.
Seo, Youngmin
2016-01-01
We present deep NH3 map of L1495-B218 filaments and the dense cores embedded within the filaments in Taurus. The L1495-B218 filaments form an interconnected, nearby, large complex extending 8 pc. We observed the filaments in NH3 (1,1) & (2,2) and CCS 21-10 with spectral resolution of 0.038 km/s and spatial resolution of 31". The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithm, identifies 39 leaves and 16 branches in NH3 (1,1). Applying a virial analysis for the 39 NH3 leaves, we find only 9 out of 39 leaves are gravitationally bound, and 12 out of 30 gravitationally unbound leaves are pressure-confined. Our analysis suggests that a dense core may form as a pressure-confined structure, evolve to a gravitationally bound core, and then undergo collapse to form a protostar (Seo et al. 2015).We also present more realistic dynamic stability conditions for dense cores with converging motions and under the influence of radiation pressure. The critical Bonnor-Ebert sphere and the isothermal cylinder have been widely used to test stability of dense cores and filaments; however, these assume a quiescent environment while actual star forming regions are turbulent and illuminated by radiation. In a new analysis of stability conditions we account for converging motions which have been modeled toward starless cores (Seo et al. 2011) and the effect of radiation fields into account. We find that the critical size of a dense core having a homologous converging motion with its peak speed being the sound speed is roughly half of the critical size of the Bonnor-Ebert sphere (Seo et al. 2013). We also find that the critical mass/line density of a dense core/filament irradiated by radiation are considerably smaller than that of the Bonnor-Ebert sphere/isothermal cylinder when the radiation pressure is stronger than the central gas pressure of dense core/isothermal cylinder. For inner Galactic regions and regions near OB associations, the critical
DEFF Research Database (Denmark)
Bak-Fredslund, Kirstine P; Lykke Eriksen, Peter; Munk, Ole L
2017-01-01
Background: PET/CT with the radioactively labelled galactose analogue 2-18F-fluoro-2-deoxy-D-galactose (18F-FDGal) can be used to quantify the hepatic metabolic function and visualise regional metabolic heterogeneity. We determined the day-to-day variation in humans with and without liver disease....... Furthermore, we examined whether the standardised uptake value (SUV) of 18F-FDGal from static scans can substitute the hepatic systemic clearance of 18F- FDGal (Kmet, mL blood/min/mL liver tissue/) quantified from dynamic scans as measure of metabolic function. Four patients with cirrhosis and six healthy...... subjects underwent two 18F-FDGal PET/CT scans within a median interval of 15 days for determination of day-to-day variation. The correlation between Kmet and SUV was examined using scan data and measured arterial blood concentrations of 18F-FDGal (blood samples) from 14 subjects from previous studies...
Elastic scattering for 16O + 12C at 140 MeV and 218 MeV
International Nuclear Information System (INIS)
Galindo U, A.
1981-01-01
In this work, angular distribution of cross sections have been measured for 12 C( 16 O, 16 O) 12 C at two energies. The measurements were carried out in 0.5 0 intervals between 5 0 -19.5 0 C (lab.) at 140 MeV, 4.5 0 -14.5 0 at 218 MeV. An optical model analysis of these strong structure angular distributions was done. Good fits of the data were obtained using the optical model search code GENOA with a full Woods-Saxon potential form. This yielded parameters subject to considerable ambiguities as it is known to occur for strongly absorbed particles. These ambiguities were explored in detail and it was found that both the real and the imaginary parts present some characteristics that have been found before for the real potential (as Igo relation for continous ambiguities and the fact that potentials with different diffusivities tend to have the same value at the strong absorption radii). It was found, among other results, that the real volume integral, the mean square radius, as well as the total reaction cross section (σsub(r)) cannot be determined unambiguously. A strong correlation was found between σsub(r) and the imaginary diffusivity. A systematic study of how the variation of the potential parameters affects the angular distribution is presented and some features of the diffraction structure of the angular distribution are discussed. (author)
Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben;
2010-01-01
We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results dearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ACDM cosmological model. At l > 3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8(sigma) level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.
Barthel, Matthias; Sturm, Patrick; Hammerle, Albin; Siegwolf, Rolf; Gentsch, Lydia; Buchmann, Nina; Knohl, Alexander
2013-04-01
Above- and belowground processes in plants are tightly coupled via carbon and water flows through the atmosphere-plant-soil system. While recent studies elucidated the influence of drought on the carbon flow through plant and soil using 13C, much less is known about the propagation of 18O. Therefore, this study aimed to examine the timing and intensity of 18O enrichment in soil and shoot CO2 and H2O vapor fluxes of European beech saplings (Fagus sylvatica L.) after applying 18O-labeled water to the soil. A custom-made chamber system, separating shoot from soil compartments, allowed independent measurements of shoot and soil related processes in a controlled climate chamber environment. Gas-exchange of oxygen stable isotopes in CO2 and H2O-vapor served as the main tool for investigation and was monitored in real-time using laser spectroscopy. This is the first study measuring concurrently and continuously the enrichment of 18O in CO2 and H2O in shoot- and soil gas-exchange after applying 18O-labeled water to the soil. Photosynthesis (A) and stomatal conductance (gs) of drought-stressed plants showed an immediate coinciding small increase to the H218O irrigation event after only ~30 min. This rapid information transfer, however, was not accompanied by the arrival of 18O labeled water molecules within the shoot. The actual label induced 18O enrichment in transpired water and CO2 occurred not until ~4h after labeling. Further, the timing of the enrichment of 18O in the transpirational flux was similar in both treatments, thus pointing to similar transport rates. However, drought reduced the 18O exchange rate between H2O and CO2at the shoot level, likely caused by a smaller leaf CO2retroflux. Moreover, 18O exchange between H2O and CO2 occurred also in the soil. However, the there was no difference observed between the treatments.
Directory of Open Access Journals (Sweden)
Gjermund Henriksen
2013-06-01
Full Text Available We have developed a new method for automated production of 2-[18F]fluoroethyl tosylate ([18F]FETos that enables 18F-alkylation to provide PET tracers with high chemical purity. The method is based on the removal of excess ethylene glycol bistosylate precursor by precipitation and subsequent filtration and purification of the filtrate by means of solid phase extraction cartridges (SPE. The method is integrated to a single synthesis module and thereby provides the advantage over previous methods of not requiring HPLC purification, as demonstrated by the full radiosynthesis of the potent opioid receptor PET tracer [18F]fluoroethyldiprenorphine.
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
A numerical model for the movement of H 2O, H 218O, and 2HHO in the unsaturated zone
Shurbaji, Abdel-Rahman M.; Phillips, Fred M.
1995-09-01
Vertical profiles of H 218O and 2HHO concentrations have yielded useful information on evaporation and infiltration processes in soils. However, in the field, quantitative interpretation of such profiles has been limited by the restrictions inherent in the quasi-steady-state and transient analytical models available to describe the physical processes. This study presents a flexible numerical model that simulates transient fluxes of heat, liquid water, water vapor, and isotopic species. The model can simulate both infiltration and evaporation under fluctuating meteorological conditions and thus should be useful in reproducing changes in field isotope profiles. A transition factor is introduced in the isotope transport equation. This factor combines hydrologic and isotopic parameters and changes slowly with depth in the soil profile but strongly in the evaporation zone, owing to the rapid change in the dominant phase of water from liquid to vapor. Using the transition factor in the isotope transport equation facilitates obtaining the typical shape of the isotope profile (bulge at the evaporation zone). This factor also facilitates producing broad isotope enrichment peaks that may be seen in very dry soils.
García Vicente, A M; Soriano Castrejón, A; Cruz Mora, M Á; Ortega Ruiperez, C; Espinosa Aunión, R; León Martín, A; González Ageitos, A; Van Gómez López, O
2014-01-01
To assess dual time point 2-deoxy-2-[(18)F]fluoro-D-glucose (18)(F)FDG PET-CT accuracy in nodal staging and in detection of extra-axillary involvement. Dual time point [(18)F] FDG PET/CT scan was performed in 75 patients. Visual and semiquantitative assessment of lymph nodes was performed. Semiquantitative measurement of SUV and ROC-analysis were carried out to calculate SUV(max) cut-off value with the best diagnostic performance. Axillary and extra-axillary lymph node chains were evaluated. Sensitivity and specificity of visual assessment was 87.3% and 75%, respectively. SUV(max) values with the best sensitivity were 0.90 and 0.95 for early and delayed PET, respectively. SUV(max) values with the best specificity were 1.95 and 2.75, respectively. Extra-axillary lymph node involvement was detected in 26.7%. FDG PET/CT detected extra-axillary lymph node involvement in one-fourth of the patients. Semiquantitative lymph node analysis did not show any advantage over the visual evaluation. Copyright © 2013 Elsevier España, S.L. and SEMNIM. All rights reserved.
International Nuclear Information System (INIS)
Morris, Olivia; Gregory, J.; Kadirvel, M.; Henderson, Fiona; Blykers, A.; McMahon, Adam; Taylor, Mark; Allsop, David; Allan, Stuart; Grigg, J.; Boutin, Herve; Prenant, Christian
2016-01-01
2-["1"8F]-Fluoro-3-pyridinecarboxaldehyde (["1"8F]FPCA) is a novel, water-soluble prosthetic group. It's radiochemistry has been developed and fully-automated for application in chemoselective radiolabelling of amino(oxy)-derivatised RI-OR2-TAT peptide, (Aoa-k)-RI-OR2-TAT, using a GE TRACERlab FX-FN. RI-OR2-TAT is a brain-penetrant, retro-inverso peptide that binds to amyloid species associated with Alzheimer's Disease. Radiolabelled (Aoa-k)-RI-OR2-TAT was reproducibly synthesised and the product of the reaction with FPCA has been fully characterised. In-vivo biodistribution of ["1"8F]RI-OR2-TAT has been measured in Wistar rats.
Energy Technology Data Exchange (ETDEWEB)
Zaremba, R.I.; Rodewald, U. Ch.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany); Kalychak, Y.M.; Zaremba, V.I. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv, Lviv (Ukraine)
2006-08-15
New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In have been synthesized from the elements by arc-melting. Single crystals were grown by special annealing modes. The thee indides were investigated via X-ray powder and single crystal diffraction: Ho{sub 6}Co{sub 2}Ga type, Immm, a = 886.7(3), b = 878.0(2), c = 932.1(3) pm, wR2 = 0.0517, 711 F{sup 2} values, 35 variables for Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Ho{sub 10}Ni{sub 9}In{sub 20} type, P4/nmm, a = 1287.5(2), c = 884.7(1) pm, wR2 = 0.0642, 1221 F{sup 2} values, 63 variables for Sc{sub 10}Ni{sub 9}In{sub 19.44}, and MgCu{sub 4}Sn type, anti F 43m, a = 704.03(7) pm, wR2 = 0.0267, 101 F{sup 2} values, and 7 variables for ScCu{sub 4}In. The scandium rich indide Sc{sub 6}Co{sub 2.18}In{sub 0.82} contains two Co{sub 2} dumb-bells at Co-Co distances of 221 and 230 pm. Each cobalt atom within these dumb-bells has a tricapped trigonal prismatic coordination. The In1 site has a distorted cube-like coordination by scandium and shows a mixed occupancy (36%) with cobalt. The In2 atoms have distorted icosahedral scandium coordination. As a consequence of the small size of the scandium atoms, the In4 site in Sc{sub 10}Ni{sub 9}In{sub 19.44} shows defects and was furthermore refined with a split model leading to a new distorted variant within the family of Ho{sub 10}Ni{sub 9}In{sub 20} compounds. ScCu{sub 4}In is an ordered version of the cubic Laves phase with scandium and indium atoms in the CN16 voids of the copper substructure. The Cu-Cu distances within the three-dimensional network of corner-sharing tetrahedra are 248.6 and 249.2 pm. The crystal chemical peculiarities of these three indide structures are briefly discussed. (orig.)
Sandell, A; Ohlsson, T; Erlandsson, K; Hellborg, R; Strand, S E
1992-01-01
We have developed a comparatively inexpensive PET system, based on a rotating scanner with two scintillation camera heads, and a nearby low energy electrostatic proton accelerator for production of short-lived radionuclides. Using a 6 MeV proton beam of 5 microA, and by optimization of the target geometry for the 18O(p,n)18F reaction, 750 MBq of 2-18FDG can be obtained. The PET scanner shows a spatial resolution of 6 mm (FWHM) and a sensitivity of 80 s-1kBq-1ml-1 (3 kcps/microCi/ml). Various corrections are included in the imaging process, to compensate for spatial and temporal response variations in the detector system. Both filtered backprojection and iterative reconstruction methods are employed. Clinical studies have been performed with acquisition times of 30-40 min. The system will be used for clinical experimental research with short- as well as long-lived positron emitters. Also the possibility of true 3D reconstruction is under evaluation.
DEFF Research Database (Denmark)
Dunkl, Veronika; Cleff, Corvin; Stoffels, Gabriele
2015-01-01
UNLABELLED: Experience regarding O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) PET in children and adolescents with brain tumors is limited. METHODS: Sixty-nine (18)F-FET PET scans of 48 children and adolescents (median age, 13 y; range, 1-18 y) were analyzed retrospectively. Twenty-six scans...... to assess newly diagnosed cerebral lesions, 24 scans for diagnosing tumor progression or recurrence, 8 scans for monitoring of chemotherapy effects, and 11 scans for the detection of residual tumor after resection were obtained. Maximum and mean tumor-to-brain ratios (TBRs) were determined at 20-40 min...... after injection, and time-activity curves of (18)F-FET uptake were assigned to 3 different patterns: constant increase; peak at greater than 20-40 min after injection, followed by a plateau; and early peak (≤ 20 min), followed by a constant descent. The diagnostic accuracy of (18)F-FET PET was assessed...
Energy Technology Data Exchange (ETDEWEB)
Miften, M. [University of Colorado School of Medicine (United States)
2016-06-15
of possible dosimetry protocols. The report will be reviewed by the AAPM Working Group on Recommendations for Radiotherapy External Beam Quality Assurance and then by the AAPM Science Council before publication in Medical Physics Survey of possible calibration protocols for calibration of Gamma Stereotactic Radiosurgery (GSR) devices Overview of modern Quality Assurance techniques for GSR AAPM TG-218 Tolerance Levels and Methodologies for IMRT Verification QA - Moyed Miften Patient-specific IMRT QA measurement is a process designed to identify discrepancies between calculated and delivered doses. Error tolerance limits are not well-defined or consistently applied across centers. The AAPM TG-218 report has been prepared to improve the understanding and consistency of this process by providing recommendations for methodologies and tolerance limits in patient-specific IMRT QA. Learning Objectives: Review measurement methods and methodologies for absolute dose verification Provide recommendations on delivery methods, data interpretation, the use of analysis routines and choice of tolerance limits for IMRT QA Sonja Dieterich has a research agreement with Sun Nuclear Inc. Steven Goetsch is a part-time consultant for Elekta.
International Nuclear Information System (INIS)
Miften, M.
2016-01-01
of possible dosimetry protocols. The report will be reviewed by the AAPM Working Group on Recommendations for Radiotherapy External Beam Quality Assurance and then by the AAPM Science Council before publication in Medical Physics Survey of possible calibration protocols for calibration of Gamma Stereotactic Radiosurgery (GSR) devices Overview of modern Quality Assurance techniques for GSR AAPM TG-218 Tolerance Levels and Methodologies for IMRT Verification QA - Moyed Miften Patient-specific IMRT QA measurement is a process designed to identify discrepancies between calculated and delivered doses. Error tolerance limits are not well-defined or consistently applied across centers. The AAPM TG-218 report has been prepared to improve the understanding and consistency of this process by providing recommendations for methodologies and tolerance limits in patient-specific IMRT QA. Learning Objectives: Review measurement methods and methodologies for absolute dose verification Provide recommendations on delivery methods, data interpretation, the use of analysis routines and choice of tolerance limits for IMRT QA Sonja Dieterich has a research agreement with Sun Nuclear Inc. Steven Goetsch is a part-time consultant for Elekta.
Alzualde, Ainhoa; Indakoetxea, Begoña; Ferrer, Isidre; Moreno, Fermin; Barandiaran, Myriam; Gorostidi, Ana; Estanga, Ainara; Ruiz, Irune; Calero, Miguel; van Leeuwen, Fred W; Atares, Begoña; Juste, Ramón; Rodriguez-Martínez, Ana Belén; López de Munain, Adolfo
2010-08-01
Gerstmann-Sträussler-Scheinker (GSS) disease is a prion disease associated with prion protein gene (PRNP) mutations. We report a novel PRNP mutation (Y218N) associated with GSS disease in a pathologically confirmed case and in two other affected family members. The clinical features of these cases met criteria for possible Alzheimer disease and possible frontotemporal dementia. Neuropathologic analysis revealed deposition of proteinase K-resistant prion protein (PrP(res)), widespread hyperphosphorylated tau pathology, abnormal accumulation of mitochondria in the vicinity of PrP deposits, and expression of mutant ubiquitin (UBB(+1)) in neurofibrillary tangles and dystrophic neurites. Prion protein immunoblotting using 3F4 and 1E4 antibodies disclosed multiple bands ranging from approximately 20 kd to 80 kd and lower bands of 15 kd and approximately 10 kd, the latter only seen after a long incubation. These bands were partially resistant to proteinase K pretreatment. This pattern differs from those seen in Creutzfeldt-Jakob disease andresembles those reported in other GSS cases. The approximately 10kd band was recognized with anti-PrP C-terminus antibodies but not with anti-N terminus antibodies, suggesting PrP truncation at the N terminal. This new mutation extends the list of known mutations responsible for GSS disease and reinforces its clinical heterogeneity. Genetic examination of the PRNP gene should be included in the workup of patients with poorly classifiable dementia.
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
International Nuclear Information System (INIS)
Pawlik, G.; Heiss, W.D.; Beil, C.; Gruenewald, G.; Herholz, K.; Wienhard, K.; Wagner, R.
1987-01-01
Eight healthy male volunteers and eight moderately aphasic patients with a single cerebral infarctions in the postacute stage, were studied by dynamic positron emission tomography (PET) using the 2(18F)-fluoro-2-deoxy-D-glucose method and a 7-slice positron camera. Because hemispheric speech dominance is commonly thought to be closely related to handedness, subjects were tested by the Oldfield and Bryden questionnaires; the volunteers also had a tracking and pin-sort test. PET studies were performed in random order, both at rest and during spontaneous speech of rather abstract and some biographic content, with a time interval of 2 to 7 days between measurements of the same individual. Data was analyzed by means of weighted, repeated measures of analysis of variance (ANOVA). 11 refs.; 2 figs
49 CFR 571.218 - Standard No. 218; Motorcycle helmets.
2010-10-01
...), and exhibit no resonant frequencies below 2,000 Hz. S7.1.6 The monorail drop test system is used for... assembly weight for the monorail system is the drop assembly weight minus the combined weight of the test... axes of the test headform assembly on a monorail drop test equipment are oriented as follows: From the...
International Nuclear Information System (INIS)
1987-01-01
1 - Description of test facility: PHEBUS test facility operated at CEA Research Center Cadarache consists of a pressurized circuit involving pumps, heat exchangers and a blowdown tank - 25 nuclear fuel rod bundle, coupled to a separate driver core; - active length 0.8 m, cosine axial power profile; - pressurized and un-pressurized fuel rods; - controlled cooling conditions at the bundle inlet (blowdown, refill and reflood period); - de-pressurized test rig volume 0.22 m 3 . The following 'as measured' boundary conditions (B.C.) were offered to participants as options with decreasing challenge to their analytical approach: Boundary conditions B.C.0: - full thermal-hydraulic analysis of PHEBUS test rig (was not recommended). Boundary conditions B.C.1: - thermal power level of fuel bundle; - fluid inlet conditions to bundle section. Boundary conditions B.C.2: - local cladding temperatures of rods; - heat transfer coefficients. Boundary conditions B.C.3: - cladding temperatures of rods; - internal pressure of rods. 2 - Description of test: Post-test investigation into the response of a nuclear fuel bundle to a large break loss of coolant accident with respect to - local fuel temperatures, - cladding strain at the time of burst, - time to burst and under given thermal-hydraulic boundary conditions of PHEBUS-test 218
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
Barthlott, Sabine; Schneider, Matthias; Hase, Frank; Blumenstock, Thomas; Kiel, Matthäus; Dubravica, Darko; García, Omaira E.; Sepúlveda, Eliezer; Mengistu Tsidu, Gizaw; Takele Kenea, Samuel; Grutter, Michel; Plaza-Medina, Eddy F.; Stremme, Wolfgang; Strong, Kim; Weaver, Dan; Palm, Mathias; Warneke, Thorsten; Notholt, Justus; Mahieu, Emmanuel; Servais, Christian; Jones, Nicholas; Griffith, David W. T.; Smale, Dan; Robinson, John
2017-01-01
We report on the ground-based FTIR (Fourier transform infrared) tropospheric water vapour isotopologue remote sensing data that have been recently made available via the database of NDACC (Network for the Detection of Atmospheric Composition Change; MUSICA/" target="_blank">ftp://ftp.cpc.ncep.noaa.gov/ndacc/MUSICA/) and via doi:10.5281/zenodo.48902. Currently, data are available for 12 globally distributed stations. They have been centrally retrieved and quality-filtered in the framework of the MUSICA project (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water). We explain particularities of retrieving the water vapour isotopologue state (vertical distribution of H216O, H218O, and HD16O) and reveal the need for a new metadata template for archiving FTIR isotopologue data. We describe the format of different data components and give recommendations for correct data usage. Data are provided as two data types. The first type is best-suited for tropospheric water vapour distribution studies disregarding different isotopologues (comparison with radiosonde data, analyses of water vapour variability and trends, etc.). The second type is needed for analysing moisture pathways by means of H2O, δD-pair distributions.
Miften, Moyed; Olch, Arthur; Mihailidis, Dimitris; Moran, Jean; Pawlicki, Todd; Molineu, Andrea; Li, Harold; Wijesooriya, Krishni; Shi, Jie; Xia, Ping; Papanikolaou, Nikos; Low, Daniel A
2018-04-01
Patient-specific IMRT QA measurements are important components of processes designed to identify discrepancies between calculated and delivered radiation doses. Discrepancy tolerance limits are neither well defined nor consistently applied across centers. The AAPM TG-218 report provides a comprehensive review aimed at improving the understanding and consistency of these processes as well as recommendations for methodologies and tolerance limits in patient-specific IMRT QA. The performance of the dose difference/distance-to-agreement (DTA) and γ dose distribution comparison metrics are investigated. Measurement methods are reviewed and followed by a discussion of the pros and cons of each. Methodologies for absolute dose verification are discussed and new IMRT QA verification tools are presented. Literature on the expected or achievable agreement between measurements and calculations for different types of planning and delivery systems are reviewed and analyzed. Tests of vendor implementations of the γ verification algorithm employing benchmark cases are presented. Operational shortcomings that can reduce the γ tool accuracy and subsequent effectiveness for IMRT QA are described. Practical considerations including spatial resolution, normalization, dose threshold, and data interpretation are discussed. Published data on IMRT QA and the clinical experience of the group members are used to develop guidelines and recommendations on tolerance and action limits for IMRT QA. Steps to check failed IMRT QA plans are outlined. Recommendations on delivery methods, data interpretation, dose normalization, the use of γ analysis routines and choice of tolerance limits for IMRT QA are made with focus on detecting differences between calculated and measured doses via the use of robust analysis methods and an in-depth understanding of IMRT verification metrics. The recommendations are intended to improve the IMRT QA process and establish consistent, and comparable IMRT QA
Directory of Open Access Journals (Sweden)
Jiayi Huang
2014-01-01
Full Text Available Background. To determine the optimal timing and analytic method of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography (PET imaging during fractionated radiotherapy (RT to predict tumor control. Methods. Ten head neck squamous cell carcinoma xenografts derived from the UT-14-SCC cell line were irradiated with 50 Gy at 2 Gy per day over 5 weeks. Dynamic PET scans were acquired over 70 minutes at baseline (week 0 and weekly for seven weeks. PET data were analyzed using standard uptake value (SUV, retention index (RI, sensitivity factor (SF, and kinetic index (Ki. Results. Four xenografts had local failure (LF and 6 had local control. Eighty scans from week 0 to week 7 were analyzed. RI and SF after 10 Gy appeared to be the optimal predictors for LF. In contrast, SUV and Ki during RT were not significant predictors for LF. Conclusion. RI and SF of PET obtained after the first week of fractionated RT were the optimal methods and timing to predict tumor control.
DEFF Research Database (Denmark)
Fode, Mette Marie; Bak-Fredslund, Kirstine; Petersen, Jørgen Baltzer
2017-01-01
BACKGROUND AND PURPOSE: The galactose analog 2-[18F]fluoro-2-deoxy-d-galactose (FDGal) is used for quantification of regional hepatic metabolic capacity by functional positron emission tomography computerized tomography (PET/CT). In the present study, FDGal PET/CT was used for functional treatment...... planning (FTP) of stereotactic body radiotherapy (SBRT) of liver metastases with the aim of minimizing radiation dose to the best functioning liver tissue. MATERIAL AND METHODS: Fourteen patients referred for SBRT had FDGal PET/CT performed before and one month after the treatment. The planning CT...... and the FDGal PET/CT images were deformable co-registered. RESULTS: A reduction in the mean dose of approximately 2 Gy to the best functioning sub-volumes was obtained. One patient developed grade 2 acute morbidity and no patients experienced grade 3 or higher acute morbidities. The regional hepatic metabolic...
2013-01-01
A 77-year-old man who had undergone mitral valve replacement 5 years previously presented with an intrapericardial mass. Computed tomography and magnetic resonance imaging showed that the mass lesion contained hematoma components. Positron-emission tomography (PET) with 2-[18 F] fluoro-2-deoxy-d-glucose (FDG) revealed uptake in the peripheral rim of the mass. These findings suggested the presence of hematoma associated with a malignant lesion. Surgical resection was performed, and the histological diagnosis was chronic expanding intrapericardial hematoma without neoplastic changes. Chronic expanding intrapericardial hematoma is a rare disease but should be considered when an expanding mass is found in a patient after cardiac surgery. The FDG-PET findings of chronic expanding hematomas, including FDG uptake in the peripheral rim of the mass as a result of inflammation, should be recognized as a potential interpretive pitfall that mimics a malignant tumor. PMID:23324446
Directory of Open Access Journals (Sweden)
Worobiec Elżbieta
2016-12-01
Full Text Available During a palynological analysis of four samples from the Bełchatów KRAM-P 218 collection of plant macroremains 95 fossil species of sporomorphs were identified. Among the non-pollen palynomorphs was the fossil species Desmidiaceaesporites cosmarioformis, previously not reported from fossil floras of Poland, most probably related to the zygospores of desmids. The pollen analysis indicates the presence of a freshwater body (probably an oxbow lake and shows the dominant role of wetland, predominantly riparian vegetation, at the time of sedimentation. The riparian forests probably consisted of Carya, Pterocarya, Celtis, and Ulmus, accompanied by Alnus, Acer, Fraxinus, Juglans, Liquidambar, Vitis, Zelkova, and Salix. In mixed forests there probably were Fagus, Quercus, Carpinus, Eucommia, Corylus, Tilioideae, and conifers, as well as some thermophilous taxa (e.g. Castanea, Symplocos, Reevesia, Mastixiaceae, and plants producing pollen of the fossil species Tricolporopollenites pseudocingulum. Taxodium, Nyssa, and presumably Glyptostrobus and Alnus were components of swamp communities that might have overgrown the adjacent area with higher groundwater. Members of the families Ericaceae, Cyrillaceae, and Clethraceae, as well as Myrica and probably also Ilex, may have been components of swamp forests and bush swamps. Our analysis indicates that the climate was warm temperate and moderately wet. The palynoflora is most similar in composition to the spore-pollen spectra of the X climatic phase - the Nyssapollenites spore-pollen zone. Deposits bearing assemblages of the Nyssapollenites spore-pollen zone were deposited during the Sarmatian and early Pannonian. Our results are consistent with those from plant macroremains from the same collection.
African Journals Online (AJOL)
boaz
The strategy group reviewed and approved all of the teams work and needed resources. ... de cas/ Contrôle de l'infection, 3) la mobilisation sociale, 4) Les Services de laboratoire, 5) le point d'entrée et 6) Gestion / ... molecular evidence for adaptation during human to ... respond to malaria treatment and his travel from an.
African Journals Online (AJOL)
boaz
1) Epidemiology/ Surveillance, 2) Case Management/ Infection Control, 3) Social mobilization, 4) Laboratory ... The strategy group reviewed and approved all of the teams work and needed .... accountability measures and success of the polio.
Directory of Open Access Journals (Sweden)
Marc D. Piroth
2013-09-01
Full Text Available Monitoring of radiochemotherapy (RCX in patients with glioblastoma is difficult because unspecific alterations in magnetic resonance imaging with contrast enhancement can mimic tumor progression. Changes in tumor to brain ratios (TBRs in positron emission tomography (PET using O-(2-[18F]fluoroethyl-L-tyrosine (18F-FET after RCX with temozolomide of patients with glioblastoma have been shown to be valuable parameters to predict survival. The kinetic behavior of 18F-FET in the tumors is another promising parameter to analyze tumor metabolism. In this study, we investigated the predictive value of dynamic 18F-FET PET during RCX of glioblastoma. Time-activity curves (TACs of 18F-FET uptake of 25 patients with glioblastoma were evaluated after surgery (FET-1, early (7–10 days after completion of RCX (FET-2, and 6 to 8 weeks later (FET-3. Changes in the time to peak (TTP and the slope of the TAC (10–50 minutes postinjection were analyzed and related to survival. Changes in kinetic parameters of 18F-FET uptake after RCX showed no relationship with survival time. In contrast, the high predictive value of changes of TBR to predict survival was confirmed. We conclude that dynamic 18F-FET PET does not provide additional prognostic information during RCX. Static 18F-FET PET imaging (20–40 minutes postinjection appears to be sufficient for this purpose and reduces costs.
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
Grimes, Carley A; Wright, Jacqueline D; Liu, Kiang; Nowson, Caryl A; Loria, Catherine M
2013-07-01
Increasing dietary sodium drives the thirst response. Because sugar-sweetened beverages (SSBs) are frequently consumed by children, sodium intake may drive greater consumption of SSBs and contribute to obesity risk. We examined the association between dietary sodium, total fluid, and SSB consumption in a nationally representative sample of US children and adolescents aged 2-18 y. We analyzed cross-sectional data from NHANES 2005-2008. Dietary sodium, fluid, and SSB intakes were assessed with a 24-h dietary recall. Multiple regression analysis was used to assess associations between sodium, fluid, and SSBs adjusted for age, sex, race-ethnic group, body mass index (BMI), socioeconomic status (SES), and energy intake. Of 6400 participants, 51.3% (n = 3230) were males, and the average (±SEM) age was 10.1 ± 0.1 y. The average sodium intake was 3056 ± 48 mg/d (equivalent to 7.8 ± 0.1 g salt/d). Dietary sodium intake was positively associated with fluid consumption (r = 0.42, P sodium is positively associated with fluid consumption and predicted SSB consumption in consumers of SSBs. The high dietary sodium intake of US children and adolescents may contribute to a greater consumption of SSBs, identifying a possible link between dietary sodium intake and excess energy intake.
Zhu, Yanbo; Wang, Qi; Pang, Guoming; Lin, Lin; Origasa, Hideki; Wang, Yangyang; Di, Jie; Shi, Mai; Fan, Chunpok; Shi, Huimei
2015-01-01
There was no consistent recognition of the association between high or low body mass index (BMI) and health related quality of life (HRQL). The aim of this research was to study the association between BMI and HRQL in Chinese adults, and to further explore the stability of that association in the subgroup analysis stratified by status of chronic conditions. A total of 21,218 adults aged 18 and older were classified as underweight, normal weight, overweight, class I obese, and class II obese based on their BMI. HRQL was measured by the SF-36 Health Survey. The independent impact of each BMI category on HRQL was examined through standard least squares regression by comparing the difference of SF-36 scores and the minimum clinically important differences (MCID), which was defined as 3 points. Compared to the normal weight, the class I obese was significantly associated with better HRQL scores in the mental component summary (MCS) (75.1 vs. 73.4, Pobese (D=-3.43) and the general health for the underweight (D=-3.71). Stratified analyses showed a similar result in the health subjects and chronic conditions, and it was significant in the chronic conditions. The class I obese showed the best HRQL, especially in the mental domain. The worst HRQL was found in the underweight. The class II obese reduced HRQL in the physical functioning only. "Obesity paradox" was more obvious in the participants with chronic conditions.
Aluminum Lithium Alloy 2195 Fusion Welding Improvements with New Filler Wire
Russell, C.
2001-01-01
The objective of this research was to assess the B218 weld filler wire for Super Lightweight External Tank production, which could improve current production welding and repair productivity. We took the following approaches: (1) Perform a repair weld quick look evaluation between 4043/B218 and B218/B218 weld filler wire combinations and evaluation tensile properties for planished and unplanished conditions; and (2) Perform repair weld evaluation on structural simulation panel using 4043-B218 and B218/B218 weld filler wire combinations and evaluation tensile and simulated service fracture properties for planished and unplanished conditions.
Chang, Chin-Chuan; Tu, Hung-Pin; Chen, Yu-Wen; Lin, Chia-Yang; Hou, Ming-Feng
2014-12-01
To examine correlations between the uptake of 2-deoxy-2-[18F]fluoro-D-glucose (FDG) by primary tumours and axillary lymph nodes, and clinical and biological tumour prognostic parameters, in patients with newly diagnosed breast cancer. Newly diagnosed breast cancer patients who had received a dual-phased FDG positron emission tomography/computed tomography scan for pretreatment staging were enrolled retrospectively. Maximal standardized uptake values at 1 h (SUV1), 2 h (SUV2), and retention indices (RI) of the tumours and ipsilateral axillary lymph nodes were measured. SUV and RI were compared with clinical and biological prognostic parameters. A total of 32 patients participated in the study. Tumour FDG uptake correlated with histological grade and tumour size. FDG uptake in axillary lymph nodes correlated positively with lymph node status, metastasis status and clinical stage. RI values for the tumour and lymph nodes were significantly positively correlated with human epidermal growth factor receptor-2 positivity. FDG uptake in tumours and lymph nodes showed correlations with some clinical and biological parameters, and may serve as a predictive marker of tumour biological behaviour in breast cancer. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.
The Non-Destructive Determination of Burn-Up by Means of the Prl44 2.18 M Gamma Activity
International Nuclear Information System (INIS)
Forsyth, R.S.; Blackadder, W.H.
1965-05-01
In recent years, gamma scanning has been used at several establishments for the determination of the burn-up profile along irradiated fuel elements, the 0.75 MeV gamma from Zr-95/Nb-95 being most often employed as the monitored radiation. Difficulties in establishing the geometry and the self-absorption of the gamma activity in the fuel have tended to prevent the application of the method to quantitative burn-up determination, which has usually been carried out by dissolution of selected portions of the fuel followed by conventional fission product separation or by uranium depletion methods. The present paper describes experiments carried out to calibrate a gamma scanner for quantitative measurements by counting the 2.18 MeV gamma activity due to Pr-144, the short-lived daughter of Ce-144 (t 1/2 = 285 days) from selected pellets in several UO 2 fuel specimens. Accurate burn-up values were then determined by dissolution and application of the isotopic dilution method, using stable molybdenum fission products. The elements, which were rotated about their longitudinal axes to minimize asymmetry effects, were viewed by a sodium iodide crystal and a multichannel analyser through a suitable collimator. Correction for attenuation of the gamma activity (much less than for 0.75 MeV) in the fuel elements which were of different diameters (12.6 to 15.04 mm) was made by applying relative attenuation factors and the effective geometry factor of the instrument was determined. In order to check the corrections applied, the counter factor was also calculated, for the 0.75 MeV activity from Zr-95/Nb-95 and in certain cases for the 0.66 MeV activity from Cs-137. The results obtained, demonstrate that at least over the range of diameters and cooling times used the method is suitable for quantitative determinations. Preliminary experiments to explore the possibility of using the high energy gammas (2.35, 2.65 MeV) from Rh-106 as a method for estimating the fraction of fission events
Area 3 Support Buildings (A3SB) H5-0992, H5-0996 PRL 218 Confirmatory Sampling Report
Mrdjenovich, Timothy
2015-01-01
The Area 3 Support Buildings site (A3SB) consists of two separate areas located on the north side of Beach Road in the northern portion of Kennedy Space Center, Florida (KSC), outside the secured perimeter of KSC. The A3SB areas are approximately 0.6 miles apart, and were developed as Shiffler's Grocery Store and Service Station (west site) and as a residence (east site) prior to acquisition by the National Aeronautics and Space Administration (NASA) in 1963. Both areas were used by the Bendix Company in support of NASA as chemical laboratories from 1963 through 1969. Both of the buildings were demolished by 1987. The west portion of the site was used by the US Fish & Wildlife Service (F&W) in support of the Merritt Island National Wildlife Refuge (MINWR) for parking at the entrance to the Hammock Trails from 1969 to the present. The east portion of the site was used for intermittent suspect materials staging in the early 1990s and is still used as an apiary location, but is otherwise no longer active. In support of the NASA HSWA permit requirements, this site was identified as Potential Release Location (PRL) 218 and a Solid Waste Management Unit (SWMU) Assessment (SA) was conducted in 2013. Confirmatory Sampling (CS) was recommended and approved by the KSC Remediation Team (KSCRT). Three locations of concern (LOCs) were identified and sampled at the site. The LOCs include two former chemical labs and a former suspect staging area. The CS was conducted in March of 2015 at three locations by means of Direct Push Technology (DPT) groundwater sampling and at one location for soil sampling. The samples were collected and analyzed in accordance with the approved CS Work Plan. There were no exceedances of criteria detected in any of the samples from the three LOCs. The results of this investigation indicate that past and/or present operations have not negatively impacted environmental media at the A3SB. Based upon no confirmed groundwater detections above GCTLs and no
SU-E-T-96: An Analysis of VMAT SBRT Lung Treatment Plans
Energy Technology Data Exchange (ETDEWEB)
Wilson, D; James, J; Wang, B; Dunlap, N; Woo, S; Silverman, C; Dragun, A; El-Ghamry, M [Univ Louisville, Louisville, KY (United States)
2015-06-15
Purpose: To present an analysis of 218 lung sbrt treatment plans delivered using Varian Eclipse RapidArc software and delivered with Varian linear accelerators. Methods: A retrospective analysis of treatment plans generated using the Varian Eclipse PRO RapidArc VMAT optimization and AAA photon beam calculation algorithms was done for 218 plans delivered using Varian Trilogy and TrueBeam linear accelerators. Some of the patients were enrolled in the RTOG 0813 and RTOG 0915 lung protocols. All of the patients’ plans were optimized using the guidelines outlined by these protocols. The plans presented were normalized so that 95% of the PTV volume received 100% of the prescribed dose. Results: The dose co formality constraints from the RTOG protocols and the number of plans within those constraints were:Tumor dose between 60% of maximum dose and 90% of maximum: 218/218 = 100%.Volume of 105% tumor dose outside put less than 15% of the PTV volume: 218/218 = 100%.Maximum dose 2 cm away from PTV within protocol table guidelines: No minor deviation: 188/218 = 86.2%. No major deviation: 216/218 = 99.1%.Ratio of 50% dose volume to PTV volume less than R50 in protocol table: No minor deviation 148/218 = 67.9%. No major deviation: 213/218 = 97.7%.Percent of lung receiving 20 Gy less than 10% (no minor violation): 218/218 = 100%.99% of PTV receiving at least 90% of the tumor dose: 214/218 = 98.2%. Conclusion: Varian RapidArc VMAT can successfully deliver lung SBRT treatments as outlined in the RTOG 0813 and 0915 protocols. The largest deviations were seen in the R50 constraints for the larger PTV volumes.
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
Heinzel, Alexander; Müller, Dirk; Yekta-Michael, Sareh Said; Ceccon, Garry; Langen, Karl-Josef; Mottaghy, Felix M; Wiesmann, Martin; Kocher, Martin; Hattingen, Elke; Galldiks, Norbert
2017-09-01
Conventional MRI is the standard method to diagnose recurrence of brain metastases after radiation. However, following radiation therapy, reactive transient blood-brain barrier alterations with consecutive contrast enhancement can mimic brain metastasis recurrence. Recent studies have suggested that O-(2-18F-fluoroethyl)-L-tyrosine (FET) PET improves the correct differentiation of brain metastasis recurrence from radiation injury. Based on published evidence and clinical expert opinion, we analyzed effectiveness and cost-effectiveness of the use of FET PET in addition to MRI compared with MRI alone for the diagnosis of recurrent brain metastases. A decision-tree model was designed to compare the 2 diagnostic strategies from the perspective of the German Statutory Health Insurance (SHI) system. Effectiveness was defined as correct diagnosis of recurrent brain metastasis and was compared between FET PET with MRI and MRI alone. Costs were calculated for a baseline scenario and for a more expensive scenario. Robustness of the results was tested using sensitivity analyses. Compared with MRI alone, FET PET in combination with MRI increases the rate of correct diagnoses by 42% (number needed to diagnose of 3) with an incremental cost-effectiveness ratio of €2821 (baseline scenario) and €4014 (more expensive scenario) per correct diagnosis. The sensitivity analyses confirmed the robustness of the results. The model suggests that the additional use of FET PET with conventional MRI for the diagnosis of recurrent brain metastases may be cost-effective. Integration of FET PET has the potential to avoid overtreatment with corresponding costs as well as unnecessary side effects. © The Author(s) 2017. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com
Directory of Open Access Journals (Sweden)
Tuomas O Kilpeläinen
2011-11-01
Full Text Available The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166 and nine studies of children and adolescents (n = 19,268.All studies identified to have data on the FTO rs9939609 variant (or any proxy [r(2>0.8] and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A- allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20-1.26, but PA attenuated this effect (p(interaction = 0.001. More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio = 1.22/allele, 95% CI 1.19-1.25 than in the inactive group (odds ratio = 1.30/allele, 95% CI 1.24-1.36. No such interaction was found in children and adolescents.The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity.
Galldiks, Norbert; Stoffels, Gabriele; Filss, Christian; Rapp, Marion; Blau, Tobias; Tscherpel, Caroline; Ceccon, Garry; Dunkl, Veronika; Weinzierl, Martin; Stoffel, Michael; Sabel, Michael; Fink, Gereon R; Shah, Nadim J; Langen, Karl-Josef
2015-09-01
We evaluated the diagnostic value of static and dynamic O-(2-[(18)F]fluoroethyl)-L-tyrosine ((18)F-FET) PET parameters in patients with progressive or recurrent glioma. We retrospectively analyzed 132 dynamic (18)F-FET PET and conventional MRI scans of 124 glioma patients (primary World Health Organization grade II, n = 55; grade III, n = 19; grade IV, n = 50; mean age, 52 ± 14 y). Patients had been referred for PET assessment with clinical signs and/or MRI findings suggestive of tumor progression or recurrence based on Response Assessment in Neuro-Oncology criteria. Maximum and mean tumor/brain ratios of (18)F-FET uptake were determined (20-40 min post-injection) as well as tracer uptake kinetics (ie, time to peak and patterns of the time-activity curves). Diagnoses were confirmed histologically (95%) or by clinical follow-up (5%). Diagnostic accuracies of PET and MR parameters for the detection of tumor progression or recurrence were evaluated by receiver operating characteristic analyses/chi-square test. Tumor progression or recurrence could be diagnosed in 121 of 132 cases (92%). MRI and (18)F-FET PET findings were concordant in 84% and discordant in 16%. Compared with the diagnostic accuracy of conventional MRI to diagnose tumor progression or recurrence (85%), a higher accuracy (93%) was achieved by (18)F-FET PET when a mean tumor/brain ratio ≥2.0 or time to peak dynamic (18)F-FET PET parameters differentiate progressive or recurrent glioma from treatment-related nonneoplastic changes with higher accuracy than conventional MRI. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Welty-Bernard, A. T.; Schwartz, E.
2014-12-01
Recent studies have established consistent relationships between pH and bacterial diversity and community structure in soils from site-specific to landscape scales. However, these studies rely on DNA or PLFA extraction techniques from bulk soils that encompass metabolically active and inactive, or dormant, communities, and loose DNA. Dormant cells may comprise up to 80% of total live cells. If dormant cells dominate a particular environment, it is possible that previous interpretations of the soil variables assumed to drive communities could be profoundly affected. We used H218O stable isotope probing and bar-coded illumina sequencing of 16S rRNA genes to monitor the response of actively growing communities to changes in soil pH in a soil microcosm over 14 days. This substrate-independent approach has several advantages over 13C or 15N-labelled molecules in that all growing bacteria should be able to make use of water, allowing characterization of whole communities. We hypothesized that Acidobacteria would increasingly dominate the growing community and that Actinobacteria and Bacteroidetes would decline, given previously established responses by these taxa to soil pH. Instead, we observed the reverse. Actinobacteria abundance increased three-fold from 26 to 76% of the overall community as soil pH fell from pH 5.6 to pH 4.6. Shifts in community structure and decreases in diversity with declining soil pH were essentially driven by two families, Streptomyceaca and Microbacteracea, which collectively increased from 2 to 40% of the entire community. In contrast, Acidobacteria as a whole declined although numbers of subdivision 1 remained stable across all soil pH levels. We suggest that the brief incubation period in this SIP study selected for growth of acid-tolerant Actinobacteria over Acidobacteria. Taxa within Actinomycetales have been readily cultured over short time frames, suggesting rapid growth patterns. Conversely, taxa within Acidobacteria have been
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
Directory of Open Access Journals (Sweden)
Yanbo Zhu
Full Text Available There was no consistent recognition of the association between high or low body mass index (BMI and health related quality of life (HRQL. The aim of this research was to study the association between BMI and HRQL in Chinese adults, and to further explore the stability of that association in the subgroup analysis stratified by status of chronic conditions.A total of 21,218 adults aged 18 and older were classified as underweight, normal weight, overweight, class I obese, and class II obese based on their BMI. HRQL was measured by the SF-36 Health Survey. The independent impact of each BMI category on HRQL was examined through standard least squares regression by comparing the difference of SF-36 scores and the minimum clinically important differences (MCID, which was defined as 3 points.Compared to the normal weight, the class I obese was significantly associated with better HRQL scores in the mental component summary (MCS (75.1 vs. 73.4, P<0.001. The underweight had the lowest score in both the physical components summary (PCS (75.4 vs. 77.5, P<0.001 and mental components summary (MCS (71.8 vs. 73.4, P<0.001. For the MCID, the HRQL score was reduced by more than 3 points in the physical functioning for the class II obese (D=-3.43 and the general health for the underweight (D=-3.71. Stratified analyses showed a similar result in the health subjects and chronic conditions, and it was significant in the chronic conditions.The class I obese showed the best HRQL, especially in the mental domain. The worst HRQL was found in the underweight. The class II obese reduced HRQL in the physical functioning only. "Obesity paradox" was more obvious in the participants with chronic conditions.
The Non-Destructive Determination of Burn-Up by Means of the Pr{sup l44} 2.18 M Gamma Activity
Energy Technology Data Exchange (ETDEWEB)
Forsyth, R S; Blackadder, W H
1965-05-15
In recent years, gamma scanning has been used at several establishments for the determination of the burn-up profile along irradiated fuel elements, the 0.75 MeV gamma from Zr-95/Nb-95 being most often employed as the monitored radiation. Difficulties in establishing the geometry and the self-absorption of the gamma activity in the fuel have tended to prevent the application of the method to quantitative burn-up determination, which has usually been carried out by dissolution of selected portions of the fuel followed by conventional fission product separation or by uranium depletion methods. The present paper describes experiments carried out to calibrate a gamma scanner for quantitative measurements by counting the 2.18 MeV gamma activity due to Pr-144, the short-lived daughter of Ce-144 (t{sub 1/2} = 285 days) from selected pellets in several UO{sub 2} fuel specimens. Accurate burn-up values were then determined by dissolution and application of the isotopic dilution method, using stable molybdenum fission products. The elements, which were rotated about their longitudinal axes to minimize asymmetry effects, were viewed by a sodium iodide crystal and a multichannel analyser through a suitable collimator. Correction for attenuation of the gamma activity (much less than for 0.75 MeV) in the fuel elements which were of different diameters (12.6 to 15.04 mm) was made by applying relative attenuation factors and the effective geometry factor of the instrument was determined. In order to check the corrections applied, the counter factor was also calculated, for the 0.75 MeV activity from Zr-95/Nb-95 and in certain cases for the 0.66 MeV activity from Cs-137. The results obtained, demonstrate that at least over the range of diameters and cooling times used the method is suitable for quantitative determinations. Preliminary experiments to explore the possibility of using the high energy gammas (2.35, 2.65 MeV) from Rh-106 as a method for estimating the fraction of
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
International Nuclear Information System (INIS)
Kwon, S.H.; Kang, D.R.; Kim, J.; Yoon, J.-K.; Lee, S.J.; Jeong, S.H.; Lee, H.W.; An, Y.-S.
2016-01-01
Aim: To assess the prognostic value of negative interim combined 2-["1"8F]-fluoro-2-deoxy-D-glucose ("1"8F-FDG) positron-emission tomography/computed tomography (PET/CT) in patients with diffuse large B-cell lymphoma (DLBCL). Materials and methods: Ninety-two patients with histologically proven DLBCL were enrolled. All of the patients underwent "1"8F-FDG PET/CT at diagnosis, and interim PET/CT after the second cycle of chemotherapy with rituximab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisolone (R-CHOP). Negative interim PET/CT was defined as the disappearance of all abnormal "1"8F-FDG uptake compared to the pretreatment PET/CT image, as determined by visual assessment. The clinical outcome of patients was estimated as progression-free survival (PFS), and the prognostic significance of clinicopathological and imaging parameters were assessed using the Cox proportional hazards model. Results: Thirty-six patients (39.1%) showed lymphoma progression within a median follow-up of 30.8 months. According to univariate analysis, Ann Arbor stage, serum lactate dehydrogenase level, Eastern Cooperative Oncology Group scale, International Prognostic Index (IPI) score, and maximum standardised uptake values on initial PET/CT were significant prognostic factors for PFS (all p<0.05). Among these parameters, only the IPI score was an independent predictor for PFS (p=0.044). Survival of patients with a high IPI score (≥3) was poorer than those with a low IPI score (0–2; p<0.001). Conclusion: Despite a negative interim "1"8F-FDG PET/CT, approximately 39% of DLBCL patients showed progression during follow-up. Although the negative PET/CT was obtained during chemotherapy, it is important to closely follow-up patients, especially those with a high IPI score. - Highlights: • About 39% of patients showed progression after negative interim PET/CT. • The IPI score was an independent predictor for PFS. • It is important to closely follow-up with high IPI score
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
2010-04-01
...) United States (b) As used in this part, (1) Agency means the Department of State, the U.S. International..., university, or other postsecondary institution, or a public system of higher education; or (B) A local educational agency (as defined in 20 U.S.C. 7801), system of vocational education, or other school system...
2010-10-01
.... Group of workers means two or more workers of the same or different crafts assigned to work together as... assigned such work on railroad rolling equipment that is not part of the train or yard movement they have... which the testing, servicing, repair, inspection, or rebuilding of railroad rolling equipment is under...
2010-10-01
... to avoid a collision with any marine animal and can be stopped within a distance appropriate to the... for marine mammals and shall report any sightings to the surface observers. These animals shall be... and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...
2010-10-01
... within the command structure in order to facilitate implementation of mitigation measures if marine... attention to the things on the outer edges of their field of vision. (viii) Marine observers shall be...
2010-10-01
... species mitigation measures. (B) Commanding Officers shall make use of marine species detection cues and... entire target area shall take place with “Big Eyes” and the naked eye during the retrieval of the IMPASS...
2010-01-01
... necessary for implementation of the obligations of the United States under chapters III and IV of the IEP that relate to the mandatory international allocation of oil by IEP participating countries. (b) Any...
2010-01-01
... International Energy Agency established to implement the IEP. IEP means the International Energy Program... that the President determines allocation of petroleum products to nations participating in the IEP is required by chapters III and IV of the IEP and (b) ending on a date on which he determines such allocation...
2010-10-01
... Anchoring drills and the Shipboard Electronic System Evaluation Facility range that necessarily operate at... night vision devices available for use. (ii) Operating Procedures & Collision Avoidance: (A) Prior to... create an imminent and serious threat to a person, vessel, or aircraft, and to the extent vessels are...
2011-05-23
... Home, Inc., New York Corporate Sales Office, working off-site in Illinois, Georgia, Minnesota, Indiana...,218B, TA-W-74,218C, TA-W-74,218D] Westpoint Home, Inc., New York Corporate Sales Office, New York, NY, Including Employees Working Off-Site in Illinois, Georgia, Minnesota, Indiana, North Carolina; Westpoint...
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
International Nuclear Information System (INIS)
Cummins, G.D.
1994-06-01
This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy's (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS
Directory of Open Access Journals (Sweden)
Rosengren Annika
2009-04-01
Full Text Available Abstract Background A number of previous studies have investigated various predictors for being granted a disability pension. The aim of this study was to test the efficacy of sick-leave track record as a predictor of being granted a disability pension in a large dataset based on subjects sampled from the general population and followed for a long time. Methods Data from five ongoing population-based Swedish studies was used, supplemented with data on all compensated sick leave periods, disability pensions granted, and vital status, obtained from official registers. The data set included 8,218 men and women followed for 16 years, generated 109,369 person years of observation and 97,160 sickness spells. Various measures of days of sick leave during follow up were used as independent variables and disability pension grant was used as outcome. Results There was a strong relationship between individual sickness spell duration and annual cumulative days of sick leave on the one hand and being granted a disability pension on the other, among both men and women, after adjustment for the effects of marital status, education, household size, smoking habits, geographical area and calendar time period, a proxy for position in the business cycle. The interval between sickness spells showed a corresponding inverse relationship. Of all the variables studied, the number of days of sick leave per year was the most powerful predictor of a disability pension. For both men and women 245 annual sick leave days were needed to reach a 50% probability of transition to disability. The independent variables, taken together, explained 96% of the variation in disability pension grantings. Conclusion The sick-leave track record was the most important predictor of the probability of being granted a disability pension in this study, even when the influences of other variables affecting the outcome were taken into account.
Huang, Li-Min; Chiu, Nan-Chang; Yeh, Shu-Jen; Bhusal, Chiranjiwi; Arora, Ashwani Kumar
2014-09-08
MenACWY-CRM (Menveo®, Novartis Vaccines, Siena, Italy) is a quadrivalent meningococcal conjugate vaccine developed to help prevent invasive meningococcal disease caused by Neisseria meningitidis serogroups A, C, W, and Y. It is approved within the European Union in persons >2 years of age and in persons from 2 months to 55 years of age in the United States, among other countries. Little is known about the immunogenicity and safety of this vaccine in Taiwanese children >2 years and adolescents. This study assessed the immunogenicity and safety of a single injection of MenACWY-CRM vaccine in Taiwanese subjects aged 2-18 years old. In this phase III, multicentre, open-label study 341 subjects received one dose of MenACWY-CRM. Immunogenicity measures were rates of seroresponse (defined as the proportion of subjects with a postvaccination hSBA ≥1:8 if the prevaccination (baseline) titre was CRM vaccination at Day 29 for the serogroups A, C, W, and Y were 83%, 93%, 50%, and 65%, respectively. At Day 29 the percentages of subjects with hSBA ≥1:8 against all four serogroups A, C, W and Y were: 83%, 96%, 96% and 82%, respectively. GMTs against all serogroups rose by ≥7-fold from baseline to Day 29. The vaccine was well tolerated. A single dose of MenACWY-CRM demonstrated a robust immune response, and an acceptable safety profile in Taiwanese children and adolescents. Copyright © 2014 Elsevier Ltd. All rights reserved.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Directory of Open Access Journals (Sweden)
Melissa Q. McDougall
2016-08-01
Full Text Available We hypothesized that vitamin E (α-tocopherol is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6, the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio defined diets without (E− or with added α-tocopherol (E+, 500 mg RRR-α-tocopheryl acetate/kg diet for a minimum of 80 days, and then spawned them to obtain E− and E+ embryos. The E− compared with E+ embryos were 82% less responsive (p<0.01 to a light/dark stimulus at 96 h post-fertilization (hpf, demonstrating impaired locomotor behavior, even in the absence of gross morphological defects. Evaluation of phospholipid (PL and lysophospholipid (lyso-PL composition using untargeted lipidomics in E− compared with E+ embryos at 24, 48, 72, and 120 hpf showed that four PLs and three lyso-PLs containing docosahexaenoic acid (DHA, including lysophosphatidylcholine (LPC 22:6, required for transport of DHA into the brain, p<0.001, were at lower concentrations in E− at all time-points. Additionally, H218O labeling experiments revealed enhanced turnover of LPC 22:6 (p<0.001 and three other DHA-containing PLs in the E− compared with the E+ embryos, suggesting that increased membrane remodeling is a result of PL depletion. Together, these data indicate that α-tocopherol deficiency in the zebrafish embryo causes the specific depletion and increased turnover of DHA-containing PL and lyso-PLs, which may compromise DHA delivery to the brain and thereby contribute to the functional impairments observed in E− embryos.
Energy Technology Data Exchange (ETDEWEB)
Cummins, G.D.
1994-06-01
This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy`s (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS.
Radon Daughters Background Reduction in Alpha Particles Counting System
International Nuclear Information System (INIS)
Dadon, S. S.; Pelled, O.; Orion, I.
2014-01-01
The ABPC method is using a serially occurring events of the beta decay of the 214Bi fallow by alpha decay of the 214Po that take place almost simultaneously to detect the Pseudo Coincidence Event (PCE) from the RDP, and to subtract them from the gross alpha counts. 267 This work showed that it is possible to improve the efficiency of RDP background reduction, including subtracting the 218Po contribution by using the ABPC method based on a single solid state silicon PIPS detector. False counts percentage obtained at the output of the PCE circuit were smaller than 0.1%. The results show that the PCE circuit was not influenced by non RDP alpha emitters. The PCE system did not reduce the non PCE of the 218Po. After 20 minutes the 218Po was strongly decayed, and its contribution became negligible. In order to overcome this disadvantage, a mathematical matching calculations for the 214Po and the 218Po decay equations were employed, and a constant ratio of the APo214(0) / APo218(0) was obtained. This ratio can be used to estimate the count rate of the 218Po at the first 20 minutes, and to subtract it from the total count rate in order to obtain correct RDP reduction
Chen, Thomas C; Yu, Jiali; Nouri Nigjeh, Eslam; Wang, Weijun; Myint, Phyo Thazin; Zandi, Ebrahim; Hofman, Florence M; Schönthal, Axel H
2017-08-01
The anticancer agent 3-bromopyruvate (3-BP) is viewed as a glycolytic inhibitor that preferentially kills glycolytic cancer cells through energy depletion. However, its cytotoxic activity is dependent on cellular drug import through transmembrane monocarboxylate transporter 1 (MCT-1), which restricts its anticancer potential to MCT-1-positive tumor cells. We created and characterized an MCT-1-independent analog of 3-BP, called NEO218. NEO218 was synthesized by covalently conjugating 3-BP to perillyl alcohol (POH), a natural monoterpene. The responses of various tumor cell lines to treatment with either compound were characterized in the presence or absence of supplemental pyruvate or antioxidants N-acetyl-cysteine (NAC) and glutathione (GSH). Drug effects on glyceraldehyde 3-phosphate dehydrogenase (GAPDH) enzyme activity were investigated by mass spectrometric analysis. The development of 3-BP resistance was investigated in MCT-1-positive HCT116 colon carcinoma cells in vitro. Our results show that NEO218: (i) pyruvylated GAPDH on all 4 of its cysteine residues and shut down enzymatic activity; (ii) severely lowered cellular ATP content below life-sustaining levels, and (iii) triggered rapid necrosis. Intriguingly, supplemental antioxidants effectively prevented cytotoxic activity of NEO218 as well as 3-BP, but supplemental pyruvate powerfully protected cells only from 3-BP, not from NEO218. Unlike 3-BP, NEO218 exerted its potent cytotoxic activity irrespective of cellular MCT-1 status. Treatment of HCT116 cells with 3-BP resulted in prompt development of resistance, based on the emergence of MCT-1-negative cells. This was not the case with NEO218, and highly 3-BP-resistant cells remained exquisitely sensitive to NEO218. Thus, our study identifies a mechanism by which tumor cells develop rapid resistance to 3-BP, and presents NEO218 as a superior agent not subject to this cellular defense. Furthermore, our results offer alternative interpretations of previously
Directory of Open Access Journals (Sweden)
Claes N. Ladefoged
2017-08-01
Full Text Available Aim: Positron emission tomography (PET imaging is a useful tool for assisting in correct differentiation of tumor progression from reactive changes, and the radiolabeled amino acid analog tracer O-(2-18F-fluoroethyl-L-tyrosine (FET-PET is amongst the most frequently used. The FET-PET images need to be quantitatively correct in order to be used clinically, which require accurate attenuation correction (AC in PET/MRI. The aim of this study was to evaluate the use of the subject-specific MR-derived AC method RESOLUTE in post-operative brain tumor patients.Methods: We analyzed 51 post-operative brain tumor patients (68 examinations, 200 MBq [18F]-FET investigated in a PET/MRI scanner. MR-AC maps were acquired using: (1 the Dixon water fat separation sequence, (2 the ultra short echo time (UTE sequences, (3 calculated using our new RESOLUTE methodology, and (4 a same day low-dose CT used as reference “gold standard.” For each subject and each AC method the tumor was delineated by isocontouring tracer uptake above a tumor(T-to-brain background (B activity ratio of 1.6. We measured B, tumor mean and maximal activity (TMEAN, TMAX, biological tumor volume (BTV, and calculated the clinical metrics TMEAN/B and TMAX/B.Results: When using RESOLUTE 5/68 studies did not meet our predefined acceptance criteria of TMAX/B difference to CT-AC < ±0.1 or 5%, TMEAN/B < ±0.05 or 5%, and BTV < ±2 mL or 10%. In total, 46/68 studies failed our acceptance criteria using Dixon, and 26/68 using UTE. The 95% limits of agreement for TMAX/B was for RESOLUTE (−3%; 4%, Dixon (−9%; 16%, and UTE (−7%; 10%. The absolute error when measuring BTV was 0.7 ± 1.9 mL (N.S with RESOLUTE, 5.3 ± 10 mL using Dixon, and 1.7 ± 3.7 mL using UTE. RESOLUTE performed best in the identification of the location of peak activity and in brain tumor follow-up monitoring using clinical FET PET metrics.Conclusions: Overall, we found RESOLUTE to be the AC method that most robustly
49 CFR 218.4 - Preemptive effect.
2010-10-01
... negligence standards apply where there is no Federal action covering the subject matter. Under 49 U.S.C. 20106 (section 20106), issuance of the regulations in this part preempts any State law, regulation, or order covering the same subject matter, except an additional or more stringent law, regulation, or order...
Publications | Page 218 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity ... Use this search tool to locate a specific publication for your field of research. ... Americas, a nonprofit affiliate to the Organization of the American States (OAS). ... algorithm to find optimally effective drug in a drug complex (open access).
Publications | Page 218 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... technologies as well as the characteristics specific to rural communities that will allow ... Towards the development of an Energy-Water-Food Security Nexus based ... Water management challenges in the context of agricultural intensification ...
Directory of Open Access Journals (Sweden)
Juliano Julio Cerci
2009-06-01
Full Text Available BACKGROUND: 2-[18F]-Fluoro-2-Deoxy-D-Glucose (FDG-PET is a well established functional imaging modality for the initial staging of Hodgkin lymphoma (HL in patients from Western Europe and North America. The reliability of FDG-PET in populations of different ethnic groups is unclear, as all investigations published to date have come from developed countries. PURPOSE: The aim of the present study was to investigate the effectiveness of FDG-PET in the initial staging of HL patients in a Brazilian population. METHODS: Eighty-two patients with newly diagnosed HL were prospectively included in the study. All patients were staged with both conventional clinical staging (CCS methods, including computed tomography (CT and whole-body FDG-PET methods. A standard of reference for the nodal regions and the extranodal organs was determined using all available information, including the CCS methods, FDG-PET, the diagnostic histology and the follow-up examinations. The results of the CCS were then compared to the FDG-PET results. RESULTS: The sensitivity of FDG-PET was higher for nodal staging than that of CT (87.8% vs. 61.6%, respectively. FDG-PET was also more sensitive than CT in regard to evaluating the extranodal organs for lymphomatous involvement (96.2% vs. 40.0%, respectively. FDG-PET detected all 16 patients who were characterized by a positive bone marrow biopsy and identified an additional 4 patients with bone marrow disease. The incorporation of FDG-PET coupled with CCS in the staging procedure upstaged 20% (17/82 of the patients and downstaged 11% (9/82 of the patients. As a result of these changes in staging, 15% (13/82 of the patients would have received a different therapeutic regimen. CONCLUSIONS: The FDG-PET method is superior to CT for the detection of nodal and extra-nodal HL. The observation that the FDG-PET method upstaged the disease was the most common result (20% of patients brought about by the addition of PET to the staging algorithm
International Nuclear Information System (INIS)
Arslan, N.; Tuncel, M.; Kuzhan, O.; Alagoz, E.; Budakoglu, B.; Ozet, A.; Ozguven, M.A.
2011-01-01
The objective of this study is to determine whether 2-deoxy-2-[18F] fluoro-D-glucose with positron emission tomography (FDG-PET) imaging and quantitative PET parameters can predict outcome and differentiate patients with limited disease (LD) from extensive disease (ED) in patients with small cell lung cancer (SCLC). We retrospectively evaluated data from 25 patients who underwent either initial staging (Group A, n 12) or restaging (Group B, n 13) by conventional imaging methods and FDG-PET according to the simplified staging scheme developed by the Veterans Administration Lung Cancer Study Group-2. FDG-PET images were both visually and quantitatively evaluated with standardized uptake value (SUV) max , SUV ave , total metabolic tumor volume (with SUV max >%50 and SUV max >2.5), total lesion glycolysis (TLG) (with SUV max >%50 and SUV max >2.5). The correlation between quantitative PET parameters, disease stages and survival were analyzed. By conventional methods 14 of 25 (56%) patients were reported to have LD and 11 of 25 (44%) had ED. FDG-PET scan upstaged 9 out of 25 (36%) and downstaged 2 out of 25 (%8) patients. Among the quantitative PET parameters, TLGs were the only PET parameters that differentiated between Group A and Group B patients. FDG-PET staging (p=0.019) could predict significant survival difference between stages on contrary to conventional staging (p=0.055). Moreover, TLG [SUV max >%50] was the only quantitative PET parameter that could predict survival (p=0.027). FDG-PET imaging is a valuable tool in the management of patients with SCLC for a more accurate staging. The use of quantitative PET parameters may have a role in prediction of stage and survival. (author)
MicroRNA-133 mediates cardiac diseases: Mechanisms and clinical implications
Energy Technology Data Exchange (ETDEWEB)
Liu, Yi; Liang, Yan [Guangdong Key Laboratory for Research and Development of Natural Drugs, Guangdong Medical University, Zhanjiang 524023, Guangdong (China); Zhang, Jin-fang [Department of Orthopaedics and Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Fu, Wei-ming, E-mail: fuweiming76@smu.edu.cn [School of Pharmaceutical Sciences, Southern Medical University, Guangzhou 510515 (China)
2017-05-15
MicroRNAs (miRNAs) belong to the family of small non-coding RNAs that mediate gene expression by post-transcriptional regulation. Increasing evidence have demonstrated that miR-133 is enriched in muscle tissues and myogenic cells, and its aberrant expression could induce the occurrence and development of cardiac disorders, such as cardiac hypertrophy, heart failure, etc. In this review, we summarized the regulatory roles of miR-133 in cardiac disorders and the underlying mechanisms, which suggest that miR-133 may be a potential diagnostic and therapeutic tool for cardiac disorders. - Highlights: • miR-218 is frequently downregulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.
MicroRNA-133 mediates cardiac diseases: Mechanisms and clinical implications
International Nuclear Information System (INIS)
Liu, Yi; Liang, Yan; Zhang, Jin-fang; Fu, Wei-ming
2017-01-01
MicroRNAs (miRNAs) belong to the family of small non-coding RNAs that mediate gene expression by post-transcriptional regulation. Increasing evidence have demonstrated that miR-133 is enriched in muscle tissues and myogenic cells, and its aberrant expression could induce the occurrence and development of cardiac disorders, such as cardiac hypertrophy, heart failure, etc. In this review, we summarized the regulatory roles of miR-133 in cardiac disorders and the underlying mechanisms, which suggest that miR-133 may be a potential diagnostic and therapeutic tool for cardiac disorders. - Highlights: • miR-218 is frequently downregulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
Wang, Fu-Li; Tan, Ye-Ying; Gu, Xiang-Min; Li, Tian-Ran; Lu, Guang-Ming; Liu, Gang; Huo, Tian-Long
2016-01-01
Background: The detection of solitary pulmonary nodules (SPNs) that may potentially develop into a malignant lesion is essential for early clinical interventions. However, grading classification based on computed tomography (CT) imaging results remains a significant challenge. The 2-[18F]-fluoro-2-deoxy-D-glucose (18F-FDG) positron emission tomography (PET)/CT imaging produces both false-positive and false-negative findings for the diagnosis of SPNs. In this study, we compared 18F-FDG and 3-deoxy-3-[18F]-fluorothymidine (18F-FLT) in lung cancer PET/CT imaging. Methods: The binding ratios of the two tracers to A549 lung cancer cells were calculated. The mouse lung cancer model was established (n = 12), and micro-PET/CT analysis using the two tracers was performed. Images using the two tracers were collected from 55 lung cancer patients with SPNs. The correlation among the cell-tracer binding ratios, standardized uptake values (SUVs), and Ki-67 proliferation marker expression were investigated. Results: The cell-tracer binding ratio for the A549 cells using the 18F-FDG was greater than the ratio using 18F-FLT (P < 0.05). The Ki-67 expression showed a significant positive correlation with the 18F-FLT binding ratio (r = 0.824, P < 0.01). The tumor-to-nontumor uptake ratio of 18F-FDG imaging in xenografts was higher than that of 18F-FLT imaging. The diagnostic sensitivity, specificity, and the accuracy of 18F-FDG for lung cancer were 89%, 67%, and 73%, respectively. Moreover, the diagnostic sensitivity, specificity, and the accuracy of 18F-FLT for lung cancer were 71%, 79%, and 76%, respectively. There was an obvious positive correlation between the lung cancer Ki-67 expression and the mean maximum SUV of 18F-FDG and 18F-FLT (r = 0.658, P < 0.05 and r = 0.724, P < 0.01, respectively). Conclusions: The 18F-FDG uptake ratio is higher than that of 18F-FLT in A549 cells at the cellular level. 18F-FLT imaging might be superior for the quantitative diagnosis of lung tumor
VizieR Online Data Catalog: Massive star forming molecular clumps Tkin (Tang+, 2017)
Tang, X. D.; Henkel, C.; Menten, K. M.; Zheng, X. W.; Esimbek, J.; Zhou, J. J.; Yeh, C. C.; Konig, C.; Yuan, Y.; He, Y. X.; Li, D. L.
2016-10-01
We have selected 30 massive clumps of the Galactic disk at various stages of high-mass star formation and with strong NH3 emission from the ATLASGAL survey (see Table 1). Our observations were carried out in 2015 April, July, and October with the 15m James Clerk Maxwell Telescope telescope (JCMT) on Mauna Kea. The beam size is ~23" and the main-beam efficiency is {eta}mb=Ta*/Tmb~=0.7 at 218GHz. The para-H2CO JKAKC =303-202, 322-221, and 321-220 transitions have rest frequencies of 218.222, 218.475, and 218.760GHz, respectively, which are measured simultaneously by employing the ACSIS digital autocorrelation spectrometer with the special backend configuration RxAH2CO250x3 allowing for three windows, each with a bandwidth of 250MHz. This provides a velocity resolution of 0.084km/s for para-H2CO (303-202 and 322-221) and 0.042km/s for para-H2CO (321-220); CH3OH (422-312) at 218.440GHz is also observed together with para-H2CO (322-221). (6 data files).
On the removal efficiency of padon decay products by fog droplets
International Nuclear Information System (INIS)
Girgzhdis, A.I.; Girgzhdene, R.V.; Shopauskas, K.K.
1978-01-01
The results of the experimental investigations on quantitative evaluation of the 218 Po and 214 Bi washout efficiency by fog in an aerosol chamber are presented. The radioactivity has been measured by means of α-spectrometric method. Comparison of eXperimental and calculated data is made. The 218 Po and 214 Bi washout efficiency ratio is found to be dependent mainly on the aerosol concentration. The change of 218 Po concentration imitates the process of coagulation of free atoms of light ions, and that of 214 Bi - of aerosol particles by fog droplets
Actiniarian Sea anemone fauna of India
Digital Repository Service at National Institute of Oceanography (India)
Parulekar, A.H.
stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...
Digital Repository Service at National Institute of Oceanography (India)
Mascarenhas, A.
stream_size 1 stream_content_type text/plain stream_name Fish_Curry_Rice_2002_218.pdf.txt stream_source_info Fish_Curry_Rice_2002_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
29 CFR 502.5 - Investigation authority of Secretary.
2010-07-01
... ENFORCEMENT OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF... gather such information as deemed necessary by the Secretary to determine compliance with contractual obligations under sec. 218 of the INA or these regulations. (b) Failure to cooperate with an investigation...
Directory of Open Access Journals (Sweden)
Stefanie M F Seiler
Full Text Available 2-Deoxy-2-[18F]fluoro-D-glucose PET/CT is a well-established imaging method for staging, restaging and therapy-control in human medicine. In veterinary medicine, this imaging method could prove to be an attractive and innovative alternative to conventional imaging in order to improve staging and restaging. The aim of this study was both to evaluate the effectiveness of this image-guided method in canine patients with spontaneously occurring cancer as well as to illustrate the dog as a well-suited animal model for comparative oncology.Ten dogs with various malignant tumors were included in the study and underwent a whole body FDG PET/CT. One patient has a second PET-CT 5 months after the first study. Patients were diagnosed with histiocytic sarcoma (n = 1, malignant lymphoma (n = 2, mammary carcinoma (n = 4, sertoli cell tumor (n = 1, gastrointestinal stromal tumor (GIST (n = 1 and lung tumor (n = 1. PET/CT data were analyzed with the help of a 5-point scale in consideration of the patients' medical histories.In seven of the ten dogs, the treatment protocol and prognosis were significantly changed due to the results of FDG PET/CT. In the patients with lymphoma (n = 2 tumor extent could be defined on PET/CT because of increased FDG uptake in multiple lymph nodes. This led to the recommendation for a therapeutic polychemotherapy as a treatment. In one of the dogs with mammary carcinoma (n = 4 and in the patient with the lung tumor (n = 1, surgery was cancelled due to the discovery of multiple metastasis. Consequently no treatment was recommended.FDG PET/CT offers additional information in canine patients with malignant disease with a potential improvement of staging and restaging. The encouraging data of this clinical study highlights the possibility to further improve innovative diagnostic and staging methods with regard to comparative oncology. In the future, performing PET/CT not only for staging but also in therapy control could offer a
76 FR 67631 - Airworthiness Directives; Cirrus Design Corporation Airplanes
2011-11-02
... Corporation, 4515 Taylor Circle, Duluth, Minnesota 55811- 1548, phone: (218) 788-3000; fax: (218) 788-3525... as applicable. (f) Compliance Comply with this AD following Cirrus Design Corporation SR22T Service... this AD, contact Cirrus Design Corporation, 4515 Taylor Circle, Duluth, Minnesota 55811-1548, phone...
77 FR 24228 - Condition Monitoring Techniques for Electric Cables Used in Nuclear Power Plants
2012-04-23
... Used in Nuclear Power Plants AGENCY: Nuclear Regulatory Commission. ACTION: Regulatory guide; issuance... guide, (RG) 1.218, ``Condition Monitoring Techniques for Electric Cables Used in Nuclear Power Plants... of electric cables for nuclear power plants. RG 1.218 is not intended to be prescriptive, instead it...
CAN THE STABILITY OF PROTEIN MUTANTS BE PREDICTED BY FREE-ENERGY CALCULATIONS
YUNYU, S; MARK, AE; WANG, CX; HUANG, FH; BERENDSEN, HJC; VANGUNSTEREN, WF
The use of free energy simulation techniques in the study of protein stability is critically evaluated. Results from two simulations of the thermostability mutation Asn218 to Ser218 in Subtilisin are presented. It is shown that components of the free energy change can be highly sensitive to the
32 CFR 218.3 - Dose reconstruction methodology.
2010-07-01
... with air and soil, generated within a fraction of a second. Because of the complexity of these radiation sources and their varied interaction properties with air and soil, it is necessary to obtain... cause material to become airborne (such as wind, decontamination or traffic) are used with empirical...
40 CFR 94.218 - Deterioration factor determination.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Deterioration factor determination. 94... Deterioration factor determination. Manufacturers shall determine exhaust emission deterioration factors using good engineering judgement according to the provisions of this section. Every deterioration factor must...
48 CFR 218.170 - Additional acquisition flexibilities.
2010-10-01
... the Governmentwide commercial purchase card. Governmentwide commercial purchase cards do not have to... entirely outside the United States. See 213.270(c)(1). (d) Master agreement for repair and alteration of... work to a contractor that has previously executed a master agreement, when delay would endanger a...
41 CFR 101-29.218 - Voluntary standards.
2010-07-01
... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 29-FEDERAL PRODUCT... standards,” but does not include professional standards of personal conduct, institutional codes of ethics...
218-IJBCS-Article-Dr S Nwodo Chinedu
African Journals Online (AJOL)
Dr Gatsing
Agro-waste: a potential fermentation substrate for Penicillium chrysogenum ... Cassava shavings significantly (P<0.001) produced the highest amount of mycelia ..... the hydrolysis of cellulosic biomass. ... chrysogenum from ammonia pretreated ... enzymatic hydrolysis of cellulose by ethanol. Biotechnol. Lett., 19: 977-979.
Gender | Page 218 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
A research team in Lebanon's remote Arsaal region used an updated version of the traditional tribal council, combined with modern technologies such as videos and GIS surveys, to resolve long-standing conflicts among land users. The results have had an impact on local government across the region and served as a ...
Hot wire production of single-wall and multi-wall carbon nanotubes
Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.
2010-10-26
Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
26 CFR 31.6413(c)-1 - Special refunds.
2010-04-01
... from the employee's remuneration by reason of such agreement has been paid to the district director... such remuneration for services covered by an agreement made pursuant to section 218 of the Social... from an employee's remuneration as a result of an agreement made pursuant to section 218 of the Social...
2011-08-03
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,218; TA-W-73,218A] International Business Machines Corporation, ITD Business Unit, Division 7, E-mail and Collaboration Group, Including Workers Off-Site From Various States in the United States Reporting to Armonk, NY; International Business Machines Corporation, Web Strategy...
A designated centre for people with disabilities operated by Health Service Executive, Sligo
LENUS (Irish Health Repository)
Gegenbauer, Kristina
2013-11-01
Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.
LENUS (Irish Health Repository)
Gegenbauer, Kristina
2013-11-01
Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.
Directory of Open Access Journals (Sweden)
Anna Jarecka
2012-12-01
Full Text Available The effect of D,L-β-aminobutyric acid (BABA on the growth and development of the root system and the development of fusariosis on tulip bulbs cv. Apeldoorn infected by Fusarium oxysporum f. sp. tulipae (F.ox.t. 218 was studied. The length and fresh weight of roots, the development of fusariosis on bulbs and the linear growth of mycelium of F.ox.t. 218 on PDA medium were measured. Preventively used BABA at a concentration of 100, 250 and 300 µg·cm-3 for soaking uncooled and cooled tulip bulbs greatly inhibited the development of fusariosis on the root system; the length and fresh weight of roots were similar to those of the bulbs not inoculated with F.ox.t. 218. At a concentration of 100 µg·cm-3;, BABA used for soaking bulbs limited the development of fusariosis on scales in about 50% and the concentration of 200 µg·cm-3 totally inhibited the disease symptoms induced by F.ox.t. 218. At a concentration of 100 - 1000 µg·cm-3, BABA did not inhibit the mycelium growth of F.ox.t. 17 and F.xo.t. 218 on PDA medium. This study suggests that BABA protects tulip roots and bulb scales against F. oxysporum f. sp. tulipae by inducing resistance in these organs and has no direct influence on the pathogen.
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
2012-05-02
... acid (PFNA) perfluorobutanesulfonic acid (PFBS). Chromium-6 using EPA Method 218.7 (IC/UV-VIS): \\10... (ASTM, 2008). \\9\\ EPA Method 537 (LC/MS/MS) (USEPA, 2009b). \\10\\ EPA Method 218.7 (IC/UV-VIS) (USEPA... chromatography with UV detection (HPLC/UV) methods have been published (Howard and Boyer, 2007), they do not...
Remote Patient Management in a Mammographic Screening Environment in Underserved Areas
2005-09-01
of 4,945 paired examinations. Radiology 2001; 218:873-880. 10. Malich A, Marx C, Facius M, Boehm T, Fleck M, Kaiser WA. Tumour 24. Venta LA, Hendrick...218:873-880. KF, Sickles EA. Mammographic character- factor determining the quality of com- 15. Venta LA, Hendrick RE, Adler YT, et al. iSicks of 115
International Nuclear Information System (INIS)
Malet, J.
1997-01-01
Short-lived radon daughters ( 218 Po, 214 Pb, 214 Bi, and 214 Po) are important contributors to the natural average annual individual dose. The models describing the evolution of these aerosol in a house depend critically on a parameter, the 218 Po deposition velocity, which, although aerosol deposition has been extensively studied, is poorly known. A numerical and experimental study is thus carried out for a simple case: deposition in a cylindrical tube under laminar flow condition. The numerical results help understanding the difference between the transport and deposition of these radionuclides and those of non radioactive aerosols. Comparison of these well environment does not give satisfactory correlation, requiring the study of phenomena that may affect deposition. The first of these is the possible variation in the e 218 Po diffusion coefficient. Furthermore, experiments coupled with numerical calculations show that this variation could be due to 218 Po neutralization. The second phenomenon concerns the effect of the surface type, which is also shown experimentally. By modelling the neutralization and using results with a piratically smooth surface, good numerical/experimental correlations are obtained. Understanding this simple case than makes possible studying a more complex case: deposition in controlled turbulent flow. Two theories are thus experimentally validated. In addition, a 218 Po deposition velocity representative of our experimental conditions is determined. Finally, we report a feasibility study of radon daughters transport and deposition in a ventilated chamber taking into account all the involved phenomena. (author)
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Energy Technology Data Exchange (ETDEWEB)
Malet, J
1997-10-10
Short-lived radon daughters ({sup 218}Po, {sup 214}Pb, {sup 214}Bi, and {sup 214}Po) are important contributors to the natural average annual individual dose. The models describing the evolution of these aerosol in a house depend critically on a parameter, the {sup 218}Po deposition velocity, which, although aerosol deposition has been extensively studied, is poorly known. A numerical and experimental study is thus carried out for a simple case: deposition in a cylindrical tube under laminar flow condition. The numerical results help understanding the difference between the transport and deposition of these radionuclides and those of non radioactive aerosols. Comparison of these well environment does not give satisfactory correlation, requiring the study of phenomena that may affect deposition. The first of these is the possible variation in the e {sup 218}Po diffusion coefficient. Furthermore, experiments coupled with numerical calculations show that this variation could be due to {sup 218}Po neutralization. The second phenomenon concerns the effect of the surface type, which is also shown experimentally. By modelling the neutralization and using results with a piratically smooth surface, good numerical/experimental correlations are obtained. Understanding this simple case than makes possible studying a more complex case: deposition in controlled turbulent flow. Two theories are thus experimentally validated. In addition, a {sup 218}Po deposition velocity representative of our experimental conditions is determined. Finally, we report a feasibility study of radon daughters transport and deposition in a ventilated chamber taking into account all the involved phenomena. (author)
Methodologies for Blunt Trauma Assessment in Military Helmets
2010-09-13
Assessment; Monorail Drop Tower 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT UU 18. NUMBER OF PAGES 10 19a. NAME OF RESPONSIBLE...Laboratory Test Procedure for Motorcycle Helmets (TP-218-06) [8]. TP-218-06 specifies a guided monorail drop and provides requirements for how helmets...a hemispherical anvil. The monorail restricts movement to control the impact location, and acceleration is measured using a uniaxial accelerometer
49 CFR 218.29 - Alternate methods of protection.
2010-10-01
... between rolling equipment in a car shop repair track area: (1) A blue signal must be displayed at or near... direction of the person in charge of the workemen, a car mover may be used to reposition rolling equipment... more cars coupled to a locomotive, and blue signals are not available, the engineman or operator at the...
24 CFR 92.218 - Amount of matching contribution.
2010-04-01
... under § 92.102(b)(2) from the resources of a State (other than a transfer of the State's formula... (pursuant to § 92.207); community housing development organization operating expenses (pursuant to § 92.208); capacity building (pursuant to § 92.300(b)) of community housing development organizations; and project...
TU-C-218-02: Effective Oncology Physics Education.
Burmeister, J; Coffey, C; Salehpour, M; Ibbott, G
2012-06-01
The education of medical physicists has historically been quite varied and medical physicists have entered the field through several pathways including specialized educational programs, postdoctoral fellowships, and on-the-job training. It is argued that the contributions of viewpoints from different branches of physics has contributed to the development of novel solutions and advances in radiation oncology. However, there also has been an effort recently to make graduate education of medical physicists more consistent and uniform, particularly for the preparation of clinically oriented therapy physicists. The trend towards a more systematic approach has been guided in part by the requirements for graduate program accreditation developed by CAMPEP and by the requirements for medical physicist certification by the ABR. At the same time, there has been criticism of this approach as being too confining and guiding graduates toward a career as technicians rather than independent thinkers. Educational programs have had to balance the requirements of accreditation and certification against the goal of preparing students for careers as independent researchers. Three speakers will describe the approaches taken by their graduate educational programs to meet the requirements of CAMPEP and adequately prepare graduates for certification by the ABR, while maintaining a commitment to providing a comprehensive education in medical physics. 1. Understand the requirements for graduate program accreditation 2. Understand the education and experience requirements for certification 3. Learn the approaches taken by several graduate programs to meet the requirements for accreditation and certification while providing a comprehensive education in medical physics. © 2012 American Association of Physicists in Medicine.
32 CFR 724.218 - Limitation-Continuance and Postponements.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Limitation-Continuance and Postponements. 724... Limitation—Continuance and Postponements. (a) A continuance of a discharge review hearing may be authorized... continuance is of reasonable duration and is essential to achieving a full and fair hearing. When a proposal...
218 GAGANIJA, MS, *MKOMA, SL and LEMA, ES
African Journals Online (AJOL)
Osondu
2012-03-24
Mar 24, 2012 ... environment, are also the main source of urban noise emission, contributing about 55% to the total noise (Pandya 2002; Sinha and Sridharan,. 2003). The growing vehicle population gives rise to unrestrained noise pollution and associated health effects and can cause psychological and physiological ...
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
1982-08-01
DATA NUMBER OF POINTS 1988 CHANNEL MINIMUM MAXIMUM 1 PHMG -130.13 130.00 2 PS3 -218.12 294.77 3 T3 -341.54 738.15 4 T5 -464.78 623.47 5 PT51 12.317...Continued) CRUISE AND TAKE-OFF MODE DATA I NUMBER OF POINTS 4137 CHANNEL MINIMUM MAXIMUM 1 PHMG -130.13 130.00 2 P53 -218.12 376.60 3 T3 -482.72
Regional Use of Social Networking Tools
2014-12-01
4 2.1.7 Tumblr 4 2.1.8 Instagram 4 2.2 Local Social Networking Services 5 3 Regional Preferences for Social Networking Tools 6 4 African Region...YouTube 280 million Twitter 255 million LinkedIn n/a Pinterest n/a Tumblr 300 million Instagram 200 million The active-user base numbers...so this percentage may decline in the future. 2.1.8 Instagram Instagram , acquired by Facebook in 2012, is a mobile social networking service that
DEFF Research Database (Denmark)
Saetre, Peter; Lundmark, Per; Wang, August
2010-01-01
Serotonin (5-hydroxytryptamin; 5-HT) alternations has since long been suspected in the pathophysiology of schizophrenia. Tryptophan hydroxylase (tryptophan 5-monooxygenase; TPH) is the rate-limiting enzyme in the biosynthesis of 5-HT, and sequence variation in intron 6 of the TPH1 gene has been...... affected individuals having attempted suicide at least once and patients with no history of suicide attempts (P = 0.84). A systematic literature review and meta-analysis support the A218C polymorphism as a susceptibility locus for schizophrenia (odds ratio 1.17, 95% confidence interval 1.......07-1.29). Association studies on suicide attempts are however conflicting (heterogeneity index I(2) = 0.54) and do not support the A218C/A779C polymorphisms being a susceptibility locus for suicidal behavior among individuals diagnosed with a psychiatric disorder (OR = 0.96 [0.80-1.16]). We conclude that the TPH1 A218...
Eichmiller, Robin; Medina-Rivera, Melisa; DeSanto, Rachel; Minca, Eugen; Kim, Christopher; Holland, Cory; Seol, Ja-Hwan; Schmit, Megan; Oramus, Diane; Smith, Jessica; Gallardo, Ignacio F; Finkelstein, Ilya J; Lee, Sang Eun; Surtees, Jennifer A
2018-04-06
Double strand DNA break repair (DSBR) comprises multiple pathways. A subset of DSBR pathways, including single strand annealing, involve intermediates with 3' non-homologous tails that must be removed to complete repair. In Saccharomyces cerevisiae, Rad1-Rad10 is the structure-specific endonuclease that cleaves the tails in 3' non-homologous tail removal (3' NHTR). Rad1-Rad10 is also an essential component of the nucleotide excision repair (NER) pathway. In both cases, Rad1-Rad10 requires protein partners for recruitment to the relevant DNA intermediate. Msh2-Msh3 and Saw1 recruit Rad1-Rad10 in 3' NHTR; Rad14 recruits Rad1-Rad10 in NER. We created two rad1 separation-of-function alleles, rad1R203A,K205A and rad1R218A; both are defective in 3' NHTR but functional in NER. In vitro, rad1R203A,K205A was impaired at multiple steps in 3' NHTR. The rad1R218A in vivo phenotype resembles that of msh2- or msh3-deleted cells; recruitment of rad1R218A-Rad10 to recombination intermediates is defective. Interactions among rad1R218A-Rad10 and Msh2-Msh3 and Saw1 are altered and rad1R218A-Rad10 interactions with RPA are compromised. We propose a model in which Rad1-Rad10 is recruited and positioned at the recombination intermediate through interactions, between Saw1 and DNA, Rad1-Rad10 and Msh2-Msh3, Saw1 and Msh2-Msh3 and Rad1-Rad10 and RPA. When any of these interactions is altered, 3' NHTR is impaired.
Changes of primary and secondary metabolites in barley plants exposed to CdO nanoparticles
Czech Academy of Sciences Publication Activity Database
Večeřová, Kristýna; Večeřa, Zbyněk; Dočekal, Bohumil; Oravec, Michal; Pompeiano, Antonio; Tříska, Jan; Urban, Otmar
2016-01-01
Roč. 218, NOV (2016), s. 207-218 ISSN 0269-7491 R&D Projects: GA MŠk(CZ) LO1415; GA ČR(CZ) GAP503/11/2315; GA ČR(CZ) GBP503/12/G147; GA MŠk(CZ) LD15039 Institutional support: RVO:67179843 ; RVO:68081715 Keywords : Barley * CdO nanoparticles * Gas chromatography * High performance liquid chromatography * Mass spectrometry * Plant metabolites Subject RIV: EH - Ecology, Behaviour; CB - Analytical Chemistry, Separation (UIACH-O) Impact factor: 5.099, year: 2016
Waves and currents in tide-dominated location off Dahej, Gulf of Khambhat, India
Digital Repository Service at National Institute of Oceanography (India)
SanilKumar, V.; AshokKumar, K.
stream_size 28493 stream_content_type text/plain stream_name Mar_Geod_33_218a.pdf.txt stream_source_info Mar_Geod_33_218a.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 1 Waves and currents... the Indian coastline. Unnikrishnan et al. (1999) developed a barotropic numerical model of the Gulf of Khambhat and surrounding areas to simulate tides in the Gulf and were successful in simulating the tidal amplification. Nayak and Shetye (2003) found...
The Atacama Cosmology Telescope: cross correlation with Planck maps
Energy Technology Data Exchange (ETDEWEB)
Louis, Thibaut; Calabrese, Erminia; Dunkley, Joanna; Næss, Sigurd [Department of Astrophysics, Oxford University, Oxford OX1 3RH (United Kingdom); Addison, Graeme E.; Hincks, Adam D. [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Hasselfield, Matthew; Hlozek, Renée [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Bond, J. Richard; Hajian, Amir [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Das, Sudeep [Argonne National Laboratory, 9700 S. Cass Ave., Lemont, IL 60439 (United States); Devlin, Mark J. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104, U.S.A (United States); Dünner, Rolando; Infante, Leopoldo [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Gralla, Megan; Marriage, Tobias A. [Dept. of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218-2686 (United States); Huffenberger, Kevin [Department of Physics, Florida State University, Keen Physics Building, 77 Chieftan Way, Tallahassee, Florida (United States); Kosowsky, Arthur [Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA, 15260 (United States); Moodley, Kavilan [Astrophysics and Cosmology Research Unit, School of Mathematical Sciences, University of KwaZulu-Natal, Durban, 4041 (South Africa); Niemack, Michael D., E-mail: Thibaut.Louis@astro.ox.ac.uk [Joseph Henry Laboratories of Physics, Jadwin Hall, Princeton University, Princeton, NJ 08544 (United States); and others
2014-07-01
We present the temperature power spectrum of the Cosmic Microwave Background obtained by cross-correlating maps from the Atacama Cosmology Telescope (ACT) at 148 and 218 GHz with maps from the Planck satellite at 143 and 217 GHz, in two overlapping regions covering 592 square degrees. We find excellent agreement between the two datasets at both frequencies, quantified using the variance of the residuals between the ACT power spectra and the ACT × Planck cross-spectra. We use these cross-correlations to measure the calibration of the ACT data at 148 and 218 GHz relative to Planck, to 0.7% and 2% precision respectively. We find no evidence for anisotropy in the calibration parameter. We compare the Planck 353 GHz power spectrum with the measured amplitudes of dust and cosmic infrared background (CIB) of ACT data at 148 and 218 GHz. We also compare planet and point source measurements from the two experiments.
ORF Alignment: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 159 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARC...SILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
Solid waste retrieval. Phase 1, Operational basis
International Nuclear Information System (INIS)
Johnson, D.M.
1994-01-01
This Document describes the operational requirements, procedures, and options for execution of the retrieval of the waste containers placed in buried storage in Burial Ground 218W-4C, Trench 04 as TRU waste or suspect TRU waste under the activity levels defining this waste in effect at the time of placement. Trench 04 in Burial Ground 218W-4C is totally dedicated to storage of retrievable TRU waste containers or retrievable suspect TRU waste containers and has not been used for any other purpose
Isotope Exchange in Oxide Catalyst
Hess, Robert V.; Miller, Irvin M.; Schryer, David R.; Sidney, Barry D.; Wood, George M., Jr.; Hoyt, Ronald F.; Upchurch, Billy T.; Brown, Kenneth G.
1987-01-01
Replacement technique maintains level of CO2/18 in closed-cycle CO2 lasers. High-energy, pulsed CO2 lasers using rare chemical isotopes must be operated in closed cycles to conserve gas. Rare isotopes operated in closed cycles to conserve gas. Rare isotopes as CO2/18 used for improved transmission of laser beam in atmosphere. To maintain laser power, CO2 must be regenerated, and O2 concentration kept below few tenths of percent. Conditions achieved by recombining CO and O2.
Solid waste retrieval. Phase 1, Operational basis
Energy Technology Data Exchange (ETDEWEB)
Johnson, D.M.
1994-09-30
This Document describes the operational requirements, procedures, and options for execution of the retrieval of the waste containers placed in buried storage in Burial Ground 218W-4C, Trench 04 as TRU waste or suspect TRU waste under the activity levels defining this waste in effect at the time of placement. Trench 04 in Burial Ground 218W-4C is totally dedicated to storage of retrievable TRU waste containers or retrievable suspect TRU waste containers and has not been used for any other purpose.
50 CFR 218.105 - Requirements for monitoring and reporting.
2010-10-01
... Dead Marine Mammals. Navy personnel shall ensure that NMFS is notified immediately ((see Communication... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking and Importing Marine Mammals; U.S. Navy's Mariana Islands Training Range...
50 CFR 218.184 - Requirements for monitoring and reporting.
2010-10-01
... individuals; (D) Number of calves present, if any; (E) Duration of sighting; (F) Behavior of marine animals... both visual sightings and behavioral observations of marine animals. (3) These transect data shall... surveys of the detonation area and nearby beaches shall be conducted for stranded marine animals following...
All projects related to | Page 218 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-04-01
Promoting Innovation in the Services Sector: Toward Productivity and Competitiveness. Project. The services sector is increasingly important to the economies of Latin America and the Caribbean, but productivity remains relatively low. Start Date: April 1, 2012. End Date: March 12, 2014. Topic: LATIN AMERICA, SERVICE ...
7 CFR 2.18 - Under Secretary for Food Safety.
2010-01-01
... availability and safety of processes and treatments that eliminate or substantially reduce the level of... inspection of eggs and egg products. (4) Related to biotechnology. Coordinate the development and carrying... biotechnology as they may affect the safety of meat, poultry or egg products. (5) Related to environmental...
50 CFR 218.24 - Requirements for monitoring and reporting.
2010-10-01
... days the ship is at sea. (ii) The towed hydrophone array shall be used to supplement the ship-based... for Cherry Point Range Complex and across range complexes, (e) General Notification of Injured or Dead... collection methods shall be standardized across range complexes to allow for comparison in different...
50 CFR 218.5 - Requirements for monitoring and reporting.
2010-10-01
... array shall be deployed during daylight hours for each of the days the ship is at sea. (ii) The towed... method for standardizing data collection for VACAPES Range Complex and across range complexes. (e... Monitoring Plan. Data collection methods shall be standardized across range complexes to allow for comparison...
50 CFR 218.14 - Requirements for monitoring and reporting.
2010-10-01
... array shall be deployed during daylight hours for each of the days the ship is at sea. (ii) The towed... method for standardizing data collection for JAX Range Complex and across range complexes. (e) General... collection methods will be standardized across range complexes to allow for comparison in different...
Brand, Cara L; Cattani, M Victoria; Kingan, Sarah B; Landeen, Emily L; Presgraves, Daven C
2018-04-23
Crossing over between homologous chromosomes during meiosis repairs programmed DNA double-strand breaks, ensures proper segregation at meiosis I [1], shapes the genomic distribution of nucleotide variability in populations, and enhances the efficacy of natural selection among genetically linked sites [2]. Between closely related Drosophila species, large differences exist in the rate and chromosomal distribution of crossing over. Little, however, is known about the molecular genetic changes or population genetic forces that mediate evolved differences in recombination between species [3, 4]. Here, we show that a meiosis gene with a history of rapid evolution acts as a trans-acting modifier of species differences in crossing over. In transgenic flies, the dicistronic gene, mei-217/mei-218, recapitulates a large part of the species differences in the rate and chromosomal distribution of crossing over. These phenotypic differences appear to result from changes in protein sequence not gene expression. Our population genetics analyses show that the protein-coding sequence of mei-218, but not mei-217, has a history of recurrent positive natural selection. By modulating the intensity of centromeric and telomeric suppression of crossing over, evolution at mei-217/-218 has incidentally shaped gross differences in the chromosomal distribution of nucleotide variability between species. We speculate that recurrent bouts of adaptive evolution at mei-217/-218 might reflect a history of coevolution with selfish genetic elements. Copyright © 2018 Elsevier Ltd. All rights reserved.
123I-MIBG imaging detects cardiac involvement and predicts cardiac events in Churg-Strauss syndrome
International Nuclear Information System (INIS)
Horiguchi, Yoriko; Morita, Yukiko; Tsurikisawa, Naomi; Akiyama, Kazuo
2011-01-01
In Churg-Strauss syndrome (CSS) it is important to detect cardiac involvement, which predicts poor prognosis. This study evaluated whether 123 I-metaiodobenzylguanidine (MIBG) scintigraphy could detect cardiac damage and predict cardiac events in CSS. 123 I-MIBG scintigraphy was performed in 28 patients with CSS, 12 of whom had cardiac involvement. The early and delayed heart to mediastinum ratio (early H/M and delayed H/M) and washout rate were calculated by using 123 I-MIBG scintigraphy and compared with those in control subjects. Early H/M and delayed H/M were significantly lower and the washout rate was significantly higher in patients with cardiac involvement than in those without and in controls (early H/M, p = 0.0024, p = 0.0001; delayed H/M, p = 0.0002, p = 0.0001; washout rate, p = 0.0012, p = 0.0052 vs those without and vs controls, respectively). Accuracy for detecting cardiac involvement was 86% for delayed H/M and washout rate and 79% for early H/M and B-type natriuretic peptide (BNP). Kaplan-Meier analysis showed significantly lower cardiac event-free rates in patients with early H/M ≤ 2.18 and BNP > 21.8 pg/ml than those with early H/M > 2.18 and BNP ≤ 21.8 pg/ml (log-rank test p = 0.006). Cardiac sympathetic nerve function was damaged in CSS patients with cardiac involvement. 123 I-MIBG scintigraphy was useful in detecting cardiac involvement and in predicting cardiac events. (orig.)
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available = 70 ... Query: 218 LGRLRSTIEAEREFTANSAHELRTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH 277 ... LGRLRSTIEAEREFTANSAHEL...RTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH Sbjct: 1 ... LGRLRSTIEAEREFTANSAHELRTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH 60 ...
Melting-pressure and density equations of 3He at temperatures from 0.001 to 30 K
International Nuclear Information System (INIS)
Huang Yonghua; Chen Guobang
2005-01-01
Nonsegmented equations for melting pressure and density at temperatures from 0.001 K to 30 K have been developed to fit the reference data. The maximum and average deviations between the melting pressure equation and the totaling 298 reference data are 2.17% and 0.218%, respectively. For the density equations, the average deviations are 0.236% for the liquid side and 0.218% for the solid side. Both the melting pressure curve and melting density curves predicted by the submitted equations approach their minimums at about 0.315 K
Low-Level Burial Grounds Dangerous Waste Permit Application design documents
International Nuclear Information System (INIS)
1990-01-01
This document presents the Functional Design Criteria for trenches to be constructed to receive solid radioactive mixed waste (RMW) from on and offsite generators. The new RMW disposal facilities are considered modifications to or lateral expansion of the existing low-level waste burial grounds. The new facilities upgrade the existing disposal practice for RMW to the minimum technology requirements of the Resource Conservation and Recovery Act. The proposed locations for the two facilities are: 218-E-10 for drag-off-waste packages and, 218-W-4C for non drag-off waste packages
Consumer Psychology and Marketing Overview: An Influence Operations Perspective
2012-01-01
Ontario – en particulier les examens de la littérature sur les opérations d’influence (CR-2007-146), la psychologie du consommateur (CR 2008-218) et... psychologie du consommateur, dont certains ou la totalité pourraient être applicables aux opérations d’influence actuelles des FC. Cet article se veut une...les opérations d’influence (CR-2007-146), l’examen de la littérature sur la psychologie du consommateur (CR 2008-218) et une annexe au matériel, à la
ORF Alignment: NC_004631 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFL...QEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
Collinear resonant ionization laser spectroscopy of rare francium isotopes
Neyens, G; Flanagan, K; Rajabali, M M; Le blanc, F M; Ware, T; Procter, T J
2008-01-01
We propose a programme of collinear resonant ionization spectroscopy (CRIS) of the francium isotopes up to and including $^{201}$Fr and $^{218,219}$Fr. This work aims at answering questions on the ordering of quantum states, and effect of the ($\\pi s_{1/2}^{-1}$)1/2$^{+}$ intruder state, which is currently believed to be the ground state of $^{199}$Fr. This work will also study the edge of the region of reflection asymmetry through measurement of the moments and radii of $^{218,219}$Fr. This proposal forms the first part of a series of experiments that will study nuclei in this region of the nuclear chart. Based on the success of this initial proposal it is the intention of the collaboration to perform high resolution measurements on the isotopes of radium and radon that surround $^{201}$Fr and $^{218}$Fr and thus providing a comprehensive description of the ground state properties of this region of the nuclear chart. Recent in-source spectroscopy measurements of lead, bismuth and polonium have demonstrated a...
Ultraviolet inactivation and photoreactivation of the cholera phage 'Kappa'
International Nuclear Information System (INIS)
Samad, S.A.; Bhattacharyya, S.C.; Chatterjee, S.N.
1987-01-01
The lysogenic cholera phage, 'Kappa' is some ten to twenty folds more resistant to UV (254 nm) than are most of the T. phages of E. coli, or the cholera phage PL 163/10, or the host V. cholerae strain H218 Sm r , the 37% (D 37 ) and 10% (D 10 ) survival doses being 255.8 J/m 2 and 633.6 J/m 2 respectively. The UV-irradiated 'Kappa' phages could be photoreactivated in the host V. cholerae strain H218 Sm r to a maximum extent of 40%. The removal of the number of lethal hits per phage by the survival-enhancement treatment (photoreactivation) with time followed an exponential relation, the constant probability of removal of lethal hit per unit time being 2.8x10 -2 min -1 . The UV-irradiated phages could also be Weigle reactivated in the host strain of H218 Sm r by a small degree, the maximum reactivation factor (ratio of survivals in UV-irradiated and non-irradiated hosts) being 1.50. (orig.)
Radiation Area Remedial Action FY 1996 summary report
International Nuclear Information System (INIS)
Hayward, W.M.
1996-11-01
The Radiation Area Remedial Action (RARA) project is responsible for the interim stabilization and maintenance of the majority of the inactive waste sites at the Hanford Site. These waste sites include approximately 400 individual sites and 4,000 acres. Three facilities were removed from the RARA list near the end of fiscal year (FY) 1996P: the 218-W-4B, 218-E-10, and 218-E-12B Burial Grounds. These three facilities are treatment, storage, and disposal (TSD) sites assigned to Fluor Daniel Hanford. Therefore, the RARA project will no longer perform activities on the inactive portions to maintain clear lines of responsibility (fully with Fluor Daniel Hanford). RARA activities are broken into two broad categories: interim stabilization, and surveillance and maintenance (S and M). Interim stabilization addresses major corrective actions for sites with radioactive surface contamination. A site continues to require S and M once it has received interim stabilization. Vegetation management is a significant activity under the RARA project. The goal is to control vegetation that may grow and spread radioactive contamination
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available : 1 ... LMFDLEDSVALREKDAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARC...AILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAI...LQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
ORF Alignment: NC_003198 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available IALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQ...AARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ... ...1 ... LMFDLEDSVALREKHAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 G
Energy Technology Data Exchange (ETDEWEB)
Horiguchi, Yoriko; Morita, Yukiko [National Hospital Organization Sagamihara National Hospital, Department of Cardiology, Sagamihara City, Kanagawa (Japan); Tsurikisawa, Naomi; Akiyama, Kazuo [National Hospital Organization Sagamihara National Hospital, Clinical Research Centre for Allergy and Rheumatology, Sagamihara City, Kanagawa (Japan)
2011-02-15
In Churg-Strauss syndrome (CSS) it is important to detect cardiac involvement, which predicts poor prognosis. This study evaluated whether {sup 123}I-metaiodobenzylguanidine (MIBG) scintigraphy could detect cardiac damage and predict cardiac events in CSS. {sup 123}I-MIBG scintigraphy was performed in 28 patients with CSS, 12 of whom had cardiac involvement. The early and delayed heart to mediastinum ratio (early H/M and delayed H/M) and washout rate were calculated by using {sup 123}I-MIBG scintigraphy and compared with those in control subjects. Early H/M and delayed H/M were significantly lower and the washout rate was significantly higher in patients with cardiac involvement than in those without and in controls (early H/M, p = 0.0024, p = 0.0001; delayed H/M, p = 0.0002, p = 0.0001; washout rate, p = 0.0012, p = 0.0052 vs those without and vs controls, respectively). Accuracy for detecting cardiac involvement was 86% for delayed H/M and washout rate and 79% for early H/M and B-type natriuretic peptide (BNP). Kaplan-Meier analysis showed significantly lower cardiac event-free rates in patients with early H/M {<=} 2.18 and BNP > 21.8 pg/ml than those with early H/M > 2.18 and BNP {<=} 21.8 pg/ml (log-rank test p = 0.006). Cardiac sympathetic nerve function was damaged in CSS patients with cardiac involvement. {sup 123}I-MIBG scintigraphy was useful in detecting cardiac involvement and in predicting cardiac events. (orig.)
ORF Alignment: NC_002936 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 218 ... Query: 167 GRHRLMCGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL 226 ... ... ... GRHRLMCGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL Sbjct: 1 ... GRHRLM...CGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL 60 ... Query: 287 QHEPVLYGFLQNGKHPWYSDRKQTTIWNYDKPKRNKDH
Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP
Contributions of conserved residues at the gating interface of glycine receptors
DEFF Research Database (Denmark)
Pless, Stephan Alexander; Leung, Ada W Y; Galpin, Jason D
2011-01-01
and the in vivo nonsense suppression method to incorporate unnatural amino acids to probe the electrostatic and hydrophobic contributions of five highly conserved side chains near the interface, Glu-53, Phe-145, Asp-148, Phe-187, and Arg-218. Our results suggest a salt bridge between Asp-148 in loop 7 and Arg-218......Glycine receptors (GlyRs) are chloride channels that mediate fast inhibitory neurotransmission and are members of the pentameric ligand-gated ion channel (pLGIC) family. The interface between the ligand binding domain and the transmembrane domain of pLGICs has been proposed to be crucial...
Benzodiazepine receptor and neurotransmitter studies in the brain of suicides
Energy Technology Data Exchange (ETDEWEB)
Manchon, M.; Kopp, N.; Rouzioux, J.J.; Lecestre, D.; Deluermoz, S.; Miachon, S.
1987-12-14
The characteristics of benzodiazepine binding sites were studied on frozen sections of hippocampus of 7 suicides and 5 controls subjects, using biochemical and autoradiographic techniques. /sup 3/H flunitrazepam was used as ligand, clonazepam and CL 218,872 as displacing agents. Some neurotransmitters or their derivatives were evaluated quantitatively in parallel in the hippocampal tissue by liquid chromatography. The authors observed mainly an increase in the Ki of CL 218,872 subtype I binding sites in suicides, and an increase in % of type I binding sites. Among neurotransmitters, only norepinephrine differed significantly between controls and suicides. 36 references, 3 figures, 1 table.
2008-09-01
2.2.2.1 Theseus AUV 2-15 2.2.3 Air and Space 2-18 2.2.3.1 F-22A Flying Qualities Development 2-18 2.2.3.2 Apollo and Space Shuttle 2-19 2.2.3.3...Figure 2.14 The Multi-Mission Spartan Vehicle and the Remote Minehunting Vehicle Dorado 2-15 Figure 2.15 Theseus Schematic 2-16 Figure 2.16 The...Disciplines 6-3 RTO-TR-SCI-144 ix List of Tables Table Page Table 2.1 Thrust and Pitch Attitude Before the Accident 2-6 Table 2.2 Theseus
Benzodiazepine receptor and neurotransmitter studies in the brain of suicides
International Nuclear Information System (INIS)
Manchon, M.; Kopp, N.; Rouzioux, J.J.; Lecestre, D.; Deluermoz, S.; Miachon, S.
1987-01-01
The characteristics of benzodiazepine binding sites were studied on frozen sections of hippocampus of 7 suicides and 5 controls subjects, using biochemical and autoradiographic techniques. 3 H flunitrazepam was used as ligand, clonazepam and CL 218,872 as displacing agents. Some neurotransmitters or their derivatives were evaluated quantitatively in parallel in the hippocampal tissue by liquid chromatography. The authors observed mainly an increase in the Ki of CL 218,872 subtype I binding sites in suicides, and an increase in % of type I binding sites. Among neurotransmitters, only norepinephrine differed significantly between controls and suicides. 36 references, 3 figures, 1 table
Schaefferkoetter, Joshua D; Carlson, Eric R; Heidel, Robert E
2015-07-01
The present study investigated the performance of cellular metabolism imaging with 2-deoxy-2-((18)F) fluoro-D-glucose (FDG) versus cellular proliferation imaging with 3'-deoxy-3'-((18)F) fluorothymidine (FLT) in the detection of cervical lymph node metastases in oral/head and neck cancer. We conducted a prospective cohort study to assess a head-to-head performance of FLT imaging and clinical FDG imaging for characterizing cervical lymph node metastases in patients with squamous cell carcinoma (SCC) of the oral/head and neck region. The primary predictor variable of the study was the presence of FDG or FLT avidity within the cervical lymph nodes. The primary outcome variable was the histologic presence of metastatic SCC in the cervical lymph nodes. The performance was reported in terms of the sensitivity, specificity, accuracy, and positive and negative predictive values. The overall accuracy for discriminating positive from negative lymph nodes was evaluated as a function of the positron emission tomography (PET) standardized uptake value (SUV). Receiver operating characteristic (ROC) analyses were performed for both tracers. Eleven patients undergoing surgical resection of SCC of the oral/head and neck region underwent preoperative FDG and FLT PET-computed tomography (CT) scans on separate days. The interpretation of the FDG PET-CT imaging resulted in sensitivity, specificity, accuracy, positive predictive value, and negative predictive value of 43.2, 99.5, 94.4, 88.9, and 94.7%, respectively. The sensitivity, specificity, accuracy, positive predictive value, and negative predictive value for FLT PET-CT imaging was 75.7, 99.2, 97.1, 90.3, and 97.7%, respectively. The areas under the curve for the ROC curves were 0.9 and 0.84 for FDG and FLT, respectively. Poor correlation was observed between the SUV for FDG and FLT within the lymph nodes and tumors. FLT showed better overall performance for detecting lymphadenopathy on qualitative assessment within the total
Directory of Open Access Journals (Sweden)
Laura Margarita López-Castillo
2016-12-01
Full Text Available In plants triosephosphate isomerase (TPI interconverts glyceraldehyde 3-phosphate (G3P and dihydroxyacetone phosphate (DHAP during glycolysis, gluconeogenesis, and the Calvin-Benson cycle. The nuclear genome of land plants encodes two tpi genes, one gene product is located in the cytoplasm and the other is imported into the chloroplast. Herein we report the crystal structures of the TPIs from the vascular plant Arabidopsis thaliana (AtTPIs and address their enzymatic modulation by redox agents. Cytoplasmic TPI (cTPI and chloroplast TPI (pdTPI share more than 60% amino acid identity and assemble as (β-α8 dimers with high structural homology. cTPI and pdTPI harbor two and one accessible thiol groups per monomer respectively. cTPI and pdTPI present a cysteine at an equivalent structural position (C13 and C15 respectively and cTPI also contains a specific solvent accessible cysteine at residue 218 (cTPI-C218. Site directed mutagenesis of residues pdTPI-C15, cTPI-C13 and cTPI-C218 to serine substantially decreases enzymatic activity, indicating that the structural integrity of these cysteines is necessary for catalysis. AtTPIs exhibit differential responses to oxidative agents, cTPI is susceptible to oxidative agents such as diamide and H2O2, whereas pdTPI is resistant to inhibition. Incubation of AtTPIs with the sulfhydryl conjugating reagents methylmethane thiosulfonate (MMTS and glutathione inhibits enzymatic activity. However, the concentration necessary to inhibit pdTPI is at least two orders of magnitude higher than the concentration needed to inhibit cTPI. Western-blot analysis indicates that residues cTPI-C13, cTPI-C218, and pdTPI-C15 conjugate with glutathione. In summary, our data indicate that AtTPIs could be redox regulated by the derivatization of specific AtTPI cysteines (cTPI-C13 and pdTPI-C15 and cTPI-C218. Since AtTPIs have evolved by gene duplication, the higher resistance of pdTPI to redox agents may be an adaptive consequence to
Puri, Mayank; Company, Anna; Sabenya, Gerard; Costas, Miquel; Que, Lawrence
2016-06-20
Detailed studies of oxygen atom exchange (OAE) between H2(18)O and synthetic non-heme oxoiron(IV) complexes supported by tetradentate and pentadentate ligands provide evidence that they proceed by a common mechanism but within two different kinetic regimes, with OAE rates that span 2 orders of magnitude. The first kinetic regime involves initial reversible water association to the Fe(IV) complex, which is evidenced by OAE rates that are linearly dependent on [H2(18)O] and H2O/D2O KIEs of 1.6, while the second kinetic regime involves a subsequent rate determining proton-transfer step between the bound aqua and oxo ligands that is associated with saturation behavior with [H2(18)O] and much larger H2O/D2O KIEs of 5-6. [Fe(IV)(O)(TMC)(MeCN)](2+) (1) and [Fe(IV)(O)(MePy2TACN)](2+) (9) are examples of complexes that exhibit kinetic behavior in the first regime, while [Fe(IV)(O)(N4Py)](2+) (3), [Fe(IV)(O)(BnTPEN)](2+) (4), [Fe(IV)(O)(1Py-BnTPEN)](2+) (5), [Fe(IV)(O)(3Py-BnTPEN)](2+) (6), and [Fe(IV)(O)(Me2Py2TACN)](2+) (8) represent complexes that fall in the second kinetic regime. Interestingly, [Fe(IV)(O)(PyTACN)(MeCN)](2+) (7) exhibits a linear [H2(18)O] dependence below 0.6 M and saturation above 0.6 M. Analysis of the temperature dependence of the OAE rates shows that most of these complexes exhibit large and negative activation entropies, consistent with the proposed mechanism. One exception is complex 9, which has a near-zero activation entropy and is proposed to undergo ligand-arm dissociation during the RDS to accommodate H2(18)O binding. These results show that the observed OAE kinetic behavior is highly dependent on the nature of the supporting ligand and are of relevance to studies of non-heme oxoiron(IV) complexes in water or acetonitrile/water mixtures for applications in photocatalysis and water oxidation chemistry.
Wang, Mingle; Zou, Zhongwei; Li, Qinghui; Xin, Huahong; Zhu, Xujun; Chen, Xuan; Li, Xinghui
2017-07-01
CsHSP17.7, CsHSP18.1, and CsHSP21.8 expressions are induced by heat and cold stresses, and CsHSP overexpression confers tolerance to heat and cold stresses in transgenic Pichia pastoris and Arabidopsis thaliana. Small heat shock proteins (sHSPs) are crucial for protecting plants against biotic and abiotic stresses, especially heat stress. However, knowledge concerning the functions of Camellia sinensis sHSP in heat and cold stresses remains poorly understood. In this study, three C. sinensis sHSP genes (i.e., CsHSP17.7, CsHSP18.1, and CsHSP21.8) were isolated and characterized using suppression subtractive hybridization (SSH) technology. The CsHSPs expression levels in C. sinensis leaves were significantly up-regulated by heat and cold stresses. Phylogenetic analyses revealed that CsHSP17.7, CsHSP18.1, and CsHSP21.8 belong to sHSP Classes I, II, and IV, respectively. Heterologous expression of the three CsHSP genes in Pichia pastoris cells enhanced heat and cold stress tolerance. When exposed to heat and cold treatments, transgenic Arabidopsis thaliana plants overexpressing CsHSP17.7, CsHSP18.1, and CsHSP21.8 had lower malondialdehyde contents, ion leakage, higher proline contents, and transcript levels of stress-related genes (e.g., AtPOD, AtAPX1, AtP5CS2, and AtProT1) compared with the control line. In addition, improved seed germination vigor was also observed in the CsHSP-overexpressing seeds under heat stress. Taken together, our results suggest that the three identified CsHSP genes play key roles in heat and cold tolerance.
Directory of Open Access Journals (Sweden)
Yulei Gao
2016-01-01
Full Text Available Background/Aims: This study investigated the effect of silencing TOB1 (Transducer of ERBB2, 1 expression in bone marrow-derived mesenchymal stem cells (MSCs on MSC-facilitated tendon-bone healing in a rat supraspinatus repair model. Methods: Rat MSCs were transduced with a recombinant lentivirus encoding short hairpin RNA (shRNA against TOB1. MSC cell proliferation was analyzed by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assays. The effect of MSCs with TOB1 deficiency on tendon-bone healing in a rat rotator cuff repair model was evaluated by biomechanical testing, histological analysis and collagen type I and II gene expression. An upstream regulator (miR-218 of TOB1 was determined in MSCs. Results: We found that knockdown of TOB1 significantly increased the proliferative activity of rat MSCs in vitro. When MSCs with TOB1 deficiency were injected into injured rat supraspinatus tendon-bone junctions, the effect on tendon-bone healing was enhanced compared to treatment with control MSCs with normal TOB1 expression, as evidenced by elevated levels of ultimate load to failure and stiffness, increased amount of fibrocartilage and augmented expression of collagen type I and type II genes. In addition, we found that the TOB1 3′ untranslated region is a direct target of miR-218. Similar to the effect of TOB1 deficiency, overexpression of miR-218 effectively promoted tendon-bone healing in rat. Conclusion: These results suggest that TOB1 may play a negative role in the effect of MSCs on tendon-bone healing, and imply that expression of TOB1 may be regulated by miR-218.
Assessing the deposition of radon progeny from a uranium glass necklace
International Nuclear Information System (INIS)
Hanse, M.F.; Moss, G.R.
2015-01-01
Could jewellery made from uranium glass beads pose an increased risk to skin cancer? The literature Eatough (Alpha-particle dosimetry for the basal layer of the skin and the radon progeny 218 Po and 214 Po. Phys. Med. Biol. 1997;42:1899-1911.) suggests that the alphas from the short-lived radon daughters, 218 Po and 214 Po, may reach the basal layer of the epidermis, which is believed to be important in the induction of skin cancers. The deposition of the alphas from the 218 Po and 214 Po daughters was investigated using PADC detector material. The expectation would be that no alpha particles would penetrate through the dead skin layer, assuming the average of 70 microns used in radiation protection, but the skin around the collar bone could potentially be thinner than the assumed average. It should be noticed that by inserting a slice of pig skin in between the necklace and the PADC, no great excess of alpha tracks were seen after 1 week of exposure in the freezer. There was, however, a clear signal through the pig skin from beta particles, confirming the potential of a uranium bead necklace posing a health risk. (authors)
Importance of secondary damage in downer cows.
Poulton, P J; Vizard, A L; Anderson, G A; Pyman, M F
2016-05-01
To investigate the relative importance in downer cows of the primary cause of recumbency in comparison with secondary complications. Downer dairy cows were monitored during their recumbency under field conditions in South Gippsland, Victoria, Australia. The cause of the original recumbency of the 218 cows was determined and secondary damage, status on day 7 and final outcome were recorded. Some type of secondary damage was found in 183/218 (84%) cows, of which 173/218 (79%) had damage deemed to be clinically important. By day 7, 52 (24%) had recovered and 69 (32%) eventually recovered. Of the 149 (68%) cows that were euthanased or died, 23 (15%) were deemed to have been lost solely from the primary cause, 107 (72%) from secondary damage and 19 (13%) from a combination of both. There was no difference in recovery among the five broad groups of causes of primary recumbency. Secondary damage was very common and presented in a large variety of ways, with many cows having multiple types of secondary damage concurrently. For most cows the secondary damage was more important than the initial primary damage in determining their fate. © 2016 Australian Veterinary Association.
ORF Alignment: NC_005004 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... epidermidis ATCC 12228] ... Length = 258 ... Query: 159 PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGY...FISFEAPNAQNTALTLHQ 218 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFE...APNAQNTALTLHQ Sbjct: 1 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFEAPNAQNTALTLHQ 60 ... Query: 279 FQTVNQT
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available oduct ... [Photorhabdus luminescens subsp. laumondii TTO1] ... Length = 218 ... Query: 87 ... LEQKMTTDIPSAS...LTQKGVVQLTNVVGNSDTLAVTQKLVQEVINSLREYTREEIDNRMKT 146 ... LEQKMTTDIPSAS...LTQKGVVQLTNVVGNSDTLAVTQKLVQEVINSLREYTREEIDNRMKT Sbjct: 1 ... LEQKMTTDIPSASLTQKGVVQLTNVVGNSDTLAVTQKLVQEVINSLR
30 CFR 218.540 - How does MMS serve official correspondence?
2010-07-01
... agent; (ii) Any corporate officer; or (iii) The addressee of record shown in the files of any State Secretary; Corporate Commission; Federal or state agency that keeps official records of business entities or... delivery made pursuant to the law of the State in which the service is effected; or (3) Private mailing...
218. Asistencia circulatoria de larga duración. Experiencia inicial
Directory of Open Access Journals (Sweden)
J. Otero
2012-04-01
Conclusiones: La asistencia ventricular de larga duración es una terapia segura y efectiva en pacientes con cardiopatías terminales, ya sea como puente a trasplante, recuperación o terapia de destino.
ORF Alignment: NC_005126 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available oduct ... [Photorhabdus luminescens subsp. laumondii TTO1] ... Length = 104 ... Query: 218 QDLQRWAQANLQGISGLQDMATH...MNLSIRHLGRLFRQELNMKAGVWLEHARIEKARTLLE 277 ... QDLQRWAQANLQGISGLQDMATH...MNLSIRHLGRLFRQELNMKAGVWLEHARIEKARTLLE Sbjct: 1 ... QDLQRWAQANLQGISGLQDMATHMNLSIRHLGRLFRQELNMKAGVWLEHARIEKARTLLE 60 ...
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available aC family ... [Gluconobacter oxydans 621H] ... Length = 94 ... Query: 159 RVANTLSDNPADNRDQKDWAELA...AMSLRSFVRHFTLETGLPFSVWRQRLRILNAQEKLAR 218 ... RVANTLSDNPADNRDQKDWAELAAMSLR...SFVRHFTLETGLPFSVWRQRLRILNAQEKLAR Sbjct: 1 ... RVANTLSDNPADNRDQKDWAELAAMSLRSFVRHFTLETGLPFSVWRQRLRILNAQEKLAR 60 ...
ORF Alignment: NC_004193 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available s ... iheyensis HTE831] ... Length = 156 ... Query: 98 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYH...SFSFAHWFSFNLNYIVGNA 157 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYHSFSFA...HWFSFNLNYIVGNA Sbjct: 1 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYHSFSFAHWFSFNLNYIVGNA 60 ... Query: 218 YADFVI
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
International Nuclear Information System (INIS)
Bujoreanu, D.; Popescu, I.V.
2006-01-01
A spent sealed radioactive source(SRS) is a high integrity capsule which contains a small amount of concentrated radionuclide with an activity which ranges from a few MBq up to levels of hundreds TBq. Presently, there are now many spent and unusable SRS in Romania, which have been used a long time in various industrial applications (smoke detectors, weld testing etc.). Considering the activity of the Radioactive Waste Treatment Plant (STDR) at the Institute for Nuclear Research Pitesti regarding radioactive source collecting from various economic agents, several radioactive sources are held in the intermediate storage deposit facility on the institute platform awaiting conditioning for the final disposal. This paper presents the conditioning technology for this sources, which has as ultimate purpose to completion of a product which matches the waste acceptance requirements imposed by the National Authority Control of Nuclear Activities, CNCAN, for the disposal site DNDR Baita - Bihor. The technology used for obtaining the final product allows two options for the immobilization of the sources in the 218 L steel drum and these are: Sources placed in the original packages and which can not be dismantled will be isolated by encapsulation in 10 litters metal capsules and then conditioned in 218 l steel drum, with a concrete biological shielding; Sources removed from the initial package are isolated in stainless steel capsules, which are to be conditioned in the same 218 L steel drum. The final product obtained as a result of the concrete conditioning operations of the spent SRS in 218 L steel drum is the steel drum - concrete - low radioactive waste assembly which presents itself as a concrete block which includes one or more capsules containing SRS. (author)
Energy Technology Data Exchange (ETDEWEB)
Machaj, B. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)
1996-12-31
Employing an earlier elaborated computer program for simulation of depositing radon decay products: {sup 214}Po, {sup 214}Pb, {sup 214}Bi ({sup 214}Po) on air filter and for computing variation of their activity against time, an assessment of errors was carried out of a methods employing measurement of {sup 218}Po + {sup 214}Po alpha activity in three time intervals. Additionally errors of the methods measuring {sup 218}Po + {sup 214}Po alpha activity in three, two and one time intervals, were assessed. A few attempts were also made to measure the alpha activity in different time intervals and to assess their measuring errors. (authors). 10 refs, 4 figs, 14 tabs.
Marsden, Danica; Gralla, Megan; Marriage, Tobias A.; Switzer, Eric R.; Partridge, Bruce; Massardi, Marcella; Morales, Gustavo; Addison, Graeme; Bond, J. Richard; Crighton, Devin;
2014-01-01
We present a catalogue of 191 extragalactic sources detected by the Atacama Cosmology Telescope (ACT) at 148 and/or 218 GHz in the 2008 Southern survey. Flux densities span 14 -1700 mJy, and we use source spectral indices derived using ACT-only data to divide our sources into two subpopulations: 167 radio galaxies powered by central active galactic nuclei (AGN) and 24 dusty star-forming galaxies (DSFGs). We cross-identify 97 per cent of our sources (166 of the AGN and 19 of the DSFGs) with those in currently available catalogues. When combined with flux densities from the Australia Telescope 20 GHz survey and follow-up observations with the Australia Telescope Compact Array, the synchrotron-dominated population is seen to exhibit a steepening of the slope of the spectral energy distribution from 20 to 148 GHz, with the trend continuing to 218 GHz. The ACT dust-dominated source population has a median spectral index, A(sub 148-218), of 3.7 (+0.62 or -0.86), and includes both local galaxies and sources with redshift around 6. Dusty sources with no counterpart in existing catalogues likely belong to a recently discovered subpopulation of DSFGs lensed by foreground galaxies or galaxy groups.
Regional aerosol deposition in human upper airways
International Nuclear Information System (INIS)
Swift, D.L.
1991-01-01
During the current report experimental studies of upper respiratory deposition of radon progeny aerosols and stimulant aerosols were carried out in replicate casts of nasal and oral passages of adults and children. Additionally, preliminary studies of nasal passage deposition of unattached Po 218 particles was carried out in four human subjects. Data on nasal inspiratory deposition in replicate models of adults and infants from three collaborating laboratories were compared and a best-fit curve of deposition efficiency for both attached and unattached particles was obtained, showing excellent inter-laboratory agreement. This curve demonstrates that nasal inspiratory deposition of radon progeny is weakly dependent upon flow rate over physiologically realistic ranges of flow, does not show a significant age effect, and is relatively independent of nasal passage dimensions for a given age range. Improved replicate models of the human adult oral passage extending to the mid-trachea were constructed for medium and higher flow mouth breathing states; these models were used to assess the deposition of unattached Po 218 particles during oronasal breathing in the oral passage and demonstrated lower deposition efficiency than the nasal passage. Measurements of both Po 218 particle and attached fraction particle size deposition were performed in replicate nasal passage of a four week old infant. 5 refs., 1 fig
Measurement of airborne radon daughters - a Bayesian approach
International Nuclear Information System (INIS)
Groer, P.G.; Lo, Y.
1997-01-01
The standard mathematical treatment of the build-up and decay of airborne radionuclides on a filter paper uses the solutions of the so-called Bateman equations adapted to the sampling process. These equations can be interpreted as differential equations for the expectation of an underlying stochastic process, which describes the random fluctuations in the accumulation and decay of the sampled radioactive atoms. The probability distribution for the number of 218 Po, 214 Pb and 214 Bi atoms, accumulated after sampling time t, is the product of three Poisson distributions. It is shown that the distribution of the number of counts, registered by a detector with efficiency ε during a counting period T after the end of sampling, is also the product of three Poisson distributions. Its mean is dependent on ε, t, T, flow rate, and N A 0 , N B 0 and N C 0 , the number of 218 Po, 214 Pb and 214 Bi atoms per unit volume. This joint Poisson distribution was used to construct the likelihood given the observed number of counts. Using Bayes' Theorem posterior densities were obtained for N A 0 , N B 0 and N C 0 . These densities characterise the remaining uncertainty about the unknown airborne concentrations of 218 Po, 214 Pb and 214 Bi atoms. (author)
2018-01-01
Background The instantaneous spread of information, low costs, and broad availability of information and communication technologies (ICTs) make them an attractive platform for managing care, patient communication, and medical interventions in cancer treatment. There is little information available in Latin America about the level of usage of ICTs for and by cancer patients. Our study attempts to fill this gap. Objective The aim of this study was to assess the level of ICT use and patterns of preferences among cancer patients. Methods We conducted an anonymous cross-sectional survey study in 500 Ecuadorian cancer patients. This questionnaire consisted of 22 items about demographic and clinical data, together with the preferences of people who use ICTs. Chi-square, crude, and adjusted logistic regressions were performed. Results Of the total, 43.2% (216/500) of participants reported that they had access to the Internet, and 25.4% (127/500) reported that they neither owned a cell phone nor did they have access to the Internet. The Internet constituted the highest usage rate as a source of information about malignant diseases (74.3%, 162/218) regardless of age (PWhatsApp (66.5%, 145/218) and short message service (SMS) text messaging (61.0%, 133/218) were widely reported as interesting communication channels. Similarly, WhatsApp (72.0%, 157/218) followed by SMS (63.8%, 139/218) were reported as the preferred ICTs through which patients would like to ask physicians about diseases. Adjusted regression analysis showed that patients aged between 40 and 64 years were more likely to be interested in receiving information through SMS (odds ratio, OR 5.09, 95% CI 1.92-13.32), as well as for asking questions to physicians through this same media (OR 9.78, CI 3.45-27.67) than the oldest group. Conclusions WhatsApp, SMS, and email are effective and widely used ICTs that can promote communication between cancer patients and physicians. According to age range, new ICTs such as
International Nuclear Information System (INIS)
Sudo, Y.; Kaminaga, M.
1990-01-01
The effects of channel gap size on mixed forced and free convective heat transfer characteristics were experimentally investigated for water flowing near atmospheric pressure in a 750 mm long and 50 mm wide channel heated from both sides. The channel gap sizes investigated were 2.5, 6, 18 and 50 mm. Experiments were carried out for both aiding and opposing forced convective flows with a Reynolds number Re x of 4x10 to 6x10 6 and a Grashof number Gr x of 2x10 4 to 6x10 11 , where the distance x from the inlet of the channel is adopted as the characteristic length in Re x and Gr x . As for the results, the following were revealed for the parameters ranges investigated in this study. (1) When the dimensionless parameter, Gr x /Re x 21/8 Pr 1/2 is less than 10 -4 , the flow shows the nature of forced convective heat transfer for a channel with any channel gap size in both aiding and opposing flows. (2) When Gr x /Re x 21/8 Pr 1/2 is larger than 10 -2 , the flow shows the nature of free convective heat transfer for a channel with any channel gap size in both aiding and opposing flows. (3) When Gr x /Re x 21/8 Pr 1/2 is between 10 -4 and 10 -2 for the channel with a channel gap size equal to or larger than 6 mm, the heat transfer coefficients in both aiding and opposing flows become, on the average, higher than those predicted by the previous correlations for either the pure turbulent forced convection or the pure free convection, and can be expressed in simple forms with a combination of Gr x /Re x 21/8 Pr 1/2 and the previous correlation for either the pure turbulent forced convection or the free convection along a flat plate. (4) When Gr x /Re x 21/8 Pr 1/2 is between 10 -4 and 10 -2 for the channel with a channel gap size of 2.5 mm, the heat transfer coefficients in both aiding and opposing flows also become, on the average, higher than those predicted by the previous correlations for either the pure turbulent forced convection or the pure free convection. (orig./GL)
40 CFR 79.68 - Salmonella typhimurium reverse mutation assay.
2010-07-01
...) AIR PROGRAMS (CONTINUED) REGISTRATION OF FUELS AND FUEL ADDITIVES Testing Requirements for... of E. coli: partial purification and some properties,” Journal of Biological Chemistry. 218:97-106...
Fledelius, Joan; Khalil, Azza Ahmed; Hjorthaug, Karin; Frøkiaer, Jørgen
2016-04-01
The demand for early-response evaluation with 2'-deoxy-2'-[18F] fluoro-D-glucose (F-18-FDG) positron emission tomography combined with whole body CT (PET/CT) is rapidly growing. This study was initiated to evaluate the applicability of the PET response criteria in solid tumours (PERCIST 1.0) for response evaluation. We performed a retrospective study of 21 patients with locally advanced non-small cell lung cancer (NSCLC), who had undergone both a baseline and a follow-up F-18-FDG-PET/CT scan during their treatments. The scans were performed at our institution in the period September 2009 and March 2011 and were analysed visually and according to PERCIST 1.0 by one board-certified nuclear medicine physician. The response was compared with overall survival (OS) and progression-free survival (PFS). The variation in key parameters affecting the F-18-FDG uptake was assessed. A kappa of 0.94 corresponding to an almost perfect agreement was found for the comparison of the visual evaluation with PERCIST. Patients with partial metabolic response and stable metabolic disease (as evaluated by PERCIST 1.0) had statistically significant longer median time to progression: 8.4 months (confidence interval (CI) 5.1-11.8 months) as compared with 2.7 months (CI 0-5.6 months) in patients classified with progression. The variation in uptake time between baseline and follow-up scans was more than the recommended 15 min in 48% of patients. PERCIST 1.0 is readily implementable and highly comparable with visual evaluation of response using early F-18-FDG-PET/CT scanning for locally advanced NSCLC patients. In spite of variations in parameters affecting F-18-FDG uptake, evaluation of F-18-FDG-PET/CT during treatment with PERCIST 1.0 is shown to separate non-responders from responders, each with statistically significant differences in both OS and PFS. © 2015 The Royal Australian and New Zealand College of Radiologists.
Morphine sparing effect of low dose ketamine during patient ...
African Journals Online (AJOL)
Adele
2003-09-12
Sep 12, 2003 ... KEY WORDS: Ketamine, morphine sparing effect, patient controlled intravenous analgesia. ... Measurements: Morphine consumption, visual analogue pain score (VAPS), pulse ..... Brain Research, 1990; 518: 218-222. 7.
2011-04-06
... state non-profit/advocacy organizations. One letter was submitted by a private company, and 218 letters... Guidelines. Non-cash benefits could include such services as employment assistance, childcare, or...
78 FR 20106 - Ocean Transportation Intermediary License Applicants
2013-04-03
... M. Tsai, President (QI). Application Type: New NVO License. American International Shipping Company... Type: New NVO License. Nippon Concept America, LLC (OFF), 2203 Timberloch Place, Suite 218D, The...
Victor Hugo, ‚Les Misérables´ (1862)
Krauss, Henning
1999-01-01
Victor Hugo, ‚Les Misérables´ (1862). - In: 19. Jahrhundert - Roman / Friedrich Wolfzettel (Hrsg.). - Tübingen : Stauffenburg-Verl., 1999. - S. 185-218. - (Stauffenburg Interpretation : Französische Literatur)
29 CFR 501.5 - Waiver of rights prohibited.
2010-07-01
... OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE... public policy except as follows: (a) Waivers or modifications of rights or obligations hereunder in favor...
2010-07-01
... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... cover the enforcement of all contractual obligation provisions applicable to the employment of H-2A...
2010-07-01
... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... demonstrating its ability to discharge financial obligations under the H-2A program. The original bond...
29 CFR 502.32 - Contents of notice.
2010-07-01
... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... covered contractual obligation, the amount of any civil money penalty assessment and the reason or reasons...
Stereotactic radiosurgery using the gamma knife
Energy Technology Data Exchange (ETDEWEB)
Kawamoto, Shunsuke; Sasaki, Tomio; Matsutani, Masao; Takakura, Kintomo; Terahara, Atsuro (Tokyo Univ. (Japan). Faculty of Medicine)
1992-03-01
Since stereotactic radiosurgery using a gamma knife was developed in 1968 by Leksell, it has been used with increasing frequency in Japan. During the period from June 19, 1990 through December 20, 1991, 218 patients have been treated with stereotactic radiosurgery using a gamma knife. Of them, 116 had vascular lesions (116), including arteriovenous malformation (114), dural arteriovenous malformation (one), and cerebral aneurysm (one); and the other 102 had tumorous lesions, including acoustic neurinoma (48), meningioma (26), pituitary tumor (11), metastatic tumor (7), germ cell tumor (3), glioma (2), hemangioblastoma (2), chordoma (one), craniopharyngioma (one), and trigeminal neurinoma (one). In this article, candidates of stereotactic radiosurgery using a gamma knife are discussed, with particular attention to clinical results of the aforementioned 218 patients. (N.K.) 54 refs.
Solid oxide fuel cell power plant with an anode recycle loop turbocharger
Saito, Kazuo; Skiba, Tommy; Patel, Kirtikumar H.
2015-07-14
An anode exhaust recycle turbocharger (100) has a turbocharger turbine (102) secured in fluid communication with a compressed oxidant stream within an oxidant inlet line (218) downstream from a compressed oxidant supply (104), and the anode exhaust recycle turbocharger (100) also includes a turbocharger compressor (106) mechanically linked to the turbocharger turbine (102) and secured in fluid communication with a flow of anode exhaust passing through an anode exhaust recycle loop (238) of the solid oxide fuel cell power plant (200). All or a portion of compressed oxidant within an oxidant inlet line (218) drives the turbocharger turbine (102) to thereby compress the anode exhaust stream in the recycle loop (238). A high-temperature, automotive-type turbocharger (100) replaces a recycle loop blower-compressor (52).
Lifescience Database Archive (English)
Full Text Available LE ... Aspects of innate immunity in Sjogren's syndrome. ... JOURNAL ... Arthritis Res Ther 13:218 (2011) DOI:10... Sjogren's syndrome and other sicca syndromes. ... JOURNAL ... Arthritis Res Ther 13:
2012-12-06
... States Steel Corporation (``U.S. Steel''); ArcelorMittal USA LLC (``AMUSA''); and Nucor Corporation (``Nucor''), within the deadline specified in 19 CFR 351.218(d)(1)(i). The domestic interested parties...
Läänemere-ruum uurimisainese ja mõistena / Juhan Kreem
Kreem, Juhan
2007-01-01
Rets. rmt.: The Baltic as a Multicultural World : Sea, Region and Peoples. Marko Lehti (ed.). (The Baltic Sea Region : Nordic Dimensions - European Perspectives 4). Berliner Wissenschafts-Verlag, Berlin, 2005. 218 lk.
2010-07-01
... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... the Administrator, WHD after notice and an opportunity for hearing when it is shown based on objective...
29 CFR 501.2 - Coordination between Federal agencies.
2010-07-01
... ENFORCEMENT OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF.... (a) Complaints received by ETA or any State Workforce Agency (SWA) regarding contractual H-2A labor...
29 CFR 502.4 - Waiver of rights prohibited.
2010-07-01
... OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE... public policy, except that a waiver or modification of rights or obligations hereunder in favor of the...
23 CFR 450.218 - Self-certifications, Federal findings, and Federal approvals.
2010-04-01
... discrimination on the basis of race, color, creed, national origin, sex, or age in employment or business... involvement of disadvantaged business enterprises in USDOT funded projects; (5) 23 CFR part 230, regarding... consideration will be given to projects and strategies involving the operation and management of the multimodal...
Routine plasma analysis for 2-[18F]fluorotyrosine by SAX-cartridges
International Nuclear Information System (INIS)
Kling, P.; Coenen, H.H.; Stoecklin, G.
1990-01-01
There is a great necessity for simple, reliable, and fast methods of plasma analysis. While HPLC is generally the most effective method, it is rather time consuming and expensive in a routine setting with numerous plasma samples. The authors have developed a new method for determination of the amino acid analogue 2-[ 18 F]fluorotyrosine using SAX columns (Adsorbex R SAX, 400 mg, Merck). The results obtained agree within 5% with those determined by reverse phase HPLC
29 CFR 779.218 - Methods to accomplish “unified operation.”
2010-07-01
..., join together to perform some or all of their activities as a unified business or business system. They may accomplish such unification through agreements, franchises, grants, leases, or other arrangements... others so that they constitute a single business or unified business system. Whether in any particular...
Ultrafast Wiggling and Jiggling: Ir2(1,8-diisocyanomenthane)4 2+
Czech Academy of Sciences Publication Activity Database
Pižl, Martin; Hunter, B. M.; Greetham, G. M.; Towrie, M.; Záliš, Stanislav; Gray, H. B.; Vlček, Antonín
2017-01-01
Roč. 121, č. 48 (2017), s. 9275-9283 ISSN 1089-5639 R&D Projects: GA ČR GA17-01137S; GA MŠk(CZ) LTC17052 Institutional support: RVO:61388955 Keywords : Coherent oscillations * Inter-system crossings * Optical spectroscopic Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.847, year: 2016
38 CFR 1.218 - Security and law enforcement at VA facilities.
2010-07-01
... physician) is prohibited. The introduction or possession of alcoholic beverages or any narcotic drug... soliciting and vending of all kinds, displaying or distributing commercial advertising, or collecting private... activities. (10) Photographs for news, advertising, or commercial purposes. Photographs for advertising or...
20 CFR 218.44 - When a remarried widow(er) annuity ends.
2010-04-01
...(er)— (1) Dies; (2) Becomes entitled to an old age benefit under the Social Security Act that is equal...) remarries unless the marriage is to an individual entitled to a retirement, disability, widow(er)'s, father...
20 CFR 218.43 - When a surviving divorced spouse annuity ends.
2010-04-01
... Act that is equal to or larger than the amount of the full surviving divorced spouse annuity before... which the surviving divorced spouse remarries unless the marriage is to an individual entitled to a...
2-18F-fluoro-2-deoxyglucose positron emission tomography in delirium.
Haggstrom, Lucy R; Nelson, Julia A; Wegner, Eva A; Caplan, Gideon A
2017-11-01
Delirium is a common, serious, yet poorly understood syndrome. Growing evidence suggests cerebral metabolism is fundamentally disturbed; however, it has not been investigated using 2- 18 F-fluoro-2-deoxyglucose (FDG) positron emission tomography (PET) in delirium. This prospective study thus explored FDG PET patterns of cerebral glucose metabolism in older inpatients with delirium. A particular emphasis was on the posterior cingulate cortex (PCC), a key region for attention, which is a central feature of delirium. Delirium scans were compared with post-delirium scans using visual analysis and semi-quantitative analysis with NeuroQ; 13 participants (8 female, median 84 y) were scanned during delirium, and 6 scanned again after resolution. On visual analysis, cortical hypometabolism was evident in all participants during delirium (13/13), and improved with delirium resolution (6/6). Using NeuroQ, glucose metabolism was higher post-delirium in the whole brain and bilateral PCC compared to during delirium ( p delirium duration. This research found widespread, reversible cortical hypometabolism during delirium and PCC hypometabolism was associated with inattention during delirium.
2010-01-05
... Department contact Tissue Paper Products from the People's Brandon Farlander (202) 482-0182. Republic of... Sunset Reviews are set forth in 19 CFR 351.218. Guidance on methodological or analytical issues relevant...
National Research Council Canada - National Science Library
Wang, Guang-Jia
1996-01-01
The substrate specificity in solvolysis reactions of p-nitrophenyl alkanoates 2 (n=2-18) catalyzed by 4-(dialkylamino)pyridine-functionalized polymer 1 can be controlled by the concentration of 1 in 1...
Empirická krajina v románové krajinné vizi. Reprezentace prostoru v Balzakových Šuanech
Czech Academy of Sciences Publication Activity Database
Hrbata, Zdeněk
2012-01-01
Roč. 22, č. 45 (2012), s. 218-241 ISSN 0862-8440 Institutional support: RVO:68378068 Keywords : historical novel * narrative situation * mimetic landscape * semiotic area Subject RIV: AJ - Letters, Mass-media, Audiovision
Regional aerosol deposition in human upper airways
Energy Technology Data Exchange (ETDEWEB)
Swift, D.L.
1991-11-01
During the current report experimental studies of upper respiratory deposition of radon progeny aerosols and stimulant aerosols were carried out in replicate casts of nasal and oral passages of adults and children. Additionally, preliminary studies of nasal passage deposition of unattached Po{sup 218} particles was carried out in four human subjects. Data on nasal inspiratory deposition in replicate models of adults and infants from three collaborating laboratories were compared and a best-fit curve of deposition efficiency for both attached and unattached particles was obtained, showing excellent inter-laboratory agreement. This curve demonstrates that nasal inspiratory deposition of radon progeny is weakly dependent upon flow rate over physiologically realistic ranges of flow, does not show a significant age effect, and is relatively independent of nasal passage dimensions for a given age range. Improved replicate models of the human adult oral passage extending to the mid-trachea were constructed for medium and higher flow mouth breathing states; these models were used to assess the deposition of unattached Po{sup 218} particles during oronasal breathing in the oral passage and demonstrated lower deposition efficiency than the nasal passage. Measurements of both Po{sup 218} particle and attached fraction particle size deposition were performed in replicate nasal passage of a four week old infant. 5 refs., 1 fig.
Directory of Open Access Journals (Sweden)
Kathryn Curtis
2016-01-01
Full Text Available Introduction. The purpose of this study was to evaluate a specialized yoga intervention for inpatients in a rehabilitation and complex continuing care hospital. Design. Single-cohort repeated measures design. Methods. Participants (N=10 admitted to a rehabilitation and complex continuing care hospital were recruited to participate in a 50–60 min Hatha Yoga class (modified for wheelchair users/seated position once a week for eight weeks, with assigned homework practice. Questionnaires on pain (pain, pain interference, and pain catastrophizing, psychological variables (depression, anxiety, and experiences with injustice, mindfulness, self-compassion, and spiritual well-being were collected at three intervals: pre-, mid-, and post-intervention. Results. Repeated measures ANOVAs revealed a significant main effect of time indicating improvements over the course of the yoga program on the (1 anxiety subscale of the Hospital Anxiety and Depression Scale, F(2,18 = 4.74, p<.05, and ηp2 = .35, (2 Self-Compassion Scale-Short Form, F(2,18 = 3.71, p<.05, and ηp2 = .29, and (3 Magnification subscale of the Pain Catastrophizing Scale, F(2,18 = 3. 66, p<.05, and ηp2 = .29. Discussion. The results suggest that an 8-week Hatha Yoga program improves pain-related factors and psychological experiences in individuals admitted to a rehabilitation and complex continuing care hospital.
Czech Academy of Sciences Publication Activity Database
Navas, F.; Perfahl, S.; Garino, C.; Salassa, L.; Nováková, Olga; Navarro-Ranninger, C.; Bednarski, P.J.; Malina, Jaroslav; Quiroga, Adoración G.
2015-01-01
Roč. 153, DEC2015 (2015), s. 211-218 ISSN 0162-0134 Institutional support: RVO:68081707 Keywords : Metallodrug photoactivaton * Platinum drugs * DNA interactions Subject RIV: BO - Biophysics Impact factor: 3.205, year: 2015
2012-01-30
... ask us in your comment to withhold your personal identifying information from public review, we cannot... Theatre, (Movie Theaters of Iowa MPS) 218 Main St., Sioux Rapids, 12000030 OHIO Cuyahoga County Jones Home...
International Nuclear Information System (INIS)
Kuznetsov, V.K.; Sanzharova, N.I.; Alexakhin, R.M.
2002-01-01
The ability to supply P to plants (agronomic effectiveness) of local rock phosphates (RP) from the Polpino deposit in the Bryansk region was determined in a Sod-podzolic acid soil. In addition, the effectiveness of using the RP to reduce 137 Cs accumulation in barley was also studied. A series of greenhouse experiments were carried out using 32 P and 137 Cs as tracers. Standard methods for soil analysis and evaluation of chemical status of RP in soil were employed. The grain yield increased by 17.7, 44.3 and 57.5% compared to the control at rates of 21.8, 43.6 and 87.2 mg P/kg soil, respectively. The relative availability of phosphorus from RP applied at a rate of 21.8 P mg/kg soil was 56.1% compared to superphosphate and reached 74.5 and 81.3% at rates of 43.6 and 87.2 mg P/kg soil. The uptake of P by plants was increased with the increase in the rates of the fertilizers applied, but the percent of P fertilizer utilization decreased. The amount of P used by plants from fertilizers depended on the type and rates of P fertilizers. With an increase in SP rates from 21.8 to 87.2 mg/kg soil, the use of fertilizer P by plants dropped from 32.6 to 21.9%. For local RP, these differences were less pronounced with the percent of the total amount of P used by plants 2.1 times less than that from SP. The application of local RP at rates of 43.6 and 87.2 mg P/ kg soil resulted in a 1.3-fold decrease in 137 Cs accumulation in grain and straw of crops. At a rate of 21.8 mg P/kg soil, the differences in 137 Cs accumulation between grain and straw were insignificant compared to the control. (author)
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
Cell Phones, Tablets, and Other Mobile Technology for Users with Visual Impairments
... research. Share: Email Print Like (218 Likes) Cell Phones, Tablets, and Other Mobile Technology Touchscreen Smartphone Accessibility for People with Visual Impairments and Blindness The Benefits of Accessible Touchscreen Mobile Devices for People with ...
2012-02-17
... Robin Baird, Ph.D., Cascadia Research, 218\\1/2\\ W. 4th Avenue, Olympia, WA 98501, has applied in due...) social organization, (5) feeding ecology, and (6) disease monitoring of the targeted species. Harassment...
76 FR 10560 - Marine Mammals; File No. 15530
2011-02-25
... Robin Baird, PhD, Cascadia Research, 218 [frac12] W. 4th Avenue, Olympia, WA 98501, has applied in due...) social organization, (5) feeding ecology, and (6) disease monitoring. Harassment of all species of...
Cherrez Ojeda, Ivan; Vanegas, Emanuel; Torres, Michell; Calderón, Juan Carlos; Calero, Erick; Cherrez, Annia; Felix, Miguel; Mata, Valeria; Cherrez, Sofia; Simancas, Daniel
2018-02-20
The instantaneous spread of information, low costs, and broad availability of information and communication technologies (ICTs) make them an attractive platform for managing care, patient communication, and medical interventions in cancer treatment. There is little information available in Latin America about the level of usage of ICTs for and by cancer patients. Our study attempts to fill this gap. The aim of this study was to assess the level of ICT use and patterns of preferences among cancer patients. We conducted an anonymous cross-sectional survey study in 500 Ecuadorian cancer patients. This questionnaire consisted of 22 items about demographic and clinical data, together with the preferences of people who use ICTs. Chi-square, crude, and adjusted logistic regressions were performed. Of the total, 43.2% (216/500) of participants reported that they had access to the Internet, and 25.4% (127/500) reported that they neither owned a cell phone nor did they have access to the Internet. The Internet constituted the highest usage rate as a source of information about malignant diseases (74.3%, 162/218) regardless of age (PWhatsApp (66.5%, 145/218) and short message service (SMS) text messaging (61.0%, 133/218) were widely reported as interesting communication channels. Similarly, WhatsApp (72.0%, 157/218) followed by SMS (63.8%, 139/218) were reported as the preferred ICTs through which patients would like to ask physicians about diseases. Adjusted regression analysis showed that patients aged between 40 and 64 years were more likely to be interested in receiving information through SMS (odds ratio, OR 5.09, 95% CI 1.92-13.32), as well as for asking questions to physicians through this same media (OR 9.78, CI 3.45-27.67) than the oldest group. WhatsApp, SMS, and email are effective and widely used ICTs that can promote communication between cancer patients and physicians. According to age range, new ICTs such as Facebook are still emerging. Future studies should
Homophobia in a University Community: Attitudes and Experiences of Heterosexual Freshmen.
D'Augelli, Anthony R.; Rose, Melissa L.
1990-01-01
Examined attitudes toward homosexuals in college freshmen (n=218). Found widespread hostile attitudes about homosexuals. Results indicated men knew fewer homosexual men, were more homophobic, and made more derogatory remarks than did women. (Author/ABL)
African Journal of Biomedical Research - Vol 13, No 3 (2010)
African Journals Online (AJOL)
Effects of Extracts of Portulaca oleracea on Reproductive Functions in Female Albino Rats · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KO Oyedeji, AF Bolarinwa, 213-218 ...
2012-04-02
... contact Polyester Staple Fiber from the Jennifer Moats, (202) 482-5047. People's Republic of China (A-570... Reviews are set forth in 19 CFR 351.218. Guidance on methodological or analytical issues relevant to the...
Search Results | Page 8 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... Mexico 218 Apply Mexico filter · United States 203 Apply United States filter ... RESEARCH filter · POLITICAL REFORM 2 Apply POLITICAL REFORM filter ... Networked Economies filter · Growth and Economic Opportunities for Women 1 ...
Prostor básně (triptychy Dům daleko a Ianus tří tváří)
Czech Academy of Sciences Publication Activity Database
Košnarová, Veronika
2010-01-01
Roč. 58, č. 2 (2010), s. 218-230 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * poetry * Linhartová, Věra Subject RIV: AJ - Letters, Mass-media, Audiovision
Digital Repository Service at National Institute of Oceanography (India)
Padate, V.P.; Rivonker, C.U.; Anil, A.C.
. Current Science 83(3), 214-218. Anon. (1989) Loss of biological diversity: A global crisis requiring international solutions. Washington DC: National Science Foundation. Ansari Z.A., Chatterji A., Ingole B.S., Sreepada R.A., Rivonkar C...
"Protože mám jenom svůj hlas..." (Rozhlasové hry Věry Linhartové)
Czech Academy of Sciences Publication Activity Database
Košnarová, Veronika
2010-01-01
Roč. 2, č. 1 (2010), s. 218-225 ISSN 1803-876X Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * drama * Linhartová, Věra Subject RIV: AJ - Letters, Mass-media, Audiovision
Effects of worked examples, example-problem, and problem-example pairs on novices’ learning
Van Gog, Tamara; Kester, Liesbeth; Paas, Fred
2010-01-01
Van Gog, T., Kester, L., & Paas, F. (2011). Effects of worked examples, example-problem, and problem-example pairs on novices’ learning. Contemporary Educational Psychology, 36(3), 212-218. doi:10.1016/j.cedpsych.2010.10.004
Czech Academy of Sciences Publication Activity Database
Dolný, A.; Šigutová, H.; Ožana, S.; Choleva, Lukáš
2018-01-01
Roč. 218, č. 3 (2018), s. 110-117 ISSN 0006-3207 Institutional support: RVO:67985904 Keywords : conservation translocation * dragonfly reintroduction * odonata Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.022, year: 2016
Understanding of the risk of HIV infection among the elderly in Ga ...
African Journals Online (AJOL)
Eucebious Lekalakala-Mokgele
2014-06-24
Medunsa. Campus) ..... Sex. All females. 32. 100.0. Marital status. Single. 7. 21.8. Married. 17. 53.1 ..... younger generation and is associated with gender inequalities ... stereotypes which perpetuate the myth that the elderly are not.
Czech Academy of Sciences Publication Activity Database
Kanda, Roman
2017-01-01
Roč. 34, č. 108 (2017), s. 218-223 ISSN 0862-7045 Institutional support: RVO:68378068 Keywords : political philosophy * European Left * ideology * universalism and particularism Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures
Lifescience Database Archive (English)
Full Text Available FV Structural polyprotein OS=Barmah forest virus... 29 6.3 >sp|Q12594|DMAW_CLAFS ...+ + + C++ PPS S L HF Sbjct: 218 HCAVSTTHQTPDWFPLLCVQSPPSTSPFLGHF 249 >sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest
African Health Sciences - Vol 13, No 2 (2013)
African Journals Online (AJOL)
African Health Sciences. ... African Health Sciences - Vol 13, No 2 (2013) ... S Musisi, D Akena, E Nakimuli-Mpungu, C Abbo, J Okello, 205-218 .... Alcohol consumption and cigarette smoking pattern among brothelbased female sex workers in ...
Czech Academy of Sciences Publication Activity Database
Cejpková, J.; Gryndler, M.; Hršelová, H.; Kotrba, P.; Řanda, Z.; Synková, I.; Borovička, Jan
2016-01-01
Roč. 218, November (2016), s. 176-185 ISSN 0269-7491 Institutional support: RVO:67985831 Keywords : cadmium * ectomycorrhiza * ectomycorrhizal fungi * quantitative real-time PCR * roots * silver * soil Subject RIV: DD - Geochemistry Impact factor: 5.099, year: 2016
2011-03-01
.... Romania (A-485-805) (2nd Review). Sulfanilic Acid from the People's Republic Julia Hancock of China (A-570... Reviews are set forth in 19 CFR 351.218. Guidance on methodological or analytical issues relevant to the...
Pihlak, Monika, 1990-
2015-01-01
Kinnisasjadele eluruumidena esitatavatest nõuetest, ostja teadmisest või teadma pidamisest asja mittevastavusest, müüja teavitamiskohustusest, VÕS § 218 lg 1 kui vastutusstandardist ja rikkumisele tuginemisest, maakleri teavitamiskohustusest ja selle rikkumise tagajärgedest
American Society of Nuclear Cardiology
... Course ASNC2018 Advocacy Value Based Payment (MACRA) & Alternative Payment Models Take Action Appropriate Use Criteria Mandate (section 218 ... Merit-Based Incentive Payment System (MIPS) and Alternative Payment Models (APMs) for the 2018 performance year which begins ...
2013-10-01
... Currency, 400 7th Street SW., Suite 3E-218, Mailstop 9W-11, Washington, DC 20219. FDIC: Michael R. Evans... collection, including the validity of the methodology and assumptions used; (c) Ways to enhance the quality...
International Nuclear Information System (INIS)
Varelis, P.
1998-01-01
Full text: The intended goal of our study into the epimerisation of 2-[ 18 F]- fluoro-2-deoxy-D-glucose ([ 18 F]-FDG) was to obtain 2-[ 18 F]-fluoro- 2-deoxy-D-mannose ([ 18 F]-FDM) for the purpose of both development and validation of our analytical methods used to determine the diastereoisomeric excess of [ 18 F]-FDG prepared in our facility. The epimerisation of [ 18 F]-FDG is smoothly effected by heating an aqueous solution of this radiochemical with 1 M aqueous sodium hydroxide at 50-60 deg C for 30 min, which provides an ∼ 1:1 mixture of [ 18 F]-FDG and [ 18 F]-FDM. In addition to the value of this mixture in analytical method development, we also found it useful for gauging the performance of the HPLC column used in the analysis of [ 18 F]-FDG. The aqueous sample matrix can be conveniently changed by azeotropic evaporation of the water with dry acetonitrile. In summary, the base catalysed epimerisation of 2-[ 18 F]-fluoro-2- deoxy-D-glucose provides a convenient and reliable procedure for the preparation 2-[ 18 F]-fluoro-2-deoxy-D-mannose, the stable analogue of which is not commercially available
On the redshift distribution and physical properties of ACT-selected DSFGs
Su, T.; Marriage, T. A.; Asboth, V.; Baker, A. J.; Bond, J. R.; Crichton, D.; Devlin, M. J.; Dünner, R.; Farrah, D.; Frayer, D. T.; Gralla, M. B.; Hall, K.; Halpern, M.; Harris, A. I.; Hilton, M.; Hincks, A. D.; Hughes, J. P.; Niemack, M. D.; Page, L. A.; Partridge, B.; Rivera, J.; Scott, D.; Sievers, J. L.; Thornton, R. J.; Viero, M. P.; Wang, L.; Wollack, E. J.; Zemcov, M.
2017-01-01
We present multi-wavelength detections of nine candidate gravitationally lensed dusty star-forming galaxies (DSFGs) selected at 218 GHz (1.4 mm) from the Atacama Cosmology Telescope (ACT) equatorial survey. Among the brightest ACT sources, these represent the subset of the total ACT sample lying in Herschel SPIRE fields, and all nine of the 218 GHz detections were found to have bright Herschel counterparts. By fitting their spectral energy distributions (SEDs) with a modified blackbody model with power-law temperature distribution, we find the sample has a median redshift of z=4.1^{+1.1}_{-1.0} (68 per cent confidence interval), as expected for 218 GHz selection, and an apparent total infrared luminosity of log _{10}(μ L_IR/L_{odot }) = 13.86^{+0.33}_{-0.30}, which suggests that they are either strongly lensed sources or unresolved collections of unlensed DSFGs. The effective apparent diameter of the sample is sqrt{μ }d= 4.2^{+1.7}_{-1.0} kpc, further evidence of strong lensing or multiplicity, since the typical diameter of DSFGs is 1.0-2.5 kpc. We emphasize that the effective apparent diameter derives from SED modelling without the assumption of optically thin dust (as opposed to image morphology). We find that the sources have substantial optical depth (tau = 4.2^{+3.7}_{-1.9}) to dust around the peak in the modified blackbody spectrum (λobs ≤ 500 μm), a result that is robust to model choice.
Suma Sogi, H P; Hugar, Shivayogi M; Nalawade, Triveni Mohan; Sinha, Anjali; Hugar, Shweta; Mallikarjuna, Rachappa M
2016-01-01
The aim of this study was to assess the existing knowledge, attitude, and practices of "oral health care" in the prevention of early childhood caries (ECCs) among parents of children in Belagavi city. A cross-sectional study was conducted in the outpatient Department of Pedodontics and Preventive Dentistry, KLE VK Institute of Dental Sciences, Belagavi, Karnataka. Institutional Ethical Clearance was obtained. The study was conducted during the month of April 2014 to October 2014 after taking prior informed consent from the 218 parents. Inclusion criteria were parents getting their children treated for dental caries and who were willing to participate. Parents who could not read and write were excluded from the study. The self-administered, close-ended questionnaire was written in English. It was then translated in local languages, i.e. Kannada and Marathi, and a pilot study was conducted on 10 parents to check for its feasibility and any changes if required were done. The response rate was 100% as all 218 parents completed the questionnaire. Of 218 parents, 116 were mothers and 102 were fathers. The overall mean knowledge score was 69.5%. The overall mean attitude score was 53.5%. The overall attitude toward prevention of ECC was not in accordance to knowledge. The overall mean of "good" practices and "bad" practices score was 33.5% and 18.5%, respectively. Good knowledge and attitude toward oral health do not necessarily produce good practices.
On the Redshift Distribution and Physical Properties of ACT-Selected DSFGs
Su, T.; Marriage, T. A.; Asboth, V.; Baker, A. J.; Bond, J. R.; Crichton, D.; Devlin, M. J.; Dunner, R.; Farrah, D.; Frayer, D. T.;
2016-01-01
We present multi-wavelength detections of nine candidate gravitationally-lensed dusty starforming galaxies (DSFGs) selected at 218 GHz (1.4 mm) from the ACT equatorial survey. Among the brightest ACT sources, these represent the subset of the total ACT sample lying in Herschel SPIRE fields, and all nine of the 218 GHz detections were found to have bright Herschel counterparts. By fitting their spectral energy distributions (SEDs) with a modified blackbody model with power-law temperature distribution, we find the sample has a median redshift of 4.1 (+ 1.1, -10) (68 percent confidence interval), as expected for 218 GHz selection and an apparent total infrared luminosity of log 10(uL(sub IR)/solar luminosity) = 13.86(+0.33, -0.30), which suggests that they are either strongly lensed sources or unresolved collections of unlensed DSFGs. The effective apparent diameter of the sample is square root of mu d = 4.2 (+ 1.7, -1.0) kpc, further evidence of strong lensing of multiplicity, since the typical diameter of dusty star-forming galaxies is 1.0-2.5 kpc. We emphasize that the effective apparent diameter derives from SED modeling without the assumption of opticaly thin dust (as opposed to image morphology). We find that the sources have substantial optical depth (tau = (4.2+, -1.9) of dust around the peak in the modified blackbody spectrum (lambda obs is less than 500 micrometers), a result that is robust to model choice.
Search Results | Page 28 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 271 - 280 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...
Search Results | Page 35 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 341 - 350 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...
Heparin binding sites on Ross River virus revealed by electron cryo-microscopy
International Nuclear Information System (INIS)
Zhang Wei; Heil, Marintha; Kuhn, Richard J.; Baker, Timothy S.
2005-01-01
Cell surface glycosaminoglycans play important roles in cell adhesion and viral entry. Laboratory strains of two alphaviruses, Sindbis and Semliki Forest virus, have been shown to utilize heparan sulfate as an attachment receptor, whereas Ross River virus (RRV) does not significantly interact with it. However, a single amino acid substitution at residue 218 in the RRV E2 glycoprotein adapts the virus to heparan sulfate binding and expands the host range of the virus into chicken embryo fibroblasts. Structures of the RRV mutant, E2 N218R, and its complex with heparin were determined through the use of electron cryo-microscopy and image reconstruction methods. Heparin was found to bind at the distal end of the RRV spikes, in a region of the E2 glycoprotein that has been previously implicated in cell-receptor recognition and antibody binding
Radiation shielding design for DECY-13 cyclotron using Monte Carlo method
International Nuclear Information System (INIS)
Rasito T; Bunawas; Taufik; Sunardi; Hari Suryanto
2016-01-01
DECY-13 is a 13 MeV proton cyclotron with target H_2"1"8O. The bombarding of 13 MeV protons on target H_2"1"8O produce large amounts of neutrons and gamma radiation. It needs the efficient radiation shielding to reduce the level of neutrons and gamma rays to ensure safety for workers and public. Modeling and calculations have been carried out using Monte Carlo method with MCNPX code to optimize the thickness for the radiation shielding. The calculations were done for radiation shielding of rectangular space room type with the size of 5.5 m x 5 m x 3 m and thickness of 170 cm made from lightweight concrete types of portland. It was shown that with this shielding the dose rate outside the wall was reduced to 1 μSv/h. (author)
DEFF Research Database (Denmark)
Saetre, Peter; Lundmark, Per; Wang, August
2010-01-01
Serotonin (5-hydroxytryptamin; 5-HT) alternations has since long been suspected in the pathophysiology of schizophrenia. Tryptophan hydroxylase (tryptophan 5-monooxygenase; TPH) is the rate-limiting enzyme in the biosynthesis of 5-HT, and sequence variation in intron 6 of the TPH1 gene has been...... associated with schizophrenia. The minor allele (A) of this polymorphism (A218C) is also more frequent in patients who have attempted suicide and individuals who died by suicide, than in healthy control individuals. In an attempt to replicate previous findings, five single nucleotide polymorphisms (SNPs......) were genotyped in 837 Scandinavian schizophrenia patients and 1,473 controls. Three SNPs spanning intron 6 and 7, including the A218C and A779C polymorphisms, were associated with schizophrenia susceptibility (P = 0.019). However there were no differences in allele frequencies of these loci between...
Nutrient Values of Chrysophyllum Albidum Linn African Star Apple ...
African Journals Online (AJOL)
FIRST LADY
reported that fruit pulp of Chrysophyllum albidum contains 21.8mg/100gm ascorbic ... Eight to ten fruits of differing morphological features were characterized and identified as .... might offer better health services than the sweet types. Thus type ...
2009-04-10
environmental enrichment on amphetamine-stimulated locomotor activity, dopamine synthesis and dopamine release. Neuropharmacology, 32(9), 885-893...Disorders, 45(1-2), 19- 30. 218 Kirby, L., & Lucki, I. (1997). Interaction between the forced swimming test and fluoxetine treatment on
Czech Academy of Sciences Publication Activity Database
Urbanová, V.; Hajdušek, O.; Šíma, R.; Franta, Z.; Hönig Mondeková, Helena; Grunclová, L.; Bartošová-Sojková, P.; Jalovecká, M.; Kopáček, P.
2018-01-01
Roč. 76, FEB 2018 (2018), s. 86-94 ISSN 0145-305X Institutional support: RVO:61388971 Keywords : Borrelia * C3-complement convertase * Factor B Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.218, year: 2016
Prototypic corium oxidation and hydrogen release during the Fuel-Coolant Interaction
Czech Academy of Sciences Publication Activity Database
Tyrpekl, J.; Piluso, P.; Bakardjieva, Snejana; Nižňanský, D.; Rehspringer, J.L.; Bezdička, Petr; Dugne, O.
2015-01-01
Roč. 75, JAN (2015), s. 210-218 ISSN 0306-4549 Institutional support: RVO:61388980 Keywords : Corium * Fuel -Coolant Interaction * Hydrogen release * Material effect * Nuclear reactor severe accident Subject RIV: CA - Inorganic Chemistry Impact factor: 1.174, year: 2015
Czech Academy of Sciences Publication Activity Database
Gouveia, A. R.; Bjornstad, O. N.; Tkadlec, Emil
2016-01-01
Roč. 6, č. 1 (2016), s. 212-218 ISSN 2045-7758 Institutional support: RVO:68081766 Keywords : Altitudinal gradient * LISA * Microtus arvalis * partial nonparametric correlation function * spatiotemporal dynamics Subject RIV: EH - Ecology, Behaviour Impact factor: 2.440, year: 2016
Czech Academy of Sciences Publication Activity Database
Prokopová, Olga; Bernauer, B.; Fíla, V.; Čapek, P.; Sysel, P.; Hrabánek, Pavel; Zikánová, Arlette; Brabec, Libor; Kočiřík, Milan
2013-01-01
Roč. 107, č. 3 (2013), s. 214-218 E-ISSN 1213-7103 R&D Projects: GA ČR GA203/09/1353 Institutional support: RVO:61388955 Keywords : permeability * composite membranes * molecular sieves Subject RIV: CF - Physical ; Theoretical Chemistry
... much vitamin A, or you have symptoms of excess vitamin A. Prevention How much vitamin A you need ... Saunders; 2015:chap 218. Ross AC, Tan L. Vitamin A deficiencies and excess. In: Kliegman RM, Stanton BF, St. Geme JW, ...
5. Anaemia in Pregnancy among Pregnant Women in Lusaka ...
African Journals Online (AJOL)
user
University Teaching Hospitals, Women and Newborn Hospital, Private Bag, RW1X, Lusaka, Zambia. Medical .... (21.8%) were single, one hundred and sixty nine. (78.2%) were .... were employed could have had long working hours with a very ...
A microkernel middleware architecture for distributed embedded real-zime systems
Pfeffer, Matthias
2001-01-01
A microkernel middleware architecture for distributed embedded real-zime systems / T. Ungerer ... - In: Symposium on Reliable Distributed Systems : Proceedings : October 28 - 31, 2001, New Orleans, Louisiana, USA. - Los Alamitos, Calif. [u.a.] : IEEE Computer Soc., 2001. - S. 218-226
Extrapulmonary tuberculosis among adults: Experience at Chris ...
African Journals Online (AJOL)
31.0%), blood (21.8%), meninges (7.3%), and peritoneum (2.9%). Disseminated tuberculosis occurred in 25.0%. The median age was 33 years (range 18 - 87 years). Males comprised 53.2% overall, with a female majority in the peritonitis group.
Digitali purpureae-Epilobietum in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Neuhäuslová, Zdenka; Härtel, Handrij
2001-01-01
Roč. 46, č. 2 (2001), s. 211-218 ISSN 1641-8190 R&D Projects: GA ČR GA206/96/0592 Institutional research plan: CEZ:AV0Z6005908 Keywords : Digitali purpureae-Epilobietum * phytocenology * ecology Subject RIV: EF - Botanics
Czech Academy of Sciences Publication Activity Database
Sroka, Pavel; Klečka, Jan; Boukal S., David
2016-01-01
Roč. 11, NOV 18 (2016), s. 205-218 ISSN 1178-9905 R&D Projects: GA ČR(CZ) GA14-29857S EU Projects: European Commission(XE) 239543 Institutional support: RVO:60077344 Keywords : community ecology * population dynamics * colonization experiment
Czech Academy of Sciences Publication Activity Database
Urban, Petr
2011-01-01
Roč. 59, č. 7 (2011), s. 203-218 ISSN 0015-1831 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : body * phenomenology * intersubjectivity * ethics Subject RIV: AA - Philosophy ; Religion
Single-species models of the allee effect: Extinction boundaries, sex ratios and mate encounters
Czech Academy of Sciences Publication Activity Database
Boukal S., David; Berec, Luděk
2002-01-01
Roč. 218, - (2002), s. 375-394 ISSN 0022-5193 R&D Projects: GA AV ČR IAB1007201 Institutional research plan: CEZ:AV0Z5007907 Keywords : Allee effect Subject RIV: EH - Ecology, Behaviour Impact factor: 1.552, year: 2002
Czech Academy of Sciences Publication Activity Database
Schwarz, H. H.; Lukáš, Jaromír; Richau, K.
2003-01-01
Roč. 218, 1-2 (2003), s. 1-9 ISSN 0376-7388 R&D Projects: GA AV ČR KSK4050111 Keywords : polyelectrolyte complex membranes * pervaporation * dehydration of organics Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.081, year: 2003
2010-09-29
..., Quimica Amtex S.A. de C.V. (Quimica Amtex), within the 30-day deadline specified in 19 CFR 351.218(d)(3)(i... of dumping at the following weighted-average margins: Quimica Amtex 12.61 percent All Others 12.61...
2012-03-23
... at the Environmental Protection Agency, Region 5, Air and Radiation Division, 77 West Jackson... reference, Intergovernmental relations, Nitrogen dioxide, Ozone, Reporting and recordkeeping requirements... plant exemption in Subpart TT of Parts 218 and 219 does not apply to industrial wastewater. This...
African Journals Online (AJOL)
Items 101 - 150 of 218 ... Vol 14, No 2 (2015), Enhancing inorganic fertilizer use in Imo State, Nigeria, Abstract ... Vol 16, No 2 (2017), Extraction and characterization of essential ... structural policies on the wheat market – comparative static and ...
Draft Genome Sequence of Lactobacillus plantarum XJ25 Isolated from Chinese Red Wine.
Zhao, Meijing; Liu, Shuwen; He, Ling; Tian, Yu
2016-11-17
Here, we present the draft genome sequence of Lactobacillus plantarum XJ25, isolated from Chinese red wine that had undergone spontaneous malolactic fermentation, which consists of 25 contigs and is 3,218,018 bp long. Copyright © 2016 Zhao et al.
Breech delivery at term in Denmark, 1982-92
DEFF Research Database (Denmark)
Krebs, L; Langhoff-Roos, J
1999-01-01
,476) in Denmark, 1982-92, a review of medical records of all (n = 218) cases with Apgar score controls, was performed. Planned vaginal delivery was associated with a 15 times greater risk of low Apgar score than elective Caesarean section...
Niche construction in evolutionary theory: the construction of an ...
Indian Academy of Sciences (India)
MANAN GUPTA
2017-07-06
Jul 6, 2017 ... 81, SAS Nagar, P.O. Manauli, Mohali, Punjab 140 306, India .... living or dying, affects the environment, NC would appear .... ing from the deterioration of the food environment in a ...... Oikos 119, 210–218. .... Health Technol.
Stopové prvky v křemeni z pegmatitu Věžná I (Česká republika)
Czech Academy of Sciences Publication Activity Database
Breiter, Karel; Svojtka, Martin; Ackerman, Lukáš; Ďurišová, Jana; Matoušková, Šárka; Švecová, K.; Loun, J.
2012-01-01
Roč. 20, č. 2 (2012), s. 218-222 ISSN 1211-0329 R&D Projects: GA ČR GAP210/10/1105 Institutional support: RVO:67985831 Keywords : quartz * trace elements * pegmatite * Věžná locality Subject RIV: DB - Geology ; Mineralogy
Measurement of radon daughters in air samples by alpha spectroscopy
International Nuclear Information System (INIS)
Acena, M.L.; Crespo, M.T.
1989-01-01
The concentration of radon progeny in air has been determined by alpha spectrometry measurement of polonium 214 and polonium 218. A known volume of air was passed through a filter, then the alpha activity was directly measured on this filter (Author)
Lifescience Database Archive (English)
Full Text Available pituitarism, post-natal microcephaly, visual and renal anomalies. ... JOURNAL ... Brain 136:3096-105 (2013) DOI:10.1093/brain/awt218 ..., Chong WK, Alkuraya FS, Martinez-Barbera JP, Sowden JC, Dattani MT ... TITLE ... ARNT2 mutation causes hypo
African Journal of Biotechnology - Vol 2, No 8 (2003)
African Journals Online (AJOL)
Stable gene transformation in cowpea (Vigna unguiculata L. walp.) using particle gun method · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J. Ikea, I. Ingelbrecht, A. Uwaifo, G. Thottappilly, 211-218 ...
PET radiochemistry: synthesis of 2-[18 F]-fluorine-2-deoxy-D-glucose
International Nuclear Information System (INIS)
Lopez D, F.A.; Flores M, A.; Zarate M, A.; Romo, E.
2005-01-01
The present work describes the method for the synthesis of the 2-[ 18 F]-fluorine-2-deoxy-D-glucose, the radiopharmaceutical of more use in nuclear medicine for the diagnosis of cancer at world level. (Author)
MO-A-218-01: CT Protocol Review - Practical Tips for Imaging Physicists.
Pizzutiello, R
2012-06-01
In the 1980's and 90's, when every mammography department had a wet film processor and a sundial to keep the schedule, medical physicists performing mammography surveys were primarily focused on measuring machine performance and image quality. As our professional experience matured, medical physicists began to learn that they were uniquely qualified to help to recommend technique factors that would balance dose and image quality. Technique charts using different kVp, target-filter combinations and AEC modes gradually became common and patients benefitted from our input. With the revolutionary change in CT Scanner technology and utilization, medical physicists have begun to contribute their expertise to developing and improving CT protocols. This presentation will present practical challenges and offer some directions for the practicing medical physicist who desires to participate in this critical and emerging aspect of imaging physics practice: CT Protocol Review. © 2012 American Association of Physicists in Medicine.
22 CFR Appendix A to Part 218 - List of Federal Financial Assistance
2010-04-01
... Department of State Subject to Age Discrimination Regulations Resettlement of Refugees in the United States Under the Migration and Refugee Assistant Act of 1962, as amended (22 U.S.C. 2601 et seq.). Diplomat in...
Adjustable valves in normal-pressure hydrocephalus: a retrospective study of 218 patients
DEFF Research Database (Denmark)
Zemack, G.; Rommer, Bertil Roland
2008-01-01
OBJECTIVE: We sought to assess the value of adjusting shunt valve opening pressure, complications, and outcomes with the use of an adjustable shunt valve in the treatment of patients with normal-pressure hydrocephalus (NPH). METHODS: In a single-center retrospective study, 231 adjustable valves...
Transuranic (TRU) Waste Phase I Retrieval Plan
International Nuclear Information System (INIS)
MCDONALD, K.M.
2000-01-01
From 1970 to 1987, TRU and suspect TRU wastes at Hanford were placed in the SWBG. At the time of placement in the SWBG these wastes were not regulated under existing Resource Conservation and Recovery Act (RCRA) regulations, since they were generated and disposed of prior to the effective date of RCRA at the Hanford Site (1987). From the standpoint of DOE Order 5820.2A1, the TRU wastes are considered retrievably stored, and current plans are to retrieve these wastes for shipment to WIPP for disposal. This plan provides a strategy for the Phase I retrieval that meets the intent of TPA milestone M-91 and Project W-113, and incorporates the lessons learned during TRU retrieval campaigns at Hanford, LANL, and SRS. As in the original Project W-113 plans, the current plan calls for examination of approximately 10,000 suspect-TRU drums located in the 218-W-4C burial ground followed by the retrieval of those drums verified to contain TRU waste. Unlike the older plan, however, this plan proposes an open-air retrieval scenario similar to those used for TRU drum retrieval at LANL and SRS. Phase I retrieval consists of the activities associated with the assessment of approximately 10,000 55-gallon drums of suspect TRU-waste in burial ground 218-W-4C and the retrieval of those drums verified to contain TRU waste. Four of the trenches in 218-W-4C (Trenches 1, 4, 20, and 29) are prime candidates for Phase I retrieval because they contain large numbers of suspect TRU drums, stacked from 2 to 5 drums high, on an asphalt pad. In fact, three of the trenches (Trenches 1 , 20, and 29) contain waste that has not been covered with soil, and about 1500 drums can be retrieved without excavation. The other three trenches in 218-W-4C (Trenches 7, 19, and 24) are not candidates for Phase I retrieval because they contain significant numbers of boxes. Drums will be retrieved from the four candidate trenches, checked for structural integrity, overpacked, if necessary, and assayed at the burial
International Nuclear Information System (INIS)
Kaur, H; Kumar, S; Sarkar, B; Ganesh, T; Giri, U; Jassal, K; Rathinamuthu, S; Gulia, G; Gopal, V; Mohanti, B; Munshi, A
2016-01-01
Purpose: This study was performed to analyze the agreement between optically stimulated luminescence (OSL) nanoDots measured doses and 0.6 cc Farmer type ionization chamber measured doses during total body irradiation (TBI). Methods: In-vivo dose measurements using OSL nanoDots and Farmer chamber were done in a total of twelve patients who received TBI at our center by bilateral parallel-opposed beams technique. In this technique, the patient is kept inside the TBI box which is filled with rice bags and irradiated using two bilateral parallel opposed beams of 40×40 cm"2 size with 45° collimator rotation at an SSD of 333.5 cm in an Elekta Synergy linear accelerator. All patients received a dose of 2 Gy in single fraction as conditioning regimen. The beams were equally weighted at the midplane of the box. The nanoDots were placed over forehead, right and left neck, right and left lung, umbilicus, right and left abdomen, medial part of thigh, knee and toe. A 0.6 cc Farmer chamber was placed in between the thighs of the patient. Measured doses are reported along with the statistical comparisons using paired sample t-test. Results: For the above sites the mean doses were 212.2±21.1, 218.2±7.6, 218.7±9.3, 215.6±9.5, 217.5±11.5, 214.5±7.7, 218.3±6.8, 221.5±15, 229.1±11.0, 220.5±7.7 and 223.3±5.1 cGy respectively. For all OSL measurements the mean dose was 218.6±11.8 cGy. Farmer chamber measurements yielded a mean dose of 208.8±15.6 cGy. Statistical analysis revealed that there was no significant difference between OSL measured doses in forehead, right and left neck, right and left lung, umbilicus, right and left abdomen and toe and Farmer chamber measured doses (0.72≤p≤0.06). However the mean OSL doses at thigh and knee were statistically different (p<0.05) from the Farmer chamber measurements. Conclusion: OSL measurements were found to be in agreement with Farmer type ionization chamber measurements in in-vivo dosimetry of TBI.
Patterns in moss element concentrations in fens across species, habitats, and regions
Czech Academy of Sciences Publication Activity Database
Hájek, Michal; Plesková, Z.; Syrovátka, V.; Peterka, T.; Laburdová, J.; Kintrová, K.; Jiroušek, M.; Hájek, Tomáš
2014-01-01
Roč. 16, č. 5 (2014), s. 203-218 ISSN 1433-8319 R&D Projects: GA ČR GAP505/10/0638 Institutional support: RVO:67985939 Keywords : bryophyte * calcicole-calcifuge behaviour * ionome Subject RIV: EF - Botanics Impact factor: 3.606, year: 2014
Experiment list: SRX020768 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 7420650,78.4,4.2,218 GSM545811: p53-pS46 ActD ChIPSeq
Blunt Head Trauma and Headache
Directory of Open Access Journals (Sweden)
Ana B Chelse
2015-04-01
Full Text Available Investigators from New York Presbyterian Morgan Stanley Children’s Hospital examined whether having an isolated headache following minor blunt head trauma was suggestive of traumatic brain injury (TBI among a large cohort of children 2-18 years of age.
Laird, Robert D.; Marrero, Matthew D.; Sentse, Miranda
2010-01-01
Studies using valid measures of monitoring activities have not found the anticipated main effects linking greater monitoring activity with fewer behavioral problems. This study focused on two contexts in which monitoring activities may be particularly influential. Early adolescents (n = 218, M age =
Visscher, Henk; Rassekh, S. Rod; Sandor, George S.; Caron, Huib N.; van Dalen, Elvira C.; Kremer, Leontien C.; van der Pal, Helena J.; Rogers, Paul C.; Rieder, Michael J.; Carleton, Bruce C.; Hayden, Michael R.; Ross, Colin J.; Hayden, Michael; Carleton, Bruce; Ross, Colin; MacLeod, Stuart; Wasserman, Wyeth; Mitton, Craig; Smith, Anne; Hildebrand, Claudette; Pastrana, Lucila Castro; Ghannadan, Reza; Rassekh, Rod; Miao, Fudan; Higginson, Michelle; Borrie, Adrienne; Amstutz, Ursula; Bhavsar, Amit; Nijssen-Jordan, Cheri; Johnson, David; Verbeek, Linda; Kaczowka, Rick; Grundy, Paul; Stobart, Kent; Wilson, Bev; Desai, Sunil; Spavor, Maria; Churcher, Linda; Chow, Terence; Hall, Kevin; Honcharik, Nick; Israels, Sara; Chan, Shanna; Garnham, Byron; Staub, Michelle; Rieder, Michael; Malkin, Becky; Portwine, Carol; Cranston, Amy; Koren, Gideon
2015-01-01
To identify novel variants associated with anthracycline-induced cardiotoxicity and to assess these in a genotype-guided risk prediction model. Two cohorts treated for childhood cancer (n = 344 and 218, respectively) were genotyped for 4578 SNPs in drug ADME and toxicity genes. Significant
Bentonite Modification with Manganese Oxides and Its Characterization
Czech Academy of Sciences Publication Activity Database
Dolinská, S.; Schütz, T.; Znamenáčková, I.; Lovás, M.; Vaculíková, Lenka
2015-01-01
Roč. 35, č. 1 (2015), s. 213-218 ISSN 1640-4920 Institutional support: RVO:68145535 Keywords : bentonite * natrification * manganese oxide Subject RIV: CB - Analytical Chemistry, Separation http://www.potopk.com.pl/ Full _text/2015_full/IM%202-2015-a35.pdf
Dicyclopentadiene Hydrogenation in Trickle Bed Reactor under Forced Periodic Control
Czech Academy of Sciences Publication Activity Database
Skála, D.; Hanika, Jiří
2008-01-01
Roč. 62, č. 2 (2008), s. 215-218 ISSN 1336-7242 R&D Projects: GA MPO(CZ) FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : periodic control * trickle -bed reactor * dicyclopentadiene Subject RIV: CI - Industrial Chemistry, Chemical Engineering
Phenotypes of sleeplessness : stressing the need for psychodiagnostics in the assessment of insomnia
van de Laar, M.; Leufkens, T.; Bakker, B.; Pevernagie, D.; Overeem, S.
2017-01-01
Insomnia is a too general term for various subtypes that might have different etiologies and therefore require different types of treatment. In this explorative study we used cluster analysis to distinguish different phenotypes in 218 patients with insomnia, taking into account several factors
A Probabilistic Cost Estimation Model for Unexploded Ordnance Removal
1999-09-01
clearance of the former Fort Ord costly and difficult [Meuser, and Szasz 1997]. Finally, soil type affects the maximum depth that ordnance...Correlated Random Variables from partially-specified Distributions." Management Science. 44(1998): 203- 218. Meuser, M, and A. Szasz . "Stakeholder
Bias and error in understanding plant invasion impacts
Czech Academy of Sciences Publication Activity Database
Hulme, P. E.; Pyšek, Petr; Jarošík, Vojtěch; Pergl, Jan; Schaffner, U.; Vila, M.
2013-01-01
Roč. 28, č. 4 (2013), s. 212-218 ISSN 0169-5347 R&D Projects: GA ČR(CZ) GAP504/11/1028 Institutional support: RVO:67985939 Keywords : biodiversity * invasions * ecosystem processes Subject RIV: EF - Botanics Impact factor: 15.353, year: 2013
First nuclear activation experiments using the new accelerator NUCLOTRON in Dubna
Czech Academy of Sciences Publication Activity Database
Adam, Jindřich; Barabanov, M. Y.; Bradnova, V.; Brandt, R.; Charoun, P.; Hella, KM.; Hashemi-Nezhad, R. S.; Kalinnikov, V. G.; Krasnov, VA.; Krivopustov, M. I.; Kulakov, BA.; Odoj, R.; Pronskikh, V. S.; Robotham, H.; Solnyshkin, A. A.; Sosnin, A. N.; Stegailov, V. I.; Tsoupko-Sitnikov, V. M.; Westmeier, W.
2003-01-01
Roč. 68, 5/6 (2003), s. 214-218 ISSN 0932-3902 R&D Projects: GA AV ČR KSK2067107 Keywords : energy proton-beams * spallation neutrons Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.130, year: 2003
Monitoring zemědělského suchav České republice – průběh suché epizody v roce 2015
Czech Academy of Sciences Publication Activity Database
Bartošová, Lenka; Trnka, Miroslav; Hlavinka, Petr; Semerádová, Daniela; Balek, Jan; Štěpánek, Petr; Zahradníček, Pavel; Možný, M.; Žalud, Zdeněk
2016-01-01
Roč. 132, č. 9-10 (2016), s. 280-284 ISSN 1210-3306 Institutional support: RVO:86652079 Keywords : drought * monitoring * drought forecast * year 2015 Subject RIV: GC - Agronomy OBOR OECD: Agronomy, plant breeding and plant protection Impact factor: 0.218, year: 2016