Determination of the electron affinity of astatine and polonium by laser photodetachment

CERN Multimedia

We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

International Nuclear Information System (INIS)

Eichler, B.; Son Chun, K.

1985-01-01

In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

International Nuclear Information System (INIS)

Otozai, K.; Takahashi, N.

1982-01-01

After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

CERN Multimedia

Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

2017-01-01

Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

CERN Document Server

Andreyev, Andrei

2013-01-01

Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

Energy Technology Data Exchange (ETDEWEB)

Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

2008-12-15

No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

International Nuclear Information System (INIS)

Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

2008-01-01

No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

2 CFR 215.10 - Purpose.

Science.gov (United States)

2010-01-01

... ORGANIZATIONS (OMB CIRCULAR A-110) Pre-Award Requirements § 215.10 Purpose. Sections 215.11 through 215.17... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose. 215.10 Section 215.10 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE...

2 CFR 215.70 - Purpose.

Science.gov (United States)

2010-01-01

... ORGANIZATIONS (OMB CIRCULAR A-110) After-the-Award Requirements § 215.70 Purpose. Sections 215.71 through 215.73... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose. 215.70 Section 215.70 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE...

Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

Energy Technology Data Exchange (ETDEWEB)

Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

2011-12-14

The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

7 CFR 215.3 - Administration.

Science.gov (United States)

2010-01-01

... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 215.3 Section 215.3 Agriculture... CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, CND...

29 CFR 215.1 - Purpose.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Purpose. 215.1 Section 215.1 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.1 Purpose. The purpose of these guidelines is to provide information concerning the...

29 CFR 215.2 - General.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false General. 215.2 Section 215.2 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.2 General. Upon receipt of copies of applications for Federal assistance subject to 49 U...

48 CFR 833.215 - Contract clause.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 833.215 Section 833.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 833.215 Contract clause. The contracting...

48 CFR 215.402 - Pricing policy.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Pricing policy. 215.402... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.402 Pricing policy. Follow the procedures at PGI 215.402 when conducting cost or price analysis, particularly...

32 CFR 215.7 - Command relationships.

Science.gov (United States)

2010-07-01

... 32 National Defense 2 2010-07-01 2010-07-01 false Command relationships. 215.7 Section 215.7 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.7 Command relationships...

47 CFR 90.215 - Transmitter measurements.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter measurements. 90.215 Section 90.215... MOBILE RADIO SERVICES General Technical Standards § 90.215 Transmitter measurements. (a) The licensee of... current station authorization. On authorizations stating only the input power to the final radiofrequency...

47 CFR 80.215 - Transmitter power.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 80.215 Section 80.215... MARITIME SERVICES General Technical Standards § 80.215 Transmitter power. (a) Transmitter power shown on the radio station authorization is the maximum power the licensee is authorized to use. Power is...

25 CFR 215.12 - Advertising costs.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Advertising costs. 215.12 Section 215.12 Indians BUREAU... LEASES, QUAPAW AGENCY § 215.12 Advertising costs. All advertising costs, publication fees, expenses incurred for abstracts of lease title, and other expenses incurred in connection with the advertising and...

49 CFR 215.203 - Restricted cars.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Restricted cars. 215.203 Section 215.203..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Restricted Equipment § 215.203 Restricted cars. (a) This section restricts the operation of any railroad freight car that is— (1) More than 50...

6 CFR 21.5 - Discrimination prohibited.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Discrimination prohibited. 21.5 Section 21.5... FROM THE DEPARTMENT OF HOMELAND SECURITY § 21.5 Discrimination prohibited. (a) General. No person in... participation in, be denied the benefits of, or be otherwise subjected to discrimination under, any program to...

49 CFR 21.5 - Discrimination prohibited.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Discrimination prohibited. 21.5 Section 21.5... DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.5 Discrimination... discrimination under, any program to which this part applies. (b) Specific discriminatory actions prohibited: (1...

2 CFR 215.27 - Allowable costs.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Allowable costs. 215.27 Section 215.27... § 215.27 Allowable costs. For each kind of recipient, there is a set of Federal principles for determining allowable costs. Allowability of costs shall be determined in accordance with the cost principles...

12 CFR 215.11 - Civil penalties.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Civil penalties. 215.11 Section 215.11 Banks... OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.11 Civil penalties... subject to civil penalties as specified in section 29 of the Federal Reserve Act (12 U.S.C. 504). [Reg. O...

Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

International Nuclear Information System (INIS)

Zalutsky, Michael R.

2012-01-01

Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

Energy Technology Data Exchange (ETDEWEB)

MICHAEL R. ZALUTSKY

2012-08-08

Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

48 CFR 53.215 - Contracting by negotiation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contracting by negotiation. 53.215 Section 53.215 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.215 Contracting by negotiation...

48 CFR 853.215 - Contracting by negotiation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contracting by negotiation. 853.215 Section 853.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS FORMS Prescription of Forms 853.215 Contracting by negotiation...

6 CFR 27.215 - Security vulnerability assessments.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Security vulnerability assessments. 27.215 Section 27.215 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.215 Security vulnerability...

48 CFR 2453.215 - Contracting by negotiation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracting by negotiation. 2453.215 Section 2453.215 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.215 Contracting by negotiation...

49 CFR 215.303 - Stenciling of restricted cars.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Stenciling of restricted cars. 215.303 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Stenciling § 215.303 Stenciling of restricted cars. (a) Each restricted railroad freight car that is described in § 215.205(a) of...

48 CFR 253.215 - Contracting by negotiation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation...

2 CFR 215.1 - Purpose.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose. 215.1 Section 215.1 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT...

42 CFR 93.215 - Investigation.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Investigation. 93.215 Section 93.215 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

10 CFR 215.5 - Pricing and volume reports.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Pricing and volume reports. 215.5 Section 215.5 Energy DEPARTMENT OF ENERGY OIL COLLECTION OF FOREIGN OIL SUPPLY AGREEMENT INFORMATION § 215.5 Pricing and volume reports. To the extent not reported pursuant to § 215.3, any person lifting for export crude oil from a...

24 CFR 200.215 - Definitions.

Science.gov (United States)

2010-04-01

... furnish advisory services in connection with the financing or construction of a project and the related... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 200.215 Section 200... Participation Review and Clearance Procedure § 200.215 Definitions. (a) Affiliate. Any person or business...

49 CFR 1542.215 - Law enforcement support.

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement support. 1542.215 Section 1542.215..., DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.215 Law... program under § 1542.103(a) or (b) must provide: (1) Law enforcement personnel in the number and manner...

29 CFR 215.5 - Processing of amendments.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Processing of amendments. 215.5 Section 215.5 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.5 Processing of amendments. (a) Grant modifications in the form of...

21 CFR 1311.215 - Internal audit trail.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Internal audit trail. 1311.215 Section 1311.215... ORDERS AND PRESCRIPTIONS (Eff. 6-1-10) Electronic Prescriptions § 1311.215 Internal audit trail. (a) The... with audit trail functions. (6) For application service providers, attempted or successful annotation...

49 CFR 215.121 - Defective car body.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective car body. 215.121 Section 215.121..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Car Bodies § 215.121 Defective car body. A railroad may not place or continue in service a car, if: (a) Any portion of...

29 CFR 1910.215 - Abrasive wheel machinery.

Science.gov (United States)

2010-07-01

... be securely fastened to the spindle and the bearing surface shall run true. When more than one wheel... 29 Labor 5 2010-07-01 2010-07-01 false Abrasive wheel machinery. 1910.215 Section 1910.215 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.215 Abrasive wheel machinery. (a...

29 CFR 215.7 - The Special Warranty.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false The Special Warranty. 215.7 Section 215.7 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.7 The Special Warranty. (a) The Special Warranty mentioned in paragraph (b)(2...

29 CFR 215.6 - The Model Agreement.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false The Model Agreement. 215.6 Section 215.6 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.6 The Model Agreement. The Model (or National) Agreement mentioned in paragraphs...

30 CFR 75.215 - Longwall mining systems.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Longwall mining systems. 75.215 Section 75.215... MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.215 Longwall mining systems. For each longwall mining section, the roof control plan shall specify— (a) The methods that will be used to maintain...

10 CFR 1015.215 - Federal salary offset.

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Federal salary offset. 1015.215 Section 1015.215 Energy... Administrative Collection of Claims § 1015.215 Federal salary offset. (a) DOE may authorize Treasury to offset a Federal salary to satisfy delinquent debt in accordance with 5 U.S.C. 5514, Installment Deduction for...

49 CFR 215.115 - Defective roller bearing.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing. 215.115 Section 215.115... § 215.115 Defective roller bearing. (a) A railroad may not place or continue in service a car, if the car has— (1) A roller bearing that shows signs of having been overheated as evidenced by— (i...

21 CFR 137.215 - Yellow corn flour.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn flour. 137.215 Section 137.215 Food... Flours and Related Products § 137.215 Yellow corn flour. Yellow corn flour conforms to the definition and standard of identity prescribed by § 137.211 for white corn flour except that cleaned yellow corn is used...

25 CFR 215.24 - Books and accounts.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Books and accounts. 215.24 Section 215.24 Indians BUREAU... LEASES, QUAPAW AGENCY § 215.24 Books and accounts. (a) The lessee shall maintain books in which shall be... land. (b) An audit of the lessee's accounts and books shall be made semiannually, or at such other...

49 CFR 215.111 - Defective plain bearing.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing. 215.111 Section 215.111... § 215.111 Defective plain bearing. A railroad may not place or continue in service a car, if the car has a plain bearing— (a) That is missing, cracked, or broken; (b) On which the bearing liner— (1) Is...

23 CFR 668.215 - Programming and project procedures.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Programming and project procedures. 668.215 Section 668.215 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS EMERGENCY RELIEF PROGRAM Procedures for Federal Agencies for Federal Roads § 668.215 Programming...

48 CFR 215.406-3 - Documenting the negotiation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Documenting the negotiation. 215.406-3 Section 215.406-3 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.406-3 Documenting the...

49 CFR 215.119 - Defective freight car truck.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective freight car truck. 215.119 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.119 Defective freight car truck. A railroad may not place or continue in service a...

7 CFR 215.1 - General purpose and scope.

Science.gov (United States)

2010-01-01

... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 215.1 Section 215.1... AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.1 General purpose and scope. This part announces the policies and prescribes the general regulations with respect to the Special Milk...

29 CFR 215.8 - Department of Labor contact.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Department of Labor contact. 215.8 Section 215.8 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.8 Department of Labor contact. Questions concerning the subject...

2 CFR 215.71 - Closeout procedures.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Closeout procedures. 215.71 Section 215.71 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... being closed out. (d) The recipient shall promptly refund any balances of unobligated cash that the...

49 CFR 215.113 - Defective plain bearing wedge.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...

48 CFR 215.404-76 - Reporting profit and fee statistics.

Science.gov (United States)

2010-10-01

... statistics. 215.404-76 Section 215.404-76 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-76 Reporting profit and fee statistics. Follow the procedures at PGI 215.404-76 for reporting profit and fee statistics. [71 FR 69494, Dec. 1, 2006] ...

2 CFR 215.24 - Program income.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Program income. 215.24 Section 215.24 Grants... income. (a) Federal awarding agencies shall apply the standards set forth in this section in requiring recipient organizations to account for program income related to projects financed in whole or in part with...

48 CFR 215.404-4 - Profit.

Science.gov (United States)

2010-10-01

... prenegotiation profit or fee objective on any negotiated contract action when cost or pricing data is obtained, except for cost-plus-award-fee contracts (see 215.404-74, 216.405-2, and FAR 16.405-2) or contracts with... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-4...

2 CFR 215.52 - Financial reporting.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Financial reporting. 215.52 Section 215.52... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status Report...

48 CFR 2052.215-77 - Travel approvals and reimbursement.

Science.gov (United States)

2010-10-01

... reimbursement. 2052.215-77 Section 2052.215-77 Federal Acquisition Regulations System NUCLEAR REGULATORY....215-77 Travel approvals and reimbursement. As prescribed at 2015.209-70(d), the contracting officer shall insert the following clause in cost reimbursement solicitations and contracts which require travel...

20 CFR 725.215 - Determination of dependency; surviving spouse.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; surviving spouse. 725.215 Section 725.215 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...) § 725.215 Determination of dependency; surviving spouse. An individual who is the miner's surviving...

48 CFR 52.215-2 - Audit and Records-Negotiation.

Science.gov (United States)

2010-10-01

...-Negotiation. 52.215-2 Section 52.215-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-2 Audit and Records—Negotiation. As prescribed in 15.209(b), insert the following clause: Audit and Records—Negotiation (OCT 2010) (a) As used in this clause, records includes books, documents...

12 CFR 215.4 - General prohibitions.

Science.gov (United States)

2010-01-01

.... (i) A member bank with deposits of less than $100,000,000 may by an annual resolution of its board of... of the date of the resolution; (C) The bank meets or exceeds, on a fully-phased in basis, all... 12 Banks and Banking 2 2010-01-01 2010-01-01 false General prohibitions. 215.4 Section 215.4 Banks...

37 CFR 1.215 - Patent application publication.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application publication. 1.215 Section 1.215 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication...

48 CFR 215.370-2 - Evaluation factor.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation factor. 215.370..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Source Selection 215.370-2 Evaluation factor. In accordance with Section 819 of the National Defense Authorization Act for...

25 CFR 215.7 - Advertisement of sale of leases.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement of sale of leases. 215.7 Section 215.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.7 Advertisement of sale of leases. Upon authority being granted by...

29 CFR 99.215 - Relation to other audit requirements.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Relation to other audit requirements. 99.215 Section 99.215... Audits § 99.215 Relation to other audit requirements. (a) Audit under this part in lieu of other audits... audited as a major program using the risk-based audit approach described in § 99.520 and, if not, the...

48 CFR 1652.215-71 - Investment Income.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Investment Income. 1652.215... 1652.215-71 Investment Income. As prescribed in 1615.470-1, the following clause shall be inserted in all FEHBP contracts based on cost analysis: Investment Income (JAN 1998) (a) The Carrier shall invest...

25 CFR 215.17 - Additional information required.

Science.gov (United States)

2010-04-01

... interested in lead and zinc mining leases, or land under the jurisdiction of the Quapaw Indian Agency, and... 25 Indians 1 2010-04-01 2010-04-01 false Additional information required. 215.17 Section 215.17 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING...

43 CFR 2.15 - Will I be charged fees?

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Will I be charged fees? 2.15 Section 2.15... INFORMATION ACT Requests for Records under the FOIA § 2.15 Will I be charged fees? Bureaus will charge fees consistent with the provisions in §§ 2.16 and 2.17. The fee schedule in appendix C to this part applies to...

2 CFR 215.20 - Purpose of financial and program management.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of financial and program management... Financial and Program Management § 215.20 Purpose of financial and program management. Sections 215.21 through 215.28 prescribe standards for financial management systems, methods for making payments and rules...

15 CFR 8a.215 - Membership practices of certain organizations.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Membership practices of certain organizations. 8a.215 Section 8a.215 Commerce and Foreign Trade Office of the Secretary of Commerce... Coverage § 8a.215 Membership practices of certain organizations. (a) Social fraternities and sororities...

48 CFR 52.215-16 - Facilities Capital Cost of Money.

Science.gov (United States)

2010-10-01

... Money. 52.215-16 Section 52.215-16 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-16 Facilities Capital Cost of Money. As prescribed in 15.408(h), insert the following provision: Facilities Capital Cost of Money (JUN 2003) (a) Facilities capital cost of money will be an allowable cost...

2 CFR 215.30 - Purpose of property standards.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of property standards. 215.30 Section 215.30 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION...

2 CFR 215.40 - Purpose of procurement standards.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of procurement standards. 215.40 Section 215.40 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION...

Analytical and functional similarity of Amgen biosimilar ABP 215 to bevacizumab.

Science.gov (United States)

Seo, Neungseon; Polozova, Alla; Zhang, Mingxuan; Yates, Zachary; Cao, Shawn; Li, Huimin; Kuhns, Scott; Maher, Gwendolyn; McBride, Helen J; Liu, Jennifer

ABP 215 is a biosimilar product to bevacizumab. Bevacizumab acts by binding to vascular endothelial growth factor A, inhibiting endothelial cell proliferation and new blood vessel formation, thereby leading to tumor vasculature normalization. The ABP 215 analytical similarity assessment was designed to assess the structural and functional similarity of ABP 215 and bevacizumab sourced from both the United States (US) and the European Union (EU). Similarity assessment was also made between the US- and EU-sourced bevacizumab to assess the similarity between the two products. The physicochemical properties and structural similarity of ABP 215 and bevacizumab were characterized using sensitive state-of-the-art analytical techniques capable of detecting small differences in product attributes. ABP 215 has the same amino acid sequence and exhibits similar post-translational modification profiles compared to bevacizumab. The functional similarity assessment employed orthogonal assays designed to interrogate all expected biological activities, including those known to affect the mechanisms of action for ABP 215 and bevacizumab. More than 20 batches of bevacizumab (US) and bevacizumab (EU), and 13 batches of ABP 215 representing unique drug substance lots were assessed for similarity. The large dataset allows meaningful comparisons and garners confidence in the overall conclusion for the analytical similarity assessment of ABP 215 to both US- and EU-sourced bevacizumab. The structural and purity attributes, and biological properties of ABP 215 are demonstrated to be highly similar to those of bevacizumab.

40 CFR 1065.215 - Pressure transducers, temperature sensors, and dewpoint sensors.

Science.gov (United States)

2010-07-01

... sensors, and dewpoint sensors. 1065.215 Section 1065.215 Protection of Environment ENVIRONMENTAL... Measurement of Engine Parameters and Ambient Conditions § 1065.215 Pressure transducers, temperature sensors, and dewpoint sensors. (a) Application. Use instruments as specified in this section to measure...

30 CFR 77.215-1 - Refuse piles; identification.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; identification. 77.215-1 Section... COAL MINES Surface Installations § 77.215-1 Refuse piles; identification. A permanent identification marker, at least six feet high and showing the refuse pile identification number as assigned by the...

47 CFR 97.215 - Telecommand of model craft.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Telecommand of model craft. 97.215 Section 97... AMATEUR RADIO SERVICE Special Operations § 97.215 Telecommand of model craft. An amateur station transmitting signals to control a model craft may be operated as follows: (a) The station identification...

30 CFR 77.215-3 - Refuse piles: certification.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles: certification. 77.215-3 Section... COAL MINES Surface Installations § 77.215-3 Refuse piles: certification. (a) Within 180 days following written notification by the District Manager that a refuse pile can present a hazard, the person owning...

46 CFR 174.215 - Drainage of weather deck.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Drainage of weather deck. 174.215 Section 174.215 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY SPECIAL RULES... weather deck. The weather deck must have open rails to allow rapid clearing of water, or must have freeing...

30 CFR 77.215 - Refuse piles; construction requirements.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; construction requirements. 77.215... COAL MINES Surface Installations § 77.215 Refuse piles; construction requirements. (a) Refuse deposited on a pile shall be spread in layers and compacted in such a manner so as to minimize the flow of air...

36 CFR 215.7 - Legal notice of decision.

Science.gov (United States)

2010-07-01

... Appeal Deciding Officer with whom an appeal is to be filed. The notice shall specify a street, postal..., or a designee, has determined that an emergency situation exists (§ 215.10), and which portion of the... portions covered by an emergency situation determination, if applicable (§ 215.10). (3) When no substantive...

14 CFR 417.215 - Straight-up time analysis.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Straight-up time analysis. 417.215 Section..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.215 Straight-up time analysis. A flight safety analysis must establish the straight-up time for a launch for use as a flight...

42 CFR 2.15 - Incompetent and deceased patients.

Science.gov (United States)

2010-10-01

... effective action on his or her own behalf, the program director may exercise the right of the patient to... 42 Public Health 1 2010-10-01 2010-10-01 false Incompetent and deceased patients. 2.15 Section 2.15 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS...

48 CFR 2052.215-78 - Travel approvals and reimbursement-Alternate 1.

Science.gov (United States)

2010-10-01

... reimbursement-Alternate 1. 2052.215-78 Section 2052.215-78 Federal Acquisition Regulations System NUCLEAR... Clauses 2052.215-78 Travel approvals and reimbursement—Alternate 1. As prescribed in 2015.209-70(d), the contracting officer shall insert the following clause in cost reimbursement solicitations and contracts which...

48 CFR 52.215-12 - Subcontractor Certified Cost or Pricing Data.

Science.gov (United States)

2010-10-01

... Cost or Pricing Data. 52.215-12 Section 52.215-12 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-12 Subcontractor Certified Cost or Pricing Data. As prescribed in 15.408(d), insert the following clause: Subcontractor Certified Cost or Pricing Data (OCT 2010) (a) Before awarding...

30 CFR 77.215-4 - Refuse piles; abandonment.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; abandonment. 77.215-4 Section 77... MINES Surface Installations § 77.215-4 Refuse piles; abandonment. When a refuse pile is to be abandoned... refuse pile shall be abandoned in accordance with a plan submitted by the operator and approved by the...

29 CFR 215.4 - Employees not represented by a labor organization.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Employees not represented by a labor organization. 215.4 Section 215.4 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.4 Employees not represented by a labor...

47 CFR 215.1 - Background.

Science.gov (United States)

2010-10-01

... POINT FOR ELECTROMAGNETIC PULSE (EMP) INFORMATION § 215.1 Background. (a) The nuclear electromagnetic pulse (EMP) is part of the complex environment produced by nuclear explosions. It consists of transient...

49 CFR 215.117 - Defective roller bearing adapter.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing adapter. 215.117 Section... Suspension System § 215.117 Defective roller bearing adapter. A railroad may not place or continue in service a car, if the car has a roller bearing adapter that is— (a) Cracked or broken; (b) Not in its design...

48 CFR 5252.215-9000 - Submission of cost or pricing data.

Science.gov (United States)

2010-10-01

... pricing data. 5252.215-9000 Section 5252.215-9000 Federal Acquisition Regulations System DEPARTMENT OF THE... Clauses 5252.215-9000 Submission of cost or pricing data. As prescribed at 5215.407, insert the following provision: Submission of Cost or Pricing Data (NOV 1987) (a) It is expected that this contract will be...

Comment: 215 [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available 215.png Taxonomy icon (c) Database Center for Life Science licensed under CC Attribution2.1 Japan アイコン:電子顕微鏡バージョン bando 2010/02/15 15:30:03 2010/02/15 15:30:03 ...

Identification of alternatively spliced isoforms of interleukin-2/15 receptor β chain in ducks.

Science.gov (United States)

Jeong, Jipseol; Kim, Woo H; Yeo, Jaeseung; Fernandez, Cherry P; Kim, Suk; Lee, Youn-Jeong; Lillehoj, Hyun S; Min, Wongi

2014-12-15

Interleukin (IL)-2 and IL-15 receptor β (IL-2/15Rβ, CD122) play important roles in signal transduction for biological functions of IL-2 and IL-15. We found that ducks possess three different IL-2/15Rβ transcripts, a conventional form (duIL-2/15Rβ) and two variants. Comparisons between the cDNA and genomic sequences revealed that the two variants, duIL-2/15Rβ-d7 and duIL-2/15Rβ-d9, were novel spliced transcripts resulting from skipping exons 7 and 9, respectively. Expression profiles of duIL-2/15Rβ and its isoforms were examined in healthy tissues, concanavalin A (ConA)-stimulated splenic lymphocytes and in livers and spleens of Riemerella anatipestifer-infected ducks using quantitative real-time PCR (qRT-PCR). Generally, duIL-2/15Rβ-d9 expression was undetectable in healthy tissues, ConA-activated samples, and R. anatipestifer-infected ducks. Expression levels of duIL-2/15Rβ transcript were relatively high to moderate in all healthy tissues tested, while duIL-2/15Rβ-d7 expression was low. Compared to untreated controls, expression levels of duIL-2/15Rβ were elevated in ConA-activated splenic lymphocytes and in livers on day 7 in R. anatipestifer-infected ducks, while duIL-2/15Rβ-d7 expression was unchanged. Additionally, COS-7 cells transfected with duIL-2/15Rβ, duIL-2/15Rβ-d7, or duIL-2/15Rβ-d9 constructs generated 73 kilodalton (kDa), 31kDa, and 40kDa proteins, respectively. This study identified three different IL-2/15Rβ transcripts, including two isoforms generated by alternative splicing and their gene expression patterns in stimulated conditions. Copyright © 2014 Elsevier B.V. All rights reserved.

7 CFR 3052.215 - Relation to other audit requirements.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Relation to other audit requirements. 3052.215 Section 3052.215 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT...

2 CFR 215.50 - Purpose of reports and records.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of reports and records. 215.50 Section 215.50 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION...

30 CFR 77.215-2 - Refuse piles; reporting requirements.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; reporting requirements. 77.215-2... COAL MINES Surface Installations § 77.215-2 Refuse piles; reporting requirements. (a) The proposed location of a new refuse pile shall be reported to and acknowledged in writing by the District Manager...

2 CFR 215.35 - Supplies and other expendable property.

Science.gov (United States)

2010-01-01

... supplies exceeding $5000 in total aggregate value upon termination or completion of the project or program... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Supplies and other expendable property. 215... Property Standards § 215.35 Supplies and other expendable property. (a) Title to supplies and other...

49 CFR 215.107 - Defective plain bearing box: General.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing box: General. 215.107... Suspension System § 215.107 Defective plain bearing box: General. A railroad may not place or continue in... the bearing; or (2) Have a detrimental effect on the lubrication of the journal and the bearings. ...

48 CFR 1352.215-76 - Cost or pricing data.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Cost or pricing data. 1352.215-76 Section 1352.215-76 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND... pricing data. As prescribed in 48 CFR 1315.204-570(b)(4), insert the following provision: Cost or Pricing...

14 CFR 21.5 - Airplane or Rotorcraft Flight Manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane or Rotorcraft Flight Manual. 21.5... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.5 Airplane or Rotorcraft Flight Manual. (a) With each airplane or rotorcraft that was not type certificated with an Airplane or Rotorcraft Flight Manual...

48 CFR 52.215-17 - Waiver of Facilities Capital Cost of Money.

Science.gov (United States)

2010-10-01

... Capital Cost of Money. 52.215-17 Section 52.215-17 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-17 Waiver of Facilities Capital Cost of Money. As prescribed in 15.408(i), insert the following clause: Waiver of Facilities Capital Cost of Money (OCT 1997) The Contractor did not...

20 CFR 416.215 - You leave the United States.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You leave the United States. 416.215 Section... Eligible § 416.215 You leave the United States. You lose your eligibility for SSI benefits for any month during all of which you are outside of the United States. If you are outside of the United States for 30...

33 CFR 135.215 - Certification.

Science.gov (United States)

2010-07-01

... partnership applicant, or a director or other officer of a corporate applicant. (d) Financial data or other...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.215 Certification. (a) Applicants shall: (1) If the...

33 CFR 136.215 - Proof.

Science.gov (United States)

2010-07-01

... FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.215 Proof. (a) In addition to the... each claim for economic loss resulting from destruction of real or personal property, the claimant must...

42 CFR 405.215 - Confidential commercial and trade secret information.

Science.gov (United States)

2010-10-01

... 42 Public Health 2 2010-10-01 2010-10-01 false Confidential commercial and trade secret information. 405.215 Section 405.215 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF... trade secret information. To the extent that CMS relies on confidential commercial or trade secret...

9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...

MicroRNA-215 suppresses cell proliferation, migration and invasion of colon cancer by repressing Yin-Yang 1

International Nuclear Information System (INIS)

Chen, Zehong; Han, Siqi; Huang, Wensheng; Wu, Jialin; Liu, Yuyi; Cai, Shirong; He, Yulong; Wu, Suijing; Song, Wu

2016-01-01

Colorectal cancer is one of the most common malignant tumors worldwide with rising incidence. MicroRNAs are small non-coding RNAs that implicate in multiple physiological or pathological processes. The aberrant expression of miRNA-215 (miR-215) has been illustrated in various types of cancers. However, the expression of miR-215 in human colon cancer and the biological roles of it remain largely unknown. We conducted this study to explore the expression and the function of miR-215 in human colon cancer. The results showed that miR-215 was remarkably downregulated in colon cancer tissues and cell lines. Overexpression of miR-215 by miR-215 mimic significantly inhibited colon cancer cell proliferation, migration and invasion while knockdown of miR-215 by miR-215 inhibitor exerted reverse effects. Furthermore, we newly identified Yin-Yang 1(YY1) as a direct target of miR-215 which could rescue the effects of miR-215 on colon cancer cells. In summary, our investigation revealed that miR-215 was downregulated in colon cancer and it suppressed colon cancer cell proliferation, migration and invasion by directly targeting YY1. - Highlights: • MiR-215 expression was decreased in colon cancer tissues and cell lines. • Mir-215 inhibited colon cancer cell proliferation, migration and invasion. • MiR-215 targeted YY1 directly. • The effects of miR-215 on colon cancer cells were mediated by YY1.

XTACC3-XMAP215 association reveals an asymmetric interaction promoting microtubule elongation

DEFF Research Database (Denmark)

Mortuza, Gulnahar B; Cavazza, Tommaso; Garcia-Mayoral, Maria Flor

2014-01-01

215 (chTOG), dissecting the mechanism by which their interaction promotes microtubule elongation during spindle assembly. Using SAXS, we show that the TACC domain (TD) is an elongated structure that mediates the interaction with the C terminus of XMAP215. Our data suggest that one TD and two XMAP215...... molecules associate to form a four-helix coiled-coil complex. A hybrid methods approach was used to define the precise regions of the TACC heptad repeat and the XMAP215 C terminus required for assembly and functioning of the complex. We show that XTACC3 can induce the recruitment of larger amounts of XMAP...

49 CFR 215.9 - Movement of defective cars for repair.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of defective cars for repair. 215.9... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS General § 215.9 Movement of... (ii) The maximum speed and other restrictions necessary for safely conducting the movement; (2)(i) The...

48 CFR 215.403-3 - Requiring information other than cost or pricing data.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Requiring information other than cost or pricing data. 215.403-3 Section 215.403-3 Federal Acquisition Regulations System... CONTRACTING BY NEGOTIATION Contract Pricing 215.403-3 Requiring information other than cost or pricing data...

2 CFR 215.46 - Procurement records.

Science.gov (United States)

2010-01-01

... NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Procurement Standards § 215.46... of competition when competitive bids or offers are not obtained; and (c) Basis for award cost or price. ...

32 CFR Appendix C to Part 45 - DD Form 215

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 215 C Appendix C to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. C Appendix C to Part 45—DD Form 215 EC21OC91.050 ...

22 CFR 1203.735-215 - General conduct prejudicial to the Government.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 2 2010-04-01 2010-04-01 true General conduct prejudicial to the Government. 1203.735-215 Section 1203.735-215 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION... promptness in dealing with or serving the public. ...

25 CFR 215.25 - Other minerals and deep-lying lead and zinc minerals.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Other minerals and deep-lying lead and zinc minerals. 215.25 Section 215.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.25 Other minerals and deep-lying lead...

8 CFR 215.1 - Definitions.

Science.gov (United States)

2010-01-01

... departure from the United States. (i) The term departure-control officer means any immigration officer as... UNITED STATES § 215.1 Definitions. For the purpose of this part: (a) The term alien means any person who is not a citizen or national of the United States. (b) The term Commissioner means the Commissioner...

50 CFR 226.215 - Critical habitat for the North Pacific Right Whale (Eubalaena japonica).

Science.gov (United States)

2010-10-01

... Right Whale (Eubalaena japonica). 226.215 Section 226.215 Wildlife and Fisheries NATIONAL MARINE... DESIGNATED CRITICAL HABITAT § 226.215 Critical habitat for the North Pacific Right Whale (Eubalaena japonica). (a) Primary Constituent Elements. The primary constituent elements of the North Pacific right whale...

48 CFR 52.215-10 - Price Reduction for Defective Certified Cost or Pricing Data.

Science.gov (United States)

2010-10-01

... Defective Certified Cost or Pricing Data. 52.215-10 Section 52.215-10 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.215-10 Price Reduction for Defective Certified Cost or Pricing Data... or Pricing Data (OCT 2010) (a) If any price, including profit or fee, negotiated in connection with...

24 CFR 180.215 - Ex parte communications.

Science.gov (United States)

2010-04-01

... AND BUSINESS OPPORTUNITY CONSOLIDATED HUD HEARING PROCEDURES FOR CIVIL RIGHTS MATTERS Administrative Law Judge § 180.215 Ex parte communications. (a) An ex parte communication is any direct or indirect...

29 CFR 1472.215 - What must I include in my drug-free awareness program?

Science.gov (United States)

2010-07-01

... 29 Labor 4 2010-07-01 2010-07-01 false What must I include in my drug-free awareness program? 1472.215 Section 1472.215 Labor Regulations Relating to Labor (Continued) FEDERAL MEDIATION AND CONCILIATION SERVICE GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals § 1472.215...

12 CFR 215.5 - Additional restrictions on loans to executive officers of member banks.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Additional restrictions on loans to executive officers of member banks. 215.5 Section 215.5 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS... MEMBER BANKS (REGULATION O) § 215.5 Additional restrictions on loans to executive officers of member...

47 CFR 215.0 - Purpose and authority.

Science.gov (United States)

2010-10-01

... POINT FOR ELECTROMAGNETIC PULSE (EMP) INFORMATION § 215.0 Purpose and authority. The purpose of this part is to designate a focal point within the Federal Government for electromagnetic pulse (EMP...

47 CFR 25.215 - Technical requirements for space stations in the Direct Broadcast Satellite Service.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Technical requirements for space stations in the Direct Broadcast Satellite Service. 25.215 Section 25.215 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.215...

43 CFR 43.215 - What must I include in my drug-free awareness program?

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false What must I include in my drug-free awareness program? 43.215 Section 43.215 Public Lands: Interior Office of the Secretary of the Interior GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Requirements for Recipients Other Than Individuals § 43.215 What must I...

2 CFR 215.42 - Codes of conduct.

Science.gov (United States)

2010-01-01

... NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Procurement Standards § 215.42... interest is not substantial or the gift is an unsolicited item of nominal value. The standards of conduct...

[Manufacture and clinical application of 215 IPS-Empress casting ceramic restorations].

Science.gov (United States)

Zhao, Na; Zhou, Jian

2008-08-01

To explore the manufacture and clinical application of IPS-Empress casting ceramic restorations. The problems in manufacture and clinical operation of 215 casting ceramic restorations were analyzed. In 215 casting ceramic restorations, 12 (5.58%) casting ceramic restorations were affected by clinical design or application, 15 (6.98%) casting ceramic restorations were affected by some manufacture problems, and 14 (6.51%) casting ceramic restorations were affected by clinical try-in. Through 2-3 years' follow-up, the achievement ratio of 215 IPS-Empress casting ceramic restorations was 94.88%, and 11 casting ceramic restorations were affected by some problems. Beauty and simultaneous enamel wear are the characteristics of casting ceramic restorations. But because of its brittle, the indications should be strictly selected.

8 CFR 215.7 - Instructions from the Administrator required in certain cases.

Science.gov (United States)

2010-01-01

... IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.7 Instructions from the... authority conferred by § 215.2 in the case of any alien who seeks to depart from the United States in the... United Nations and the United States of America regarding the Headquarters of the United Nations (61 Stat...

12 CFR 215.9 - Disclosure of credit from member banks to executive officers and principal shareholders.

Science.gov (United States)

2010-01-01

... individual for the purposes of determining principal shareholder status. (2) Related interest means: (i) Any... executive officers and principal shareholders. 215.9 Section 215.9 Banks and Banking FEDERAL RESERVE SYSTEM... SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.9 Disclosure of credit from member banks to executive...

48 CFR 1652.215-70 - Rate Reduction for Defective Pricing or Defective Cost or Pricing Data.

Science.gov (United States)

2010-10-01

... Defective Pricing or Defective Cost or Pricing Data. 1652.215-70 Section 1652.215-70 Federal Acquisition... CLAUSES AND FORMS CONTRACT CLAUSES Texts of FEHBP Clauses 1652.215-70 Rate Reduction for Defective Pricing or Defective Cost or Pricing Data. As prescribed in 1615.407-1, the following clause shall be...

7 CFR 215.7 - Requirements for participation.

Science.gov (United States)

2010-01-01

... authority under this part to support a nonprofit nutrition program for the elderly, including a program... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.7 Requirements for participation...

8 CFR 215.4 - Procedure in case of alien prevented from departing from the United States.

Science.gov (United States)

2010-01-01

... departing from the United States. 215.4 Section 215.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.4 Procedure in case of alien prevented from departing from the United States. (a) Any alien, other than an enemy alien, whose departure...

48 CFR 215.404-71-1 - General.

Science.gov (United States)

2010-10-01

... range provides values based on above normal or below normal conditions. In the price negotiation..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215... contracting officer assigns values to each profit factor; the value multiplied by the base results in the...

48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547. [71 FR 69495, Dec. 1, 2006] ...

17 CFR 256.215 - Appropriated retained earnings.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Appropriated retained earnings... UTILITY HOLDING COMPANY ACT OF 1935 Liabilities and Other Credit Accounts § 256.215 Appropriated retained earnings. This account shall include the amount of retained earnings which has been appropriated or set...

40 CFR 180.215 - Naled; tolerances for residues.

Science.gov (United States)

2010-07-01

... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.215... 0.5 Pea, succulent 0.5 Pepper 0.5 Pumpkin 0.5 Safflower, seed 0.5 Spinach 3 Squash, summer 0.5...

8 CFR 215.2 - Authority of departure-control officer to prevent alien's departure from the United States.

Science.gov (United States)

2010-01-01

... prevent alien's departure from the United States. 215.2 Section 215.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF ALIENS DEPARTING FROM THE UNITED STATES § 215.2 Authority of departure-control officer to prevent alien's departure from the United States. (a) No alien...

25 CFR 215.21 - Payment of gross production tax on lead and zinc.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Payment of gross production tax on lead and zinc. 215.21... ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.21 Payment of gross production tax on lead and zinc. The superintendent of the Quapaw Indian Agency is hereby authorized and directed to pay at the...

Negative Ion Source Development and Photodetachment Studies at ISOLDE

CERN Document Server

AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

13 CFR 147.215 - What must I include in my drug-free awareness program?

Science.gov (United States)

2010-01-01

..., rehabilitation, and employee assistance programs; and (d) The penalties that you may impose upon them for drug...-free awareness program? 147.215 Section 147.215 Business Credit and Assistance SMALL BUSINESS... establish an ongoing drug-free awareness program to inform employees about— (a) The dangers of drug abuse in...

48 CFR 2515.215-70 - NSF negotiation authorities.

Science.gov (United States)

2010-10-01

... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Negotiation Authorities 2515.215-70 NSF negotiation authorities. (a) Authorities. Citation: 42 U.S.C. 1870(c). (b) Application. When an NSF contract... international cooperation or national security.” Contracts or their modifications entered into under this...

48 CFR 2152.215-70 - Contractor records retention.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor records... PRECONTRACT PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2152.215-70 Contractor records retention. As prescribed in 2115.071, insert the following clause: Contractor Records Retention (OCT 2005...

48 CFR 215.404-70 - DD Form 1547, Record of Weighted Guidelines Method Application.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-70 DD Form 1547, Record of Weighted Guidelines Method Application. Follow the procedures at PGI 215.404-70 for use of DD Form 1547 whenever a structured...

In-beam alpha, electron, and gamma-ray spectroscopy of 215Fr

International Nuclear Information System (INIS)

Decman, D.J.; Grawe, H.; Kluge, H.; Maier, K.H.; Maj, A.; Menningen, M.; Roy, N.; Wiegner, W.

1983-01-01

The nucleus 215 Fr was studied using the 208 Pb( 11 B, 4n) and 204 Hg( 15 N, 4n) reactions. The measurements included α-γ, γ-γ, and e-e coincidence experiments as well as γ-ray and α-particle DPAD studies. The decay scheme gives levels up to a 3068 keV 39/2 - isomer with tsub(1/2)=(33 +- 5) ns as well as 3 shorter-lived isomers (tsub(1/2) approx.= 4 ns); g-factors have been measured for these isomers. The alpha-particle spectroscopy showed the existence of 4 longrange alphas which could be assigned to excited states in 215 Fr. tsub(1/2)( 215 Frsup(gs)) = (86+-5) ns has been remeasured. The negative parity states up to 1680 keV seem to be members of the π(h9/2) 5 9/2sup(ν)(g9/2) 2 configuration; a strong hindrance of M1 transitions is found. The higher lying states are compared with the DIPM model. (orig.)

XMAP215 is a microtubule nucleation factor that functions synergistically with the γ-tubulin ring complex.

Science.gov (United States)

Thawani, Akanksha; Kadzik, Rachel S; Petry, Sabine

2018-05-01

How microtubules (MTs) are generated in the cell is a major question in understanding how the cytoskeleton is assembled. For several decades, γ-tubulin has been accepted as the universal MT nucleator of the cell. Although there is evidence that γ-tubulin complexes are not the sole MT nucleators, identification of other nucleation factors has proven difficult. Here, we report that the well-characterized MT polymerase XMAP215 (chTOG/Msps/Stu2p/Alp14/Dis1 homologue) is essential for MT nucleation in Xenopus egg extracts. The concentration of XMAP215 determines the extent of MT nucleation. Even though XMAP215 and the γ-tubulin ring complex (γ-TuRC) possess minimal nucleation activity individually, together, these factors synergistically stimulate MT nucleation in vitro. The amino-terminal TOG domains 1-5 of XMAP215 bind to αβ-tubulin and promote MT polymerization, whereas the conserved carboxy terminus is required for efficient MT nucleation and directly binds to γ-tubulin. In summary, XMAP215 and γ-TuRC together function as the principal nucleation module that generates MTs in cells.

12 CFR 215.1 - Authority, purpose, and scope.

Science.gov (United States)

2010-01-01

... executive officers or principal shareholders (or to the related interests of such persons). (4) Extensions... TO EXECUTIVE OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.1... executive officer, director, or principal shareholder of the member bank, of any company of which the member...

48 CFR 852.215-71 - Evaluation factor commitments.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Evaluation factor....215-71 Evaluation factor commitments. As prescribed in 815.304-71(b), insert the following clause: Evaluation Factor Commitments (DEC 2009) The offeror agrees, if awarded a contract, to use the service...

50 CFR 216.215 - Definitions, terms, and criteria

Science.gov (United States)

2010-10-01

... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.215 Definitions...

48 CFR 1552.215-75 - Past performance information.

Science.gov (United States)

2010-10-01

... offeror's reference, the Government will compare the negative response to the responses from the offeror's... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Past performance... 1552.215-75 Past performance information. As prescribed in 1515.209(c), insert the following clause...

41 CFR 105-74.215 - What must I include in my drug-free awareness program?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What must I include in my drug-free awareness program? 105-74.215 Section 105-74.215 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION...

29 CFR 779.215 - General scope of terms.

Science.gov (United States)

2010-07-01

... common control within the meaning of the definition of enterprise. The fact the firms are independently... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Unified Operation Or Common Control § 779.215 General scope of terms. (a) Under the definition related activities...

49 CFR 40.215 - What information about the DER do employers have to provide to BATs and STTs?

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false What information about the DER do employers have to provide to BATs and STTs? 40.215 Section 40.215 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Alcohol Testing Personnel § 40.215 What information about the DER do...

Development and therapeutic application of internally emitting radiopharmaceuticals

International Nuclear Information System (INIS)

Adelstein, S.J.; Bloomer, W.D.

1980-01-01

This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

46 CFR 10.215 - Medical and physical requirements.

Science.gov (United States)

2010-10-01

... be able to grasp, lift, and manipulate various common shipboard tools; move hands and arms to open... an applicant's ability to hear may impact maritime safety, the examining medical practitioner, if not... safety or if table 10.215(a) shows that the mariner must pass a demonstration of physical ability, but he...

48 CFR 853.215-70 - VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA.

Science.gov (United States)

2010-10-01

..., Application for Furnishing Nursing Home Care to Beneficiaries of VA. 853.215-70 Section 853.215-70 Federal... 853.215-70 VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA. VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA, will be used for...

25 CFR 215.23a - Suspension of operations and production on leases for minerals other than oil and gas.

Science.gov (United States)

2010-04-01

... minerals other than oil and gas. 215.23a Section 215.23a Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.23a Suspension of operations and production on leases for minerals other than oil and gas. The provisions of...

28 CFR 2.15 - Petition for consideration of parole prior to date set at hearing.

Science.gov (United States)

2010-07-01

... prior to date set at hearing. 2.15 Section 2.15 Judicial Administration DEPARTMENT OF JUSTICE PAROLE... hearing. When a prisoner has served the minimum term of imprisonment required by law, the Bureau of... consideration for parole prior to the date set by the Commission at the initial or review hearing. The petition...

10 CFR 603.215 - Recipient's commitment and cost sharing.

Science.gov (United States)

2010-01-01

... self-interest in the success of the project and incorporating the technology into products and... proposal, in the recipient's management plan, or through other means. (b) The contracting officer must seek... 603.215 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT...

8 CFR 215.9 - Temporary Worker Visa Exit Program.

Science.gov (United States)

2010-01-01

... Section 215.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROLS OF... participating in the program and must present designated biographic and/or biometric information upon departure... participating in the program, which biographical and/or biometric information would be required, and the format...

2 CFR 215.21 - Standards for financial management systems.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Standards for financial management systems... Financial and Program Management § 215.21 Standards for financial management systems. (a) Federal awarding... information whenever practical. (b) Recipients' financial management systems shall provide for the following...

2 CFR 215.60 - Purpose of termination and enforcement.

Science.gov (United States)

2010-01-01

... Reserved UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of termination and enforcement. 215...

EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2014. Scientific Opinion on Flavouring Group Evaluation 215 (FGE.215): Seven α,β-Unsaturated Cinnamyl Ketones from subgroup 3.2 of FGE.19

DEFF Research Database (Denmark)

Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of flavouring substances from subgroup 3.2 of FGE.19 in the Flavouring Group Evaluation 215 (FGE.215). The Flavour Industry has...

Growth, physicochemical properties, and morphogenesis of Chinese wild-type PRV Fa and its gene-deleted mutant strain PRV SA215

Directory of Open Access Journals (Sweden)

Tang Shanhu

2011-06-01

Full Text Available Abstract Background PRV Fa is common in China and causes most of the pseudorabies in the pig industry. A PRV SA215 strain with deleted gE, gI, and TK genes was constructed to develop a commercial attenuated live vaccine. However, the physicochemical properties, growth pattern, penetration kinetics, and morphogenesis of the PRV SA215 and its parental PRV Fa strain are unclear. Results A series of experiments were conducted to characterize both strains and provide more information. PRV Fa and PRV SA215 were found to have similar penetration patterns, with about 5 min half-time of penetration. The SA215 strain exhibited a slight delay in entry compared with PRV Fa. In the one-step growth test, the titers of the SA215 strain were first detected at 8 h, rapidly increased, and peaked at 12 h. A plateau was formed between 12-36 h of culturing. PRV SA215 showed delayed replication and approximately 10-30-fold lower titers during 0-16 h of culturing compared with the PRV-Fa strain. After 16 h, the PRV Fa titers dramatically decreased, whereas those of PRV SA215 were prolonged to 36 h and reached a titer value equal to that of PRV Fa and then decreased. Both strains were sensitive to both heat and acid-alkali treatments; however, PRV Fa was relatively more stable to heat treatment than PRV SA215. Both strains could propagate in the cultures with pH values from 5.0 to 9.0. Cultures with pH below 3.0 or above 11.0 were fatal to both strains. Both strains had considerable resistance to freeze-thawing treatments. Morphogenetic investigations showed that typical phases in the maturation pathway were observed in the PRV Fa-infected PK15 cells, whereas secondary envelopment was not observed in the PRV SA215 strain. Instead, capsid aggregations with concomitants of electrodense materials were observed. Conclusions These results suggest that PRV SA215 is a promising strain for vaccine development

Growth and apoptosis of human natural killer cell neoplasms: role of interleukin-2/15 signaling.

Science.gov (United States)

Yamasaki, Satoshi; Maeda, Motoi; Ohshima, Koichi; Kikuchi, Masahiro; Otsuka, Teruhisa; Harada, Mine

2004-10-01

Interleukin (IL)-15 plays an important role in the survival of human natural killer (NK) cells. We investigated IL-2/15 signaling in NK cell neoplasms from five patients and in five cell lines (NK-92, KHYG-1, SNK-6, HANK1 and MOTN-1) compared to mature peripheral NK cells from 10 healthy subjects. Apoptosis of NK cell lines was prevented by addition of IL-15 in vitro. Blocking IL-2/15Rbeta on IL-2-stimulated NK-92 cells resulted in reduced expression of Bcl-X(L) and phosphorylated Stat5, which paralleled early apoptosis without altering Bcl-2 expression. These data add IL-2/15Rbeta to the list of factors important for the survival of NK cell neoplasms.

18 CFR 367.2150 - Account 215, Appropriated retained earnings.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 215, Appropriated retained earnings. 367.2150 Section 367.2150 Conservation of Power and Water Resources FEDERAL... retained earnings. This account must include the amount of retained earnings that has been appropriated or...

20 CFR 628.215 - State Human Resource Investment Council.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false State Human Resource Investment Council. 628... PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Planning § 628.215 State Human Resource..., 702, and 703 of the Act, establish a State Human Resource Investment Council (HRIC). The HRIC's...

Effect of Zohar LQ-215, a biorational surfactant, on the sweetpotato whitefly Bemisia tabaci (biotype b).

Science.gov (United States)

Ishaaya, I; Khasdan, V; Horowitz, A Rami

2006-01-01

Zohar LQ-215, a surfactant based on plant oils, able to control nymphs of the whitefly, Bemisia tabaci (Gennadius), under laboratory and field conditions. To evaluate the effects of the surfactant on the nymph stages of whitefly under laboratory conditions, potted cotton seedlings infested with 1st- or 3rd-instars were treated with the compound aqueous solutions. LC90 values of Zohar LQ-215 on 1st and 3rd-nymphs, based on mortality curves, were 0.78% and 1.14%, respectively. Adult mortality of 12% and 19% was obtained at concentrations of 0.5% and 1%, respectively. Under both laboratory and, in some cases, under field conditions, greater mortality was achieved when combining Zohar LQ-215 with the insect growth regulator buprofezin than when either insecticide was applied separately. Our results indicate that Zohar LQ-215 could serve as a potential compound for controlling whiteflies under light to moderate infestation and could be used in combination with other rational insecticides such as buprofezin for controlling whiteflies in integrated pest management programs.

38 CFR 41.215 - Relation to other audit requirements.

Science.gov (United States)

2010-07-01

... using the risk-based audit approach described in § 41.520 and, if not, the estimated incremental cost... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Relation to other audit... (CONTINUED) AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 41.215 Relation to...

48 CFR 215.403-5 - Instructions for submission of cost or pricing data or information other than cost or pricing data.

Science.gov (United States)

2010-10-01

... submission of cost or pricing data or information other than cost or pricing data. 215.403-5 Section 215.403... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.403-5 Instructions for submission of cost or pricing data or information other than cost or pricing data. When the...

Stem cell factor and interleukin-2/15 combine to enhance MAPK-mediated proliferation of human natural killer cells

Science.gov (United States)

Benson, Don M.; Yu, Jianhua; Becknell, Brian; Wei, Min; Freud, Aharon G.; Ferketich, Amy K.; Trotta, Rossana; Perrotti, Danilo; Briesewitz, Roger

2009-01-01

Stem cell factor (SCF) promotes synergistic cellular proliferation in combination with several growth factors, and appears important for normal natural killer (NK)–cell development. CD34+ hematopoietic precursor cells (HPCs) require interleukin-15 (IL-15) for differentiation into human NK cells, and this effect can be mimicked by IL-2. Culture of CD34+ HPCs or some primary human NK cells in IL-2/15 and SCF results in enhanced growth compared with either cytokine alone. The molecular mechanisms responsible for this are unknown and were investigated in the present work. Activation of NK cells by IL-2/15 increases expression of c-kit whose kinase activity is required for synergy with IL-2/15 signaling. Mitogen-activated protein kinase (MAPK) signaling intermediaries that are activated both by SCF and IL-2/15 are enhanced in combination to facilitate earlier cell-cycle entry. The effect results at least in part via enhanced MAPK-mediated modulation of p27 and CDK4. Collectively the data reveal a novel mechanism by which SCF enhances cellular proliferation in combination with IL-2/15 in primary human NK cells. PMID:19060242

29 CFR 553.215 - Ambulance and rescue service employees.

Science.gov (United States)

2010-07-01

... activities, the applicable standard is the one which applies to the activity in which the employee spends the majority of work time during the work period. (b) Ambulance and rescue service employees of public agencies... 29 Labor 3 2010-07-01 2010-07-01 false Ambulance and rescue service employees. 553.215 Section 553...

48 CFR 52.215-15 - Pension adjustments and asset reversions.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Pension adjustments and... Clauses 52.215-15 Pension adjustments and asset reversions. As prescribed in 15.408(g), insert the following clause: Pension Adjustments and Asset Reversions (OCT 2010) (a) The Contractor shall promptly...

30 CFR 204.215 - Are the information collection requirements in this subpart approved by the Office of Management...

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Are the information collection requirements in this subpart approved by the Office of Management and Budget (OMB)? 204.215 Section 204.215 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES...

29 CFR 215.3 - Employees represented by a labor organization.

Science.gov (United States)

2010-07-01

... LABOR GUIDELINES, SECTION 5333(b), FEDERAL TRANSIT LAW § 215.3 Employees represented by a labor... the Federal statute in a manner which does not contravene state or local law. For example, employee... to applicants for the Over-the-Road Bus Accessibility Program, and grant applications for the Other...

48 CFR 1852.215-78 - Make or buy program requirements.

Science.gov (United States)

2010-10-01

... and size status. (g) Any recommendations to defer make-or-buy decisions when categorization of some... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Make or buy program... and Clauses 1852.215-78 Make or buy program requirements. As prescribed in 1815.408-70(a), insert the...

Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

Energy Technology Data Exchange (ETDEWEB)

Liu, Fabao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); You, Xiaona [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Chi, Xiumei [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Wang, Tao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Ye, Lihong [Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); Niu, Junqi, E-mail: junqiniu@yahoo.com.cn [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Zhang, Xiaodong, E-mail: zhangxd@nankai.edu.cn [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China)

2014-02-07

Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells.

Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

Energy Technology Data Exchange (ETDEWEB)

Claesson, Kristina

2011-05-15

In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

Spectroscopy of 215Ra: the shell model and enhanced E3 transitions

International Nuclear Information System (INIS)

Stuchbery, A.E.; Dracoulis, G.D.; Kibedi, T.; Fabricius, B.; Lane, G.J.; Poletti, A.R.; Baxter, A.M.

1998-01-01

Excited states in the N=127 nucleus 215 Ra have been studied using γ-ray and electron spectroscopy following reactions of 13 C on 206 Pb targets. Levels were identified up to spins of ∝61/2 ℎ and excitation energies of ∝6 MeV. Enhanced octupole transitions are a feature of the level scheme. Lifetimes and magnetic moments were measured for several isomeric levels. The level scheme, transition rates and magnetic moments are compared with empirical shell model calculations and multiparticle octupole-coupled shell model calculations. In general, the experimental data are well described, but in comparison with its success in describing enhanced E3 transitions between related states in the radon isotopes, some limitations of the multiparticle octupole-coupling approach are revealed in 215 Ra. (orig.)

41 CFR 102-41.215 - Do we report to GSA all forfeited, voluntarily abandoned, or unclaimed drug paraphernalia not...

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Do we report to GSA all forfeited, voluntarily abandoned, or unclaimed drug paraphernalia not required for official use? 102-41.215 Section 102-41.215 Public Contracts and Property Management Federal Property Management Regulations System...

A phase I, randomized, single-dose study evaluating the pharmacokinetic equivalence of biosimilar ABP 215 and bevacizumab in healthy adult men.

Science.gov (United States)

Markus, Richard; Chow, Vincent; Pan, Zhiying; Hanes, Vladimir

2017-10-01

This study compared the pharmacokinetic (PK) profiles of the proposed biosimilar ABP 215 with bevacizumab in healthy males. In this randomized, single-blind, single-dose, three-arm, parallel-group study, healthy subjects were randomized to receive ABP 215 (n = 68), bevacizumab (US) (n = 67), or bevacizumab (EU) (n = 67) 3 mg/kg intravenously. Primary endpoints were area under the serum concentration-time curve from time 0 extrapolated to infinity (AUC inf ) and the maximum observed concentration (C max ). Secondary endpoints included safety and immunogenicity. AUC inf and C max were similar across the three groups. Geometric means ratio (GMR) for C max and AUC inf , respectively, was 0.98 and 0.99 for ABP 215 versus bevacizumab (US); 1.03 and 0.96 for ABP 215 versus bevacizumab (EU); and 1.05 and 0.97 for bevacizumab (US) versus bevacizumab (EU). The 90% confidence intervals for the GMRs of AUC inf and C max were within the prespecified standard PK bioequivalence criteria of 0.80 to 1.25. The incidence of adverse events (AEs) was 47.1, 32.8, and 61.2% in the ABP 215, bevacizumab (US) and bevacizumab (EU) groups, respectively. When analyzed by investigational site, the incidence and severity of AEs were comparable in the ABP 215 and bevacizumab groups. There were no AEs leading to study discontinuation. No binding or neutralizing anti-drug anti-bodies was detected. This study demonstrated the PK similarity of ABP 215 to both bevacizumab (US) and bevacizumab (EU), and of bevacizumab (US) to bevacizumab (EU). Safety and tolerability were comparable between treatments and no subject developed binding or neutralizing anti-drug anti-bodies.

49 CFR 215.109 - Defective plain bearing box: Journal lubrication system.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing box: Journal lubrication... Freight Car Components Suspension System § 215.109 Defective plain bearing box: Journal lubrication system...) Metal parts contacting the journal; or (e) Is— (1) Missing; or (2) Not in contact with the journal. ...

Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

International Nuclear Information System (INIS)

Koziorowski, J.

1998-01-01

Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

13 CFR 120.215 - What interest rates apply to smaller loans?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What interest rates apply to... BUSINESS LOANS Policies Specific to 7(a) Loans Maturities; Interest Rates; Loan and Guarantee Amounts § 120.215 What interest rates apply to smaller loans? For a loan over $25,000 but not exceeding $50,000, the...

48 CFR 52.215-20 - Requirements for Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data.

Science.gov (United States)

2010-10-01

... Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data. 52.215-20 Section 52.215-20... Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data. As prescribed in 15.408(l), insert the following provision: Requirements for Certified Cost or Pricing Data and Data Other Than...

27 CFR 28.215 - Certificate of tax determination, Form 2605 (5120.20).

Science.gov (United States)

2010-04-01

... Wine With Benefit of Drawback § 28.215 Certificate of tax determination, Form 2605 (5120.20). Every....20), which shall be executed, in duplicate, (a) by the person who withdrew the wine from bond on tax determination, certifying that all taxes have been properly determined on such wine, or (b) where the wine was...

27 CFR 24.215 - Wine or wine products not for beverage use.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine or wine products not... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.215 Wine or wine products not for beverage use. (a) General. Wine, or wine products made from wine...

48 CFR 215.404-74 - Fee requirements for cost-plus-award-fee contracts.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Fee requirements for cost... NEGOTIATION Contract Pricing 215.404-74 Fee requirements for cost-plus-award-fee contracts. In developing a fee objective for cost-plus-award-fee contracts, the contracting officer shall— (a) Follow the...

LncRNA MEG3 enhances cisplatin sensitivity in non-small cell lung cancer by regulating miR-21-5p/SOX7 axis

Directory of Open Access Journals (Sweden)

Wang P

2017-10-01

Full Text Available Pei Wang,* Dong Chen,* Hongbing Ma, Yong LiDepartment of Cardiothoracic Surgery, Huaihe Hospital of Henan University, Kaifeng, People’s Republic of China *These authors contributed equally to this work Background: Long noncoding RNAs (lncRNAs have been revealed to play essential role in drug resistance of multiple cancers. LncRNA MEG3 was previously reported to be associated with cisplatin (DDP resistance in non-small cell lung cancer (NSCLC cells. However, the molecular mechanism of MEG3 affecting DDP resistance in NSCLC remains to be further illustrated. In this study, we attempted to discuss whether MEG3 also could function as a competing endogenous RNA to regulate DDP resistance in NSCLC.Materials and methods: The expression of MEG3, miR-21-5p, and sex-determining region Y-box 7 (SOX7 in NSCLC tissues or cells was examined by quantitative real-time polymerase chain reaction (qRT-PCR. 3-(4,5-Dimethylthazol-2-yl-2,5-diphenyltetrazolium bromide (MTT, flow cytometry, and caspase-3 activity analysis were applied to assess the DDP sensitivity of NSCLC cells. The interaction between MEG3, miR-21-5p, and SOX7 was explored by luciferase reporter assay, RNA immunoprecipitation (RIP assay, qRT-PCR, and Western blot. Mouse NSCLC transplanted tumor was established to verify the functional role of MEG3 in DDP resistance in vivo.Results: MEG3 was downregulated in DDP-resistant NSCLC cells. Overexpression of MEG3 enhanced DDP sensitivity of NSCLC cells in vitro. MEG3 directly interacted with miR-21-5p and suppressed its expression. miR-21-5p significantly abolished the effects of MEG3 on DDP resistance via modulating cell proliferation and apoptosis. SOX7 was identified as a direct target of miR-21-5p and MEG3 positively regulated SOX7 expression by suppressing miR-21-5p. Moreover, MEG3 knockdown-induced pro-proliferative and anti-apoptotic effects were reversed in DDP-resistant NSCLC cells by upregulating SOX7. Furthermore, upregulation of MEG3 induced

Myostatin Promotes Interleukin-1β Expression in Rheumatoid Arthritis Synovial Fibroblasts through Inhibition of miR-21-5p

Directory of Open Access Journals (Sweden)

Sung-Lin Hu

2017-12-01

Full Text Available Rheumatoid arthritis (RA is characterized by the infiltration of a number of pro-inflammatory cytokines into synovial fluid and patients with RA often develop joint destruction and deficits in muscle mass. The growth factor myostatin is a key regulator linking muscle mass and bone structure. We sought to determine whether myostatin regulates rheumatoid synovial fibroblast activity and inflammation in RA. We found that levels of myostatin and interleukin (IL-1β (a key pro-inflammatory cytokine in RA in synovial fluid from RA patients were overexpressed and positively correlated. In in vitro investigations, we found that myostatin dose-dependently regulated IL-1β expression through the ERK, JNK, and AP-1 signal-transduction pathways. Computational analysis confirmed that miR-21-5p directly targets the expression of the 3′ untranslated region (3′ UTR of IL-1β. Treatment of cells with myostatin inhibited miR-21-5p expression and miR-21-5p mimic prevented myostatin-induced enhancement of IL-1β expression, showing an inverse correlation between miR-21-5p and IL-1β expression during myostatin treatment. We also found significantly increased paw swelling in an animal model of collagen-induced arthritis (CIA, compared with controls; immunohistochemistry staining revealed substantially higher levels of myostatin and IL-1β expression in CIA tissue. Our evidence indicates that myostatin regulates IL-1β production. Thus, targeting myostatin may represent a potential therapeutic target for RA.

48 CFR 215.404-71-3 - Contract type risk and working capital adjustment.

Science.gov (United States)

2010-10-01

.... Cost-plus-incentive-free (4) 1.0 0 to 2. Cost-plus-fixed-fee (4) 0.5 0 to 1. Time-and-materials... considered cost-plus-fixed-fee contracts for the purposes of assigning profit values. They shall not receive... CONTRACTING BY NEGOTIATION Contract Pricing 215.404-71-3 Contract type risk and working capital adjustment. (a...

Neuroligin 2 R215H Mutant Mice Manifest Anxiety, Increased Prepulse Inhibition, and Impaired Spatial Learning and Memory

Directory of Open Access Journals (Sweden)

Chia-Hsiang Chen

2017-11-01

Full Text Available Neuroligin 2 (NLGN2 is a postsynaptic adhesion protein that plays an essential role in synaptogenesis and function of inhibitory neuron. We previously identified a missense mutation R215H of the NLGN2 in a patient with schizophrenia. This missense mutation was shown to be pathogenic in several cell-based assays. The objective of this study was to better understand the behavioral consequences of this mutation in vivo. We generated a line of transgenic mice carrying this mutation using a recombinant-based method. The mice were subjected to a battery of behavioral tests including open field locomotor activity assay, prepulse inhibition (PPI assay, accelerated rotarod test, novel location and novel recognition tests, elevated plus-maze (EPM test, and Morris water maze test. The transgenic animals were viable and fertile, but the Nlgn2 R215H knock-in (KI homozygous mice showed growth retardation, anxiety-like behavior, increased PPI, and impaired spatial learning and memory. There was no significant interaction between sex and genotype in most behavioral tests; however, we observed a significant interaction between sex and genotype in EPM test in this study. Also, we found that the Nlgn2 R215H homozygous KI mice did not express the NLGN2 protein, resembling Nlgn2 knockout mice. Our results demonstrate that Nlgn2 R215H KI homozygous mice manifest several behavioral abnormalities similar to those found in psychiatric patients carrying NLGN2 mutations, indicating that dysfunction of NLGN2 contributes to the pathogenesis of certain psychiatric symptoms commonly present in various mental disorders, not limited to schizophrenia.

Astatine-211 labeling. A study towards automatic production of astatinated antibodies

International Nuclear Information System (INIS)

Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

2015-01-01

Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

31 CFR 215.9 - Change of legal residence by members of the Armed Forces.

Science.gov (United States)

2010-07-01

... legal residence. The notification shall include the name, social security number, current mailing... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Change of legal residence by members... Withholding Agreement § 215.9 Change of legal residence by members of the Armed Forces. (a) In determining the...

Safety analysis report for packaging (onsite) for limited type Bmaterial in the CNS 14-215H cask

International Nuclear Information System (INIS)

Flanagan, B.D.

1997-01-01

The purpose of this Safety Analysis Report for Packaging is to provide the analyses and evaluations necessary to demonstrate that the CNS 14-215H cask provided by Chem-Nuclear Systems Inc. can safety transport greater than Type A quantities of radioactive material on the Hanford Site. The CNS 14-215H cask was chosen for its loading abilities, availability, and because it has a Certificate of Compliance (CoC) issued by the U.S. Nuclear Regulatory Commission (NRC) for transporting low specific activity in quantities greater than Type A material in commerce. Although the CDC does not cover greater than Type A material not meeting LSA requirements, it does allow for an established level of protection in determining the safety of transporting Type B material on the Hanford Site

$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

CERN Multimedia

We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

48 CFR 52.215-11 - Price Reduction for Defective Certified Cost or Pricing Data-Modifications.

Science.gov (United States)

2010-10-01

... accordingly and the contract shall be modified to reflect the reduction. This right to a price reduction is... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Price Reduction for... CONTRACT CLAUSES Text of Provisions and Clauses 52.215-11 Price Reduction for Defective Certified Cost or...

Sterol-mediated regulation of mevalonic acid synthesis. Accumulation of 4-carboxysterols as the predominant sterols synthesized in a Chinese hamster ovary cell cholesterol auxotroph (mutant 215)

International Nuclear Information System (INIS)

Plemenitas, A.; Havel, C.M.; Watson, J.A.

1990-01-01

Chinese hamster ovary-215 (CHO-215) mutant cells are auxotrophic for cholesterol. Berry and Chang (Berry, D. J., and Chang, T. Y. (1982) Biochemistry 21, 573-580) suggested that the metabolic lesion was at the level of 4-methyl sterol oxidation. However, the observed cellular accumulation of lanosterol was not consistent with a defect at this metabolic site. With the use of a novel Silica Sep Pak sterol separation procedure, we demonstrated that 60-80% of the acetonesoluble lipid radioactivity in [5-3H]mevalonate-labeled CHO-215 cells was incorporated into acidic sterols. 7(8),Cholesten-4 beta-methyl,4 alpha-carboxy,3 beta-ol was the dominant end product. In addition to this acidic sterol, 7(8),24-cholestadien,4 beta-methyl,4 alpha-carboxy,3 beta-ol and 7(8),24-cholestadien,4 alpha-carboxy,3 beta-ol were also isolated. Incubation of cell-free extracts with [3H]7(8)-cholesten-4 beta-methyl, 4 alpha-carboxy,3 beta-ol and pyridine nucleotides confirmed that CHO-215 4-carboxysterol decarboxylase activity was less than 1% of that for wild type cells. Thus, a correspondence between decreased 4-carboxysterol decarboxylase activity and the spectrum of accumulated sterol products by intact CHO-215 cells was demonstrated. No detectable cholesterol was synthesized by CHO-215 cells. 3H-Product accumulation studies demonstrated that 7(8),24-cholestadien, 4 beta-methyl,4 alpha-carboxy,3 beta-ol increased prior to its subsequent saturation at the delta 24 carbon. Furthermore, the steady state ratio for delta 24-saturated acidic sterols/unsaturated acidic sterols was dependent on media cholesterol source and amount. Finally, the accumulated acidic sterol(s) were not regulatory signal molecules for the modulation of 3-hydroxy-3-methyl-glutaryl coenzyme. A reductase activity in response to cholesterol availability

48 CFR 215.404-72 - Modified weighted guidelines method for nonprofit organizations other than FFRDCs.

Science.gov (United States)

2010-10-01

... Defense or a Secretary of a Department as receiving sustaining support on a cost-plus-fixed-fee basis from... METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-72 Modified weighted... of the costs in Block 20 of the DD Form 1547. Show the net (reduced) amount on the DD Form 1547. (ii...

A retrospective study of serum β-hydroxybutyric acid in 215 ill cats: clinical signs, laboratory findings and diagnoses.

Science.gov (United States)

Aroch, Itamar; Shechter-Polak, M; Segev, Gilad

2012-02-01

Serum concentrations of β-hydroxybutyric acid (sBHBA) are increased in cats with diabetes mellitus (DM), diabetic ketoacidosis (DKA) and hepatic lipidosis (HL). This study assessed sBHBA as a diagnostic tool in 215 consecutively-enrolled ill cats in the general population in a veterinary hospital. At the time of presentation, sBHBA was within the reference range in 158/215 (73.5%) cats (median 0.27; range 0.00-0.49 mmol/L) and elevated in 57/215 (26.5%) cats (median 0.87; range 0.51-21.45 mmol/L). Compared to cats with normal sBHBA, those with increased sBHBA had higher frequencies of anorexia, weight loss, icterus, polyuria/polydipsia, hyperbilirubinaemia, hypertriglyceridaemia, pancreatitis, HL, DM and DKA. They had higher concentrations of bilirubin and triglycerides and lower concentrations of potassium, chloride and total protein. There were positive correlations (P<0.01) between sBHBA and urinary glucose (r=0.42) and ketones (r=0.76), but there were no group differences in dipstick levels of urinary ketones. Cats with DM/DKA and with HL had significantly higher sBHBA compared to other cats. Receiver operator characteristics analysis of sBHBA as a predictor of HL showed that sBHBA was a good predictor of HL. Increased sBHBA occurs frequently in ill cats and provides useful diagnostic information, especially in DM/DKA and HL. Copyright © 2011 Elsevier Ltd. All rights reserved.

Zum 215. Gebutstag von Admiral Ferdinand Baron von Wrangell : (29. Dezember 1797 - 25. 25. Mai 1870) / Peter Krienitz

Index Scriptorium Estoniae

Krienitz, Peter

2012-01-01

Admiral Ferdinand Baron von Wrangellist tema 215. sünniaastapäeva puhul. Silmapaistavast Kirde-Siberi uurijast. Tema poliitilisest tegevusest ja elust Roela mõisas. Ferdinand Baroni poolt seatud viisil tähistati jõulusid Roelas kuni 1944. aasta lõpuni.

Characterization of acid flux in osteoclasts from patients harboring a G215R mutation in ClC-7

DEFF Research Database (Denmark)

Henriksen, Kim; Gram, Jeppe; Neutzsky-Wulff, Anita Vibsig

2008-01-01

-I, calcium release, and pit area when comparing to age and sex matched controls. In addition, the ADOII osteoclasts showed no differences in actin ring formation. Finally, V-ATPase and chloride channel inhibitors completely abrogated the H(+) and Cl(-) driven acidification. Finally, the acid influx...... mutation in ClC-7 (G215R) were isolated, and used these to investigate bone resorption measured by CTX-I, calcium release and pit scoring. The actin cytoskeleton of the osteoclasts was also investigated. ClC-7 enriched membranes from the osteoclasts were isolated, and used to test acidification rates...... in the presence of a V-ATPase and a chloride channel inhibitor, using a H(+) and Cl(-) driven approach. Finally, acidification rates in ClC-7 enriched membranes from ADOII osteoclasts and their corresponding controls were compared. Resorption by the G215R osteoclasts was reduced by 60% when measured by both CTX...

[Pediatric lung lesions: a clinicopathological study of 215 cases].

Science.gov (United States)

Niu, Huilin; Wang, Fenghua; Liu, Wei; Wang, Yong; Chen, Zhengrong; Gao, Qiu; Yi, Peng; Li, Liping; Zeng, Rongxin

2015-09-01

To investigate clinical and pathological features of lung lesions in children. Clinical manifestations, radiologic imaging, histopathological features and immunohistochemical results were analyzed in 215 cases of lung lesions in children. A total of 215 cases of lung lesions in children aged 0 day to 13 years (average age of 27.2 months and the median age of 18.0 months) were selected, including 137 male and 78 female patients with a male to female ratio of 1.76:1.00. The incidence of congenital lung disease was higher in patients of less than 1 year old than those of over 1 year old age, and the difference of the two groups was statistically significant (P = 0.004). 142 cases had acquired lung diseases, and 73 cases had congenital bronchopulmonary dysplasia. Lung abscess was the most common lesion seen in 86 cases (40.0%), including 1 case of fungal abscess. Congenital pulmonary airway malformation (CPAM) was the second most common, seen in 44 patients (20.5%), including 20 cases of type 1, 18 cases of type 2 and 6 cases of type 4 CPAM. Pulmonary sequestration was found in 25 cases (11.6%) including 14 cases of intralobar type and 11 cases of extralobar type. Two cases of extralobar pulmonary sequestration showed simultaneous CPAM2 type 2 lesion. Other lesions included tuberculosis (13 cases, 6.0%), emphysema (12 cases, 5.6%), interstitial pneumonia (7 cases, 3.2%), pulmonary hemorrhage (6 cases, 2.8%), bronchogenic cyst (4 cases, 1.9%), bronchiolitis obliterans (2 cases, 0.9%), idiopathic pulmonary hemosiderin deposition disease (2 cases, 0.9%) and 1 cases of lung non-specific changes. 13 cases of neoplastic lesions (6.0%) were found, of which 11 cases were primary tumors (5.1%), including inflammatory myofibroblastic tumor in 5 patients (2.3%), pleuropulmonary blastoma in 5 cases (1 case of type I, 2 type II and 2 type III) and 1 case of mucoepidermoid carcinoma (0.5%) and 2 cases of metastatic tumors (hepatoblastoma and Wilm's tumor, 0.9%). Infectious diseases

Impactos de atropelamentos de animais silvestres no trecho da rodovia SP-215 confrontante ao Parque Estadual de Porto Ferreira – Porto Ferreira, SP (Nota Científica. Impacts roadkills mortality of wild animals in the area of SP-215 highway alongside Porto Ferreira State Park – Porto Ferreira, SP (Scientific Note.

Directory of Open Access Journals (Sweden)

Sonia Aparecida de SOUZA

2010-12-01

Full Text Available No presente trabalho foi realizado o monitoramento dos atropelamentos de animais silvestres na rodovia SP–215 no trecho confrontante ao Parque Estadual de Porto Ferreira. Em seis anos foram registrados 72 indivíduos, sendo 17 espécies de mamíferos, 10 de aves, quatro de répteis, uma de anfíbio e três indivíduos não identificados. Dentre esses, lobo-guará Chrysocyon brachyurus, jaguatirica Leopardus pardalis e cuíca-lanosa Caluromys lanatus se encontram na lista das espécies ameaçadas de extinção do Estado de São Paulo. A partir do conhecimento das espécies atingidas, faz-se necessário o desenvolvimento de estudos e propostas de implantação de medidas mitigadoras à presença da rodovia SP–215 para a conservação da fauna.This paper presents the data collected through the monitoring of roadkills on SP–215 highway in the area alongside Porto Ferreira State Park. During six years, 72 roadkills were recorded, including 17 species of mammals, 10 of birds, five of reptiles, one of amphibians and three unidentified individuals. Among those species, maned wolf Chrysocyon brachyurus, ocelot Leopardus pardalis, and Western woolly opossum Caluromys lanatus are included in the threatened species list of the state of São Paulo. After finding out which species are affected, it is necessary to develop studies and proposals for implementing effective mitigation measures for the presence of SP–215 highway in the area in order to preserve the local fauna.

TMBP200, a XMAP215 homologue of tobacco BY-2 cells, has an essential role in plant mitosis.

Science.gov (United States)

Yasuhara, Hiroki; Oe, Yuki

2011-07-01

TMBP200 from tobacco BY-2 cells is a member of the highly conserved family of microtubule-associated proteins that includes Xenopus XMAP215, human TOGp, and Arabidopsis MOR1/GEM1. XMAP215 homologues have an essential role in spindle assembly and function in animals and yeast, but their role in plant mitosis is not fully clarified. Here, we show by immunoblot analysis that TMBP200 levels in synchronously cultured BY-2 cells increased when the cells entered mitosis, thus indicating that TMBP200 plays an important role in mitosis in tobacco. To investigate the role of TMBP200 in mitosis, we employed inducible RNA interference to silence TMBP200 expression in BY-2 cells. The resulting depletion of TMBP200 caused severe defects in bipolar spindle formation and resulted in the appearance of multinucleated cells with variable-sized nuclei. This finding indicates that TMBP200 has an essential role in bipolar spindle formation and function.

Adaptation of the fish juvenile growth test (OECD TG 215, 2000) to the marine species Dicentrarchus labrax.

Science.gov (United States)

Tornambè, A; Manfra, L; Canepa, S; Oteri, F; Martuccio, G; Cicero, A M; Magaletti, E

2018-02-01

The OECD TG 215 method (2000) (C.14 method of EC Regulation 440/2008) was developed on the rainbow trout (Oncorynchus mykiss) to assess chronic toxicity (28d) of chemicals on fish juveniles. It contemplates to use other well documented species identifying suitable conditions to evaluate their growth. OECD proposes the European sea bass (Dicentrarchus labrax, L. 1758) as Mediterranean species among vertebrates recommended in the OECD guidelines for the toxicity testing of chemicals. In this context, our study is aimed to proposing the adaptation of the growth test (OECD TG 215, 2000) to D. labrax. For this purpose toxicity tests were performed with sodium dodecyl sulfate, a reference toxicant commonly used in fish toxicity assays. The main aspects of the testing procedure were reviewed: fish size (weight), environmental conditions, dilution water type, experimental design, loading rate and stocking density, feeding (food type and ration), test validity criteria. The experience gained from growth tests with the sea bass allows to promote its inclusion among the species to be used for the C.14 method. Copyright © 2016. Published by Elsevier Inc.

Temporal dynamics of cortical and subcortical responses to apomorphine in Parkinson disease: an H2(15)O PET study

NARCIS (Netherlands)

Hosey, Lara A.; Thompson, Jennifer L. W.; Metman, Leonard Verhagen; van den Munckhof, Pepyn; Braun, Allen R.

2005-01-01

H2(15)O positron emission tomography (PET) was used to study the temporal course of central nervous system (CNS) responses to apomorphine in patients with idiopathic Parkinson disease (PD). Agonist-induced changes in regional cerebral blood flow (rCBF) were evaluated within

An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

Science.gov (United States)

1991-12-01

d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

12 CFR Appendix to Part 215 - Section 5200 of the Revised Statutes Total Loans and Extensions of Credit

Science.gov (United States)

2010-01-01

... extensions of credit and not upon any full or partial recourse endorsement or guarantee by the transferor... Loans and Extensions of Credit Appendix to Part 215 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... Statutes Total Loans and Extensions of Credit (a)(1) The total loans and extensions of credit by a national...

The XMAP215 Ortholog Alp14 Promotes Microtubule Nucleation in Fission Yeast.

Science.gov (United States)

Flor-Parra, Ignacio; Iglesias-Romero, Ana Belén; Chang, Fred

2018-06-04

The organization and number of microtubules (MTs) in a cell depend on the proper regulation of MT nucleation. Currently, the mechanism of nucleation is the most poorly understood aspect of MT dynamics. XMAP215/chTOG/Alp14/Stu2 proteins are MT polymerases that stimulate MT polymerization at MT plus ends by binding and releasing tubulin dimers. Although these proteins also localize to MT organizing centers and have nucleating activity in vitro, it is not yet clear whether these proteins participate in MT nucleation in vivo. Here, we demonstrate that in the fission yeast Schizosaccharomyces pombe, the XMAP215 ortholog Alp14 is critical for efficient MT nucleation in vivo. In multiple assays, loss of Alp14 function led to reduced nucleation rate and numbers of interphase MT bundles. Conversely, activation of Alp14 led to increased nucleation frequency. Alp14 associated with Mto1 and γ-tubulin complex components, and artificially targeting Alp14 to the γ-tubulin ring complexes (γ-TuRCs) stimulated nucleation. In imaging individual nucleation events, we found that Alp14 transiently associated with a γ-tubulin particle shortly before the appearance of a new MT. The transforming acidic coiled-coil (TACC) ortholog Alp7 mediated the localization of Alp14 at nucleation sites but not plus ends, and was required for efficient nucleation but not for MT polymerization. Our findings provide the strongest evidence to date that Alp14 serves as a critical MT nucleation factor in vivo. We suggest a model in which Alp14 associates with the γ-tubulin complex in an Alp7-dependent manner to facilitate the assembly or stabilization of the nascent MT. Copyright © 2018 Elsevier Ltd. All rights reserved.

75 FR 17156 - Gulf of Mexico, Outer Continental Shelf, Western Planning Area, Oil and Gas Lease Sale 215 (2010...

Science.gov (United States)

2010-04-05

... environmental assessment (EA) for proposed Gulf of Mexico Outer Continental Shelf (OCS) oil and gas Lease Sale... Environmental Impact Statement; Volumes I and II (Multisale EIS, OCS EIS/EA MMS 2007-018) and in the Gulf of...; Western Planning Area Sales 210, 215, and 218--Final Supplemental Environmental Impact Statement...

Effects of Glucopone 215 CSUP Concentration on Size and Magnetic Property of Co-Ni-Cu Nanoparticles Prepared by Electrodeposition Method

International Nuclear Information System (INIS)

Abdul Razak Daud; Setia Budi; Shahidan Radiman

2011-01-01

Co-Ni-Cu nanoparticles were prepared by electrodeposition method at co-deposition potential of -925 mV (SCE) from sulphate solution (0.018 M Co 2+ + 0.180 M Ni 2+ + 0.002 M Cu 2+ ), both in the presence and in the absence of surfactant, Glucopone 215 CSUP. The effect of surfactant concentration on size and magnetic properties of Co-Ni-Cu nanoparticles produced was investigated. Surface morphology was analyzed using a field emission scanning electron microscope (FESEM) while its magnetic properties were investigated by a vibrating sampel magnetometer (VSM). Co-Ni-Cu nanoparticles prepared from the Glucopone 215 CSUP- containing solution were spherical with nanometer size. The finest particles were about 50 nm obtained when 5 v% of surfactant was used which was the highest surfactant concentration studied in this work. Coercivity (H c ) of the samples prepared from electrolytes containing surfactant was higher than those of prepared without surfactant. (author)

Road to Grid Parity through Deployment of Low-Cost 21.5% N-Type Si Solar Cells

Energy Technology Data Exchange (ETDEWEB)

Velundur, Vijay [Suniva, Norcross, GA (United States)

2017-04-19

This project seeks to develop and deploy differentiated 21.5% efficient n-type Si solar cells while reaching the SunShot module cost goal of ≤ $0.50/W. This objective hinges on development of enabling low cost technologies that simplify the manufacturing process and reduce overall processing costs. These comprise of (1) Boron emitter formation and passivation; (2) Simplified processing process for emitter and BSF layers; and (3) Advanced metallization for the front and back contacts.

48 CFR 52.215-21 - Requirements for Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing...

Science.gov (United States)

2010-10-01

... Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data-Modifications. 52.215-21... Requirements for Certified Cost or Pricing Data and Data Other Than Certified Cost or Pricing Data... Pricing Data and Data Other Than Certified Cost or Pricing Data—Modifications (OCT 2010) (a) Exceptions...

Charge radii and electromagnetic moments of At-211195

Science.gov (United States)

Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

2018-05-01

Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

Diurnal and Semidiurnal Tides in the Middle Atmosphere over Balasore (21.5°N, 86.9°E).

Science.gov (United States)

Sasi, M. N.; Krishna Murthy, B. V.

1990-09-01

Using rocket wind data at a tropical station, Balasore (21.5°N, 86.9°E), the diurnal and semidiurnal tidal amplitudes and phases of the zonal and meridional components have been obtained over an altitude range of 20-65 km for equinox, summer and winter seasons. Comparison with the theoretical values revealed some important differences between the two and the implications of these are discussed.

Workshop on selected aspects of radiochemistry

International Nuclear Information System (INIS)

1991-11-01

The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

Energy Technology Data Exchange (ETDEWEB)

Jaszczak, R.J.

1995-12-01

Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

International Nuclear Information System (INIS)

Jaszczak, R.J.

1995-12-01

Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

Optical band gap demarcation around 2.15 eV depending on preferred orientation growth in red HgI{sub 2} films

Energy Technology Data Exchange (ETDEWEB)

Tyagi, Pankaj, E-mail: pankajtyagicicdu@gmail.com

2017-04-01

Thermally evaporated stoichiometric films of red HgI{sub 2} show preferred orientation growth with either (102) or (002) orientation. The as grown films shows a change from one preferred orientation to another depending on their thickness, open-air heat-treatment and in-situ heat treatment of films. The in-situ heat-treatment of thermally evaporated stoichiometric films of red HgI{sub 2} with preferred growth of (102) orientation shows a gradual linear decrease in film thickness with in-situ heat-treatment temperature. On in-situ heat-treatment above 80 °C, it is found that HgI{sub 2} films become thinner than 900 nm, which are otherwise difficult to grow due to high vapor pressure of HgI{sub 2}. For these films the preferred orientation also changed from (102) to (002). The optical band gap (E{sub g}) also found to increase linearly with in-situ heat-treatment temperature. It is interesting to note that in-situ heat-treated films having (002) orientation had higher values of optical band gap than (102) orientation films. On combining these results with those of as grown and open-air heat-treated red HgI{sub 2} films reported in the literature, it is evident that there exists an optical band gap demarcation around 2.15 eV for red HgI{sub 2} thin films depending on their preferred orientation growth. Films with (102) orientation are found to have optical band gap less than 2.15 eV and those with (002) orientation are found to have optical band gap more than 2.15 eV. This is irrespective of the physical mean of obtaining the preferred orientation. The preferred orientation can be achieved by either physical means such as growing films with higher thickness, heat-treating them for short duration in open air or heat-treating them in-situ.

The growth speed of microtubules with XMAP215-coated beads coupled to their ends is increased by tensile force

Science.gov (United States)

Trushko, Anastasiya; Schäffer, Erik; Howard, Jonathon

2013-01-01

The generation of pulling and pushing forces is one of the important functions of microtubules, which are dynamic and polarized structures. The ends of dynamic microtubules are able to form relatively stable links to cellular structures, so that when a microtubule grows it can exert a pushing force and when it shrinks it can exert a pulling force. Microtubule growth and shrinkage are tightly regulated by microtubule-associated proteins (MAPs) that bind to microtubule ends. Given their localization, MAPs may be exposed to compressive and tensile forces. The effect of such forces on MAP function, however, is poorly understood. Here we show that beads coated with the microtubule polymerizing protein XMAP215, the Xenopus homolog of Dis1 and chTOG, are able to link stably to the plus ends of microtubules, even when the ends are growing or shrinking; at growing ends, the beads increase the polymerization rate. Using optical tweezers, we found that tensile force further increased the microtubule polymerization rate. These results show that physical forces can regulate the activity of MAPs. Furthermore, our results show that XMAP215 can be used as a handle to sense and mechanically manipulate the dynamics of the microtubule tip. PMID:23964126

Limited ability of humoral immune responses in control of viremia during infection with SIVsmmD215 strain

Energy Technology Data Exchange (ETDEWEB)

Ribiero, Ruy M [Los Alamos National Laboratory

2009-01-01

To investigate the impact of humoral immunity on SIV replication, 11 rhesus macaques (RMs) were inoculated with the neutralization-sensitive strain SIVsmmD215. Seven RMs were treated every three weeks, with 50 mglkg of an anti-CD20 antibody (Rituxan, gift from Genentech) starting from day -7 p.i., as follows: four RMs were treated for two months, and three were treated for five months. The remaining four RMs were used as controls. Three RMs were completely depleted of CD20 cells. Four RMs only partially depleted CD20 cells in the LNs and intestine. The efficacy of tissue CD20 depletion predicted the ablation of antibody production, with SIVsmm seroconversion being delayed in the animals with complete tissue CD20 depletion, and neutralizing antibody production being significantly delayed and at low levels in all CD20-depleted RMs. There was no significant difference in acute or chronic VLs between CD20-depleted RMs and control monkeys, with a tendency for lower set-point VLs in CD20-depleted RMs. At 6 weeks p.i., cellular immune responses were significantly stronger in CD20 depleted RMs than in controls. After two years p.i., there was no significant difference in survival between CD20-depleted and control RMs. We concluded that CD20 depletion plays no significant role in the control of SIV replication or disease progression in SIVsmmD215-infected RMs.

Foco Nasmyth para el telescopio 2,15mts. de CASLEO

Science.gov (United States)

Casagrande, A. R.

En principio, este proyecto intenta lograr el mayor aprovechamiento posible del instrumental que se dispone, buscando la manera de optimizar y hacer más eficiente el servicio que brinda el CASLEO a la comunidad astronómica. El mismo consiste en utilizar dispositivos ya existentes en el telescopio, y darle una utilidad. Tal es el caso del camino óptico destinado al foco Coude. Si tenemos en cuenta que disponemos de un tercer espejo Coude, con todos sus mecanismos automatizados, (actualmente sin uso), una distancia apropiada del plano focal, el espacio y el lugar físico necesario para instalar un periférico, es posible la habilitación de un foco Nasmyth en el telescopio 2,15mts. El hecho de contar con este nuevo foco, redundará en importantes beneficios. En primer lugar, posibilitará la observación, casi simultánea, con dos instrumentos. Otro aspecto a tener en cuenta, es que disminuirá el frecuente cambio del instrumental periférico, motivo este que degrada su ideal puesta a punto. Por último, también de interés, es de destacar su escaso costo de ejecución.

miR-192, miR-194 and miR-215: a convergent microRNA network suppressing tumor progression in renal cell carcinoma.

Science.gov (United States)

Khella, H W Z; Bakhet, M; Allo, G; Jewett, M A S; Girgis, A H; Latif, A; Girgis, H; Von Both, I; Bjarnason, G A; Yousef, G M

2013-10-01

MicroRNAs (miRNAs) play a crucial role in tumor progression and metastasis. We, and others, recently identified a number of miRNAs that are dysregulated in metastatic renal cell carcinoma compared with primary renal cell carcinoma. Here, we investigated three miRNAs that are significantly downregulated in metastatic tumors: miR-192, miR-194 and miR-215. Gain-of-function analyses showed that restoration of their expression decreases cell migration and invasion in renal cell carcinoma cell line models, whereas knockdown of these miRNAs resulted in enhancing cellular migration and invasion abilities. We identified three targets of these miRNAs with potential role in tumor aggressiveness: murine double minute 2, thymidylate synthase, and Smad Interacting protein 1/zinc finger E-box binding homeobox 2. We observed a convergent effect (the same molecule can be targeted by all three miRNAs) and a divergent effect (the same miRNA can control multiple targets) for these miRNAs. We experimentally validated these miRNA-target interactions using three independent approaches. First, we observed that miRNA overexpression significantly reduces the mRNA and protein levels of their targets. In the second, we observed significant reduction of the luciferase signal of a vector containing the 3'UTR of the target upon miRNA overexpression. Finally, we show the presence of inverse correlation between miRNA changes and the expression levels of their targets in patient specimens. We also examined the prognostic significance of miR-215 in renal cell carcinoma. Lower expression of miR-215 is associated with significantly reduced disease-free survival time. These findings were validated on an independent data set from The Cancer Genome Atlas. These results can pave the way to the clinical use of miRNAs as prognostic markers and therapeutic targets.

Autoguía para el telescopio 2,15 mts de CASLEO

Science.gov (United States)

Aballay, J. A.; Casagrande, A. R.; Pereyra, P. F.; Marún, A. H.

Se está desarrollando un sistema de autoguía para el telescopio de 2,15 mts. El mismo se realizará aprovechando el Offset Guider. Al ocular móvil de éste se vinculará alguna cámara digital (ST4-ST7-CH250) para lograr la visión del objeto. El funcionamiento del equipo será el siguiente: primero, dadas las coordenadas del objeto a observar, se tomarán las coordenadas del telescopio para que, a través de una base de datos, se determine un campo de objetos que sirvan para la cámara de visión, luego, la PC obtendrá el offset entre la estrella de observación y la estrella seleccionada como guía, este valor será trasladado a los motores que posicionarán en forma automática el ocular. Una vez que la estrella es visualizada en la cámara (monitor de PC ) se correrá el programa que guiará el telescopio automáticamente.

Cámara CCD Directa con el Telescopio de 2.15 m del CASLEO: algunos diagnósticos

Science.gov (United States)

Cellone, S. A.

Se efectuaron algunas pruebas con la cámara CCD (+ Reductor Focal) instalada en el foco Cassegrain del Telescopio de 2.15 m del Complejo Astronómico El Leoncito (CASLEO). Las conclusiones más significativas son: Los tiempos de exposición efectivos difieren de los nominales en una fracción apreciable de segundo. En exposiciones de menos de 3 segundos, la iluminación no es pareja en todo el detector. En consecuencia, se recomiendan los pasos a seguir por los astrónomos tanto durante la observación como en la reducción de sus datos.

18F-DOPA PET/CT Physiological Distribution and Pitfalls: Experience in 215 Patients.

Science.gov (United States)

Calabria, Ferdinando F; Chiaravalloti, Agostino; Jaffrain-Rea, Marielise L; Zinzi, Maddalena; Sannino, Pasqualina; Minniti, Giuseppe; Rubello, Domenico; Schillaci, Orazio

2016-10-01

F-DOPA PET/CT is potentially helpful in the management of patients with low-grade brain tumors, movement disorders, and somatic neuroendocrine tumors. We describe the whole-body physiological distribution of F-DOPA uptake. We examined 215 patients with F-DOPA PET/CT. Among these, 161 had brain scans and 54 had whole-body scans. Physiological distribution was negligible in the brain, with the exception of basal ganglia, whereas greatest activity was noted in the liver, pancreas, other exocrine glands, and the urinary system. Incidental tracer uptake sites were identified in 5.5% of patients. Some of these findings were due to inflammation, whereas in most cases, uptake was seen in benign tumors of the brain or in the endocrine or exocrine glands. F-DOPA uptake may be seen in inflammatory tissue or benign tumors. Correlations with history, physical examination, laboratory examination, CT, MRI, and histology are necessary for optimal diagnosis.

The Installation Restoration Program Toxicology Guide. Volume 2

Science.gov (United States)

1987-05-01

Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

Clinical analysis of acute anterior uveitis in 215 cases

Directory of Open Access Journals (Sweden)

Xue-Wei Zhou

2013-11-01

Full Text Available AIM: To analyze the etiology, therapeutic effects,risk of relapse and prognosis of acute anterior uveitis.MEHTODS: Medical history of 215 patients with acute anterior uveitis who underwent treatment in Department of Ophthalmology, People's Hospital of Fenghua was collected, together with results of clinical examinations and auxiliary examinations. The data were studied in terms of therapeutic effects, etiological factors, prognosis and relapse rate. RESULTS: In 85 cases(39.5%, the cause was identified, and among the among the most frequent causes were traumatic or surgical injury, viral infection and glaucomatocyclitic crisis. After treatment, the best corrected visual acuity was no less than 1.0 in 153 cases(71.2%, between 0.5 and 1.0 in 55 cases(25.6%, between 0.3 and 0.5 in 4 cases(1.9%, between 0.05 and 0.3 in 2 cases(0.9%, and less than 0.05 in 1 case(0.5%. During the follow-up of more than 6 months, relapse occurred in 4 cases(1.9%during 4-6 months, in 7 cases(3.2%during 7-12 months, in 10 cases(4.7%during 13-24 months, and in 3 cases(1.4%during 25-60 months. CONCLUSION: The etiology of acute anterior uveitis is complicated and mostly idiopathic. Vision prognosis is good after treatment, but therelapse rate is high and can cause visual impairment, so better understanding should be gained of its relapse and its prevention and early treatment should be emphasized.

Self-Biased 215MHz Magnetoelectric NEMS Resonator for Ultra-Sensitive DC Magnetic Field Detection

Science.gov (United States)

Nan, Tianxiang; Hui, Yu; Rinaldi, Matteo; Sun, Nian X.

2013-06-01

High sensitivity magnetoelectric sensors with their electromechanical resonance frequencies electromechanical systems (NEMS) resonator with an electromechanical resonance frequency of 215 MHz based on an AlN/(FeGaB/Al2O3) × 10 magnetoelectric heterostructure for detecting DC magnetic fields. This magnetoelectric NEMS resonator showed a high quality factor of 735, and strong magnetoelectric coupling with a large voltage tunable sensitivity. The admittance of the magnetoelectric NEMS resonator was very sensitive to DC magnetic fields at its electromechanical resonance, which led to a new detection mechanism for ultra-sensitive self-biased RF NEMS magnetoelectric sensor with a low limit of detection of DC magnetic fields of ~300 picoTelsa. The magnetic/piezoelectric heterostructure based RF NEMS magnetoelectric sensor is compact, power efficient and readily integrated with CMOS technology, which represents a new class of ultra-sensitive magnetometers for DC and low frequency AC magnetic fields.

Heating induced structural and chemical behavior of KD2PO4 in the 25 °C–215 °C temperature range

International Nuclear Information System (INIS)

Botez, Cristian E.; Morris, Joshua L.; Encerrado Manriquez, Andres J.; Anchondo, Adan

2013-01-01

We have used powder x-ray diffraction (XRD) to investigate the structural and chemical modifications undergone by KD 2 PO 4 (DKDP) upon heating from room temperature to 215 °C. Full-profile (Le Bail) analysis of our temperature-resolved data shows no evidence of polymorphic structural transitions or deuterium–hydrogen isotope exchange occurring below T s = 185 °C. The lattice parameters of DKDP vary smoothly upon heating to T s and are 0.2% to 0.6% greater than those of its isostructural hydrogenated counterpart KH 2 PO 4 (KDP). In addition, XRD isotherms collected at T s demonstrate the structural and chemical stability of the title compound at this temperature over a 10.5 h time period. Upon further heating, however, the tetragonal DKDP phase becomes unstable, as evidenced by its transition to a monoclinic DKDP modification and eventual chemical decomposition via dehydration. - Highlights: • Structural and chemical behavior of KD 2 PO 4 is investigated upon heating to 215 °C • No polymorphic transitions or deuterium-hydrogen isotope exchange below T s = 185 °C • KD 2 PO 4 is structurally and chemically stable at T s over a 10.5 h time period • KD 2 PO 4 chemically decomposes via dehydration upon heating above T d = 195 °C

Further investigations at the Naigani Lapita site (VL 21/5), Fiji : excavation, radiocarbon dating and palaeofaunal extinction

International Nuclear Information System (INIS)

Irwin, G.; Worthy, T.H.; Best, S.; Hawkins, S.; Carpenter, J.; Matararaba, S.

2011-01-01

This paper brings up-to-date a report by S. Best of initial excavations at Naigani in 1981. The results of subsequent fieldwork in 2000 include the excavation and dating of Lapita-age ovens associated with early settlement and extinct palaeofauna. These include the giant megapode (Megavitiornis altirostris), a species of Ducula pigeon, the giant iguana (Lapitiguana impensa), and probably the endemic crocodile (Volia athollandersoni). The Lapita site of VL 21/5 dates from 900 BC and represents an initial colonising settlement within the Fiji Islands. The period of occupation ended around 750 BC. The significance of Naigani is considered in terms of chronology, ceramic history, economy, extinctions, origins and interactions. (author). 33 refs., 10 figs., 2 tabs.

Automation of metabolic stability studies in microsomes, cytosol and plasma using a 215 Gilson liquid handler.

Science.gov (United States)

Linget, J M; du Vignaud, P

1999-05-01

A 215 Gilson liquid handler was used to automate enzymatic incubations using microsomes, cytosol and plasma. The design of automated protocols are described. They were based on the use of 96 deep well plates and on HPLC-based methods for assaying the substrate. The assessment of those protocols was made with comparison between manual and automated incubations, reliability and reproducibility of automated incubations in microsomes and cytosol. Examples of the use of those programs in metabolic studies in drug research, i.e. metabolic screening in microsomes and plasma were shown. Even rapid processes (with disappearance half lives as low as 1 min) can be analysed. This work demonstrates how stability studies can be automated to save time, render experiments involving human biological media less hazardous and may be improve inter-laboratory reproducibility.

Galaxy at a redshift of 3.215 - further studies of the PKS 1614+051 system

International Nuclear Information System (INIS)

Djorgovski, S.; Strauss, M.A.; Spinrad, H.; Mccarthy, P.; Perley, R.A.; California Univ., Berkeley; National Radio Astronomy Observatory, Charlottesville, VA)

1987-01-01

A narrow-emission-line companion of the quasar PKS 1614+051 was reported earlier as a probable galaxy at a redshift of 3.218, which would have made it by far the most distant galaxy known at the time. New radio and optical imaging, and optical and near-IR spectroscopy of the PKS 1614+051 system is reported here. It is argued that the data support and reinforce the original interpretation of the companion object as a mildly active galaxy, possibly a marginal Seyfert 2. The object has a detectable and marginally resolved optical continuum, but was not detected at radio wavelengths. The ionization state is low, and the emission lines are fairly narrow. The improved redshift for the companion, based on the Ly-alpha line alone, is 3.215 + or - 0.002. New Ly-alpha images show interesting morphology of extended emission-line gas, suggestive of a possible tidal interaction with the neighboring QSO. 24 references

EXOPLANET CHARACTERIZATION BY PROXY: A TRANSITING 2.15 R⊕ PLANET NEAR THE HABITABLE ZONE OF THE LATE K DWARF KEPLER-61

International Nuclear Information System (INIS)

Ballard, Sarah; Charbonneau, David; Fressin, Francois; Torres, Guillermo; Irwin, Jonathan; Newton, Elisabeth; Desert, Jean-Michel; Crepp, Justin R.; Shporer, Avi; Mann, Andrew W.; Ciardi, David R.; Henze, Christopher E.; Bryson, Stephen T.; Howell, Steven B.; Horch, Elliott P.; Everett, Mark E.

2013-01-01

We present the validation and characterization of Kepler-61b: a 2.15 R ⊕ planet orbiting near the inner edge of the habitable zone of a low-mass star. Our characterization of the host star Kepler-61 is based upon a comparison with a set of spectroscopically similar stars with directly measured radii and temperatures. We apply a stellar prior drawn from the weighted mean of these properties, in tandem with the Kepler photometry, to infer a planetary radius for Kepler-61b of 2.15 ± 0.13 R ⊕ and an equilibrium temperature of 273 ± 13 K (given its period of 59.87756 ± 0.00020 days and assuming a planetary albedo of 0.3). The technique of leveraging the physical properties of nearby ''proxy'' stars allows for an independent check on stellar characterization via the traditional measurements with stellar spectra and evolutionary models. In this case, such a check had implications for the putative habitability of Kepler-61b: the planet is 10% warmer and larger than inferred from K-band spectral characterization. From the Kepler photometry, we estimate a stellar rotation period of 36 days, which implies a stellar age of >1 Gyr. We summarize the evidence for the planetary nature of the Kepler-61 transit signal, which we conclude is 30,000 times more likely to be due to a planet than a blend scenario. Finally, we discuss possible compositions for Kepler-61b with a comparison to theoretical models as well as to known exoplanets with similar radii and dynamically measured masses

A simple method for labelling proteins with 211At via diazotized aromatic diamine

International Nuclear Information System (INIS)

Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

1987-01-01

A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

International Nuclear Information System (INIS)

Khazrouni, S.

1985-06-01

Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr

Energy loss of pions and electrons of 1 to 6 GeV/c in drift chambers operated with Xe,CO2(15\\%)

CERN Document Server

Andronic, A; Braun-Munzinger, P; Bucher, D; Busch, O; Catanescu, V; Ciobanu, M; Daues, H W; Emschermann, D; Fateev, O V; Foka, Y; Garabatos, C; Gunji, T; Herrmann, N; Inuzuka, M; Kislov, E; Lindenstruth, V; Ludolphs, W; Mahmoud, T; Petracek, V; Petrovici, M; Rusanov, I R; Sandoval, A; Santo, R; Schicker, R; Simon, R S; Smykov, L P; Soltveit, H K; Stachel, J; Stelzer, H; Tsiledakis, G; Vulpescu, B; Wessels, J P; Windelband, B; Xu, C; Zaudtke, O; Zanevsky, Yu; Yurevich, V

2004-01-01

We present measurements of the energy loss of pions and electrons in drift chambers operated with a Xe,CO2(15%) mixture. The measurements are carried out for particle momenta from 1 to 6 GeV/c using prototype drift chambers for the ALICE TRD. Microscopic calculations are performed using input parameters calculated with GEANT3. These calculations reproduce well the measured average and most probable values for pions, but a higher Fermi plateau is required in order to reproduce our electron data. The widths of the measured distributions are smaller for data compared to the calculations. The electron/pion identification performance using the energy loss is also presented.

Biopsy of human morula-stage embryos: outcome of 215 IVF/ICSI cycles with PGS.

Directory of Open Access Journals (Sweden)

Elena E Zakharova

Full Text Available Preimplantation genetic diagnosis (PGD is commonly performed on biopsies from 6-8-cell-stage embryos or blastocyst trophectoderm obtained on day 3 or 5, respectively. Day 4 human embryos at the morula stage were successfully biopsied. Biopsy was performed on 709 morulae from 215 ICSI cycles with preimplantation genetic screening (PGS, and 3-7 cells were obtained from each embryo. The most common vital aneuploidies (chromosomes X/Y, 21 were screened by fluorescence in situ hybridization (FISH. No aneuploidy was observed in 72.7% of embryos, 91% of those developed to blastocysts. Embryos were transferred on days 5-6. Clinical pregnancy was obtained in 32.8% of cases, and 60 babies were born. Patients who underwent ICSI/PGS treatment were compared with those who underwent standard ICSI treatment by examining the percentage of blastocysts, pregnancy rate, gestational length, birth height and weight. No significant differences in these parameters were observed between the groups. Day 4 biopsy procedure does not adversely affect embryo development in vitro or in vivo. The increased number of cells obtained by biopsy of morulae might facilitate diagnostic screening. There is enough time after biopsy to obtain PGD results for embryo transfer on day 5-6 in the current IVF cycle.

Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

Science.gov (United States)

Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

2011-01-01

Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

EXOPLANET CHARACTERIZATION BY PROXY: A TRANSITING 2.15 R{sub Circled-Plus} PLANET NEAR THE HABITABLE ZONE OF THE LATE K DWARF KEPLER-61

Energy Technology Data Exchange (ETDEWEB)

Ballard, Sarah; Charbonneau, David; Fressin, Francois; Torres, Guillermo; Irwin, Jonathan; Newton, Elisabeth [University of Washington, Seattle, WA 98195 (United States); Desert, Jean-Michel; Crepp, Justin R.; Shporer, Avi [California Institute of Technology, Pasadena, CA 91125 (United States); Mann, Andrew W. [Institute for Astronomy, University of Hawai' i, Honolulu, HI 96822 (United States); Ciardi, David R. [NASA Exoplanet Science Institute/Caltech, Pasadena, CA 91125 (United States); Henze, Christopher E.; Bryson, Stephen T.; Howell, Steven B. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Horch, Elliott P. [Southern Connecticut State University, New Haven, CT 06515 (United States); Everett, Mark E., E-mail: sarahba@uw.edu [National Optical Astronomy Observatory, Tucson, AZ 85719 (United States)

2013-08-20

We present the validation and characterization of Kepler-61b: a 2.15 R{sub Circled-Plus} planet orbiting near the inner edge of the habitable zone of a low-mass star. Our characterization of the host star Kepler-61 is based upon a comparison with a set of spectroscopically similar stars with directly measured radii and temperatures. We apply a stellar prior drawn from the weighted mean of these properties, in tandem with the Kepler photometry, to infer a planetary radius for Kepler-61b of 2.15 {+-} 0.13 R{sub Circled-Plus} and an equilibrium temperature of 273 {+-} 13 K (given its period of 59.87756 {+-} 0.00020 days and assuming a planetary albedo of 0.3). The technique of leveraging the physical properties of nearby ''proxy'' stars allows for an independent check on stellar characterization via the traditional measurements with stellar spectra and evolutionary models. In this case, such a check had implications for the putative habitability of Kepler-61b: the planet is 10% warmer and larger than inferred from K-band spectral characterization. From the Kepler photometry, we estimate a stellar rotation period of 36 days, which implies a stellar age of >1 Gyr. We summarize the evidence for the planetary nature of the Kepler-61 transit signal, which we conclude is 30,000 times more likely to be due to a planet than a blend scenario. Finally, we discuss possible compositions for Kepler-61b with a comparison to theoretical models as well as to known exoplanets with similar radii and dynamically measured masses.

Investigation of 70SiO2-15CaO-10P2O5-5Na2O Glass Composition for Bone Regeneration Applications

Directory of Open Access Journals (Sweden)

Vikas Anand

2014-11-01

Full Text Available Glass with the composition 70SiO2-15CaO -10P2O5-5Na2O has been prepared by using sol gel technique. Bioactive behavior of the glass sample has been checked by in vitro study using TRIS simulated body fluid. Bioactive properties of the sample has been analyzed by using XRD, Raman, FE-SEM, EDX and Brunauer Emmett Teller studies. pH study has been conducted to check the non- acidic nature of the glass sample. Drug delivery behavior of the sample has been estimated by using gentamicin as an antibiotic. Reported sample has been found to be potential candidate for bone regeneration applications.

Application of serum microRNA-9-5p, 21-5p, and 223-3p combined with tumor markers in the diagnosis of non-small-cell lung cancer in Yunnan in southwestern China.

Science.gov (United States)

Yang, Yanlong; Chen, Kai; Zhou, Yongchun; Hu, Zaoxiu; Chen, Shuai; Huang, Yunchao

2018-01-01

Xuanwei City is located in late Permian coal-accumulating areas of the northeastern region of Yunnan Province. In China, morbidity and mortality from lung cancer are highest in Yunnan. Identifying useful circulating markers suitable for the diagnosis of lung cancer in this region is quite meaningful. In this study, we evaluated diagnostic roles of serum miR-9-5p, 21-5p, 223-3p, 135b-5p, 339-5p, and 501-5p in patients with non-small-cell lung cancer (NSCLC) in Yunnan. Moreover, we evaluated the diagnostic performance of several tumor markers, including carcinoembryonic antigen (CEA), cytokeratin 19 fragment 21-1 (CYFRA21-1), and squamous cell carcinoma-related antigen (SCC). Quantitative real-time polymerase chain reaction detected six miRNAs in the serum of 104 NSCLC patients and 50 cancer-free controls. Other markers, including CEA, CYFRA21-1, and SCC, in serum were also measured. The diagnostic ability of miRNAs and tumor markers was evaluated by receiver operating characteristic (ROC) curve analysis. The diagnostic performance of these serum markers was also evaluated in Xuanwei and non-Xuanwei subjects, because the etiological and the epidemiological characteristics of lung cancer in Xuanwei were quite different from those in other regions. Serum miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were upregulated in NSCLC patients, compared with cancer-free controls. No significant difference was found in miR-135b-5p, miR-339-5p, and miR-501-5p expression. The area under ROC curves (AUCs) of miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were 0.706, 0.765, 0.744, 0.749, 0.735, and 0.616, respectively. When combined, miRNAs and tumor markers yielded the highest diagnostic power, with AUC of 0.886, sensitivity of 82.69%, and specificity of 88.00%. In Xuanwei subjects, miR-223-3p and CEA may be suitable biomarkers to distinguish NSCLC from cancer-free states with AUCs of 0.752 and 0.791, respectively. The diagnostic power of the combination of mi

Astatine-211 labelled proteins and their stability in vivo

International Nuclear Information System (INIS)

Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

1989-01-01

211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

Gender specific association of TP53 polymorphisms (EX4 215G>C Arg72Pro, IVS3+40-41ins16, and IVS6+62G>A), with risk of oral cancer subtypes and overall survival of the patients.

Science.gov (United States)

Nagam, Srivani L S S; Katta, Saritha; Prasad, Vidudala V T S

2017-03-01

Reports on the association of TP53 polymorphisms with oral cancer are not only limited but also not specific to site and/or gender. Hence, we examined the effect of TP53 polymorphisms (EX4 215G>C, IVS3+40-41ins16 and IVS6+62G>A) on buccal mucosa cancer (BMC) and tongue cancer (TC) risk, survival of patients in relation to risk and clinical factors, gender wise (excepting for estimating hazards ratio [HR]), using Fisher's Exact Test, Kaplan-Meier analysis, and Cox-proportional hazards models. The exonic polymorphism increased BMC and TC risk in males by 2-4-fold. The IVS3+40-41ins16 was protective against BMC and TC in both genders, whereas IVS6+62G>A protected only males against TC. Genotype combinations and haplotypes which altered the risk of cancers in males and females were different. TC males, aged 40-44 years and females, aged 55-59 years survived better than BMC patients. The IVS3+40-41ins16 polymorphism differentially impacted survival of female patients exposed to tobacco. TC patients with EX4 215GC with lymphovascular spread (LVS) and metastasis exhibited higher HR while, patients with EX4 215CC and perineural invasion (PNI) showed lower HR. Impact of the intronic variants along with clinical parameters on survival and HR estimates varied between BMC and TC. Our bioinformatics analysis revealed the presence of CTCF binding site within TP53 gene. In conclusion, the polymorphisms altered risk and survival of BMC and TC in a gender specific manner, which varied with mode of tobacco and/or alcohol use. The current study, therefore underscores strong need for research, stratified by tumor site and gender. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Properties of 15/2- states in 215Ra and 217Th; evaluation of the 15/2- to 9/2+ E3 strength in N=127 isotones

International Nuclear Information System (INIS)

Dracoulis, G.D.; Riess, R.; Stuchbery, A.E.; Bark, R.A.; Gupta, S.L.; Baxter, A.M.; Kruse, M.

1988-01-01

The lifetime of the yrast 15/2 - state in 215 Ra was measured using pulsed beams and γ-ray and electron techniques. Transition multipolarities were established from measured conversion coefficients. The B(E3) of the 15/2 - → 9/2 + transition is found to be considerably larger than previously reported. A candidate for the corresponding transition in 217 Th was also observed. The E3 strength of the 15/2 - → 9/2 + transition in the N=127 isotones is evaluated in the light of these and other recent results. Interpretation in the framework of particle-octupole vibration coupling requires a systematic lowering of the core 3 - vibration as proton pairs are added to 208 Pb

Shielding properties of 80TeO2-5TiO2-(15-x) WO3-xAnOm glasses using WinXCom and MCNP5 code

Science.gov (United States)

Dong, M. G.; El-Mallawany, R.; Sayyed, M. I.; Tekin, H. O.

2017-12-01

Gamma ray shielding properties of 80TeO2-5TiO2-(15-x) WO3-xAnOm glasses, where AnOm is Nb2O5 = 0.01, 5, Nd2O3 = 3, 5 and Er2O3 = 5 mol% have been achieved. Shielding parameters; mass attenuation coefficients, half value layers, and macroscopic effective removal cross section for fast neutrons have been computed by using WinXCom program and MCNP5 Monte Carlo code. In addition, by using Geometric Progression method (G-P), exposure buildup factor values were also calculated. Variations of shielding parameters are discussed for the effect of REO addition into the glasses and photon energy.

Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

International Nuclear Information System (INIS)

1995-07-01

This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

Retrospective analysis of the clinical behavior of oral hairy leukoplakia in 215 HIV-seropositive patients

Directory of Open Access Journals (Sweden)

Daniela Assis do VALE

Full Text Available Abstract Oral manifestations are common findings in human immunodeficiency virus (HIV infected patients and frequently influence the overall health. Oral hairy leukoplakia (OHL is strongly associated with HIV infection demonstrating its relationship with the individual’s immune status and progression of immunosuppression. This study aims to retrospectively evaluate OHL in HIV patients, analyzing its incidence, demographic aspects and possible changes in clinical and epidemiological profile of the disease over 17 years. The records of 1600 HIV-infected patients were reviewed. The data were correlated and analyzed, considering HIV exposure category, age, gender, harmful habits, CD4 level, use and type of antiretroviral. OHL was observed in 215 (13.4% patients. Most were men in the fourth decade of life, 171 (79.5% and 112 (52,1% respectively, but an increase in the incidence of OHL among female patients and those in the fifth decade of life was observed. Tobacco smoking was the most frequent harmful habit reported by 114 (68% patients. OHL occurred mostly in patients with CD4 counts between 200 and 500 cells/mm3 35 (55.5%. The lower incidence of OHL was found among patients using at least one non-nucleoside reverse transcriptase inhibitor (NNRTI. OHL is related to CD4 count, use of ARVT and tobacco smoking and is also more prevalent in men in the fourth decade of life. These characteristics were recognized in absolute values, but when verifying the behavior over the years we noticed that the incidence of OHL is decreasing and its epidemiological characteristics changing.

Characterization, production, and purification of leucocin H, a two-peptide bacteriocin from Leuconostoc MF215B.

Science.gov (United States)

Blom, H; Katla, T; Holck, A; Sletten, K; Axelsson, L; Holo, H

1999-07-01

Leuconostoc MF215B was found to produce a two-peptide bacteriocin referred to as leucocin H. The two peptides were termed leucocin Halpha and leucocin Hbeta. When acting together, they inhibit, among others, Listeria monocytogenes, Bacillus cereus, and Clostridium perfringens. Production of leucocin H in growth medium takes place at temperatures down to 6 degrees C and at pH below 7. The highest activity of leucocin H in growth medium was demonstrated in the late exponential growth phase. The bacteriocin was purified by precipitation with ammonium sulfate, ion-exchange (SP Sepharose) and reverse phase chromatography. Upon purification, specific activity increased 10(5)-fold, and the final specific activity was 2 x 10(7) BU/OD280. Amino acid composition analyses of leucocin Halpha and leucocin Hbeta indicated that both peptides consisted of around 40 amino acid residues. Their N-termini were blocked for Edman degradation, and the methionin residues of leucocin Hbeta did not respond to Cyanogen Bromide (CNBr) cleavage. Absorbance at 280 nm indicated the presence of tryptophan residues and tryptophan-fracturing opened for partial sequencing by Edman degradation. From leucocin Halpha, the sequence of 20 amino acids was obtained; from leucocin Hbeta the sequence of 28 amino acid residues was obtained. No sequence homology to other known bacteriocins could be demonstrated. It also appeared that the two peptides themselves shared little or no sequence homology. The presence of soy oil did not affect the activity of leucocin H in agar.

Evaluation report on CCTF Core-II reflood Test C2-15 (Run 75)

International Nuclear Information System (INIS)

Okubo, Tsutomu; Iguchi, Tadashi; Akimoto, Hajime; Murao, Yoshio

1992-01-01

This report presents an evaluation on the CCTF Core-II Test C2-15 (Run 75). The purpose of the test is to investigate whether the thermo-hydrodynamic behavior is different between the CCTF and the FLECHT-SET reflooding tests. For this purpose, test conditions of the present test were set as close as possible to those of concerned FLECHT-SET 2714B experiment, taking account of differences in facility design. Investigating results of both the tests, the following conclusions are obtained: (1) Some discrepancies were observed in the measured test conditions between the two tests. Out of them, difference in the Acc injection duration was large and affected test results, such as the water accumulation in the downcomer and the core and the core cooling, during the initial period. However, this effect was found to become small with time. (2) Taking account of this difference and the difference in the broken cold leg pressure loss coefficient between the two facilities, the overall reflooding behavior is judged to be similar in the two facilities. (3) The CCTF test results showed the core heat transfer enhancement in the higher power region due to its steep radial power distribution, whereas the FLECHT-SET did not due to its rather flat radial power distribution. This enhancement was observed significantly at 1.83 m but was smaller at the higher elevation. (4) The heat transfer was nearly identical between the two tests and an existing correlation could well predict the heat transfer coefficients of both the tests at the location where the heat transfer enhancement mentioned above (3) were small, during the time period when the effect of the difference in the Acc injection mentioned above (1) were small. (5) Therefore, the core cooling is expected to be almost the same in the CCTF and the FLECHT-SET under the same core boundary conditions and core radial power distribution. (author)

Angular dependence of the disorder crossover in the vortex lattice of Bi2.15Sr1.85CaCu2O8+δ by muon spin rotation and torque magnetometry

International Nuclear Information System (INIS)

Aegerter, C.M.; Hofer, J.; Savic, I.M.; Keller, H.; Lee, S.L.; Ager, C.; Lloyd, S.H.; Forgan, E.M.

1998-01-01

Using the techniques of muon spin rotation and torque magnetometry, we investigate the crossover field B cr in Bi 2.15 Sr 1.85 Ca 1 Cu 2 O 8+δ at which the vortex lattice becomes disordered along the field direction. It is found that B cr scales as the projection of the applied field along the perpendicular to the superconducting planes. This has the implication that a field large enough to give a disordered lattice when applied perpendicular to the planes, can give a well-ordered vortex-line lattice for angles of the field to the c axis greater than a critical value. copyright 1998 The American Physical Society

Microdosimetry of astatine-211 and comparison with that of iodine-125

International Nuclear Information System (INIS)

Unak, T.

2001-01-01

211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

Science.gov (United States)

Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

2017-05-31

211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

Evaluation of Mir-224, Mir-215 and Mir-143 as Serum Biomarkers for HCV Associated Hepatocellular Carcinoma

Science.gov (United States)

Mamdouh, Samah; Khorshed, Fatma; Aboushousha, Tarek; Hamdy, Hussam; Diab, Ayman; Seleem, Mohamed; Saber, Mohamed

2017-11-26

HCV induced hepatitis and hepatocellular carcinoma as its sequel are major health problems world-wide and especially in Egypt. For diagnosis and during treatment of liver diseases, liver functions are monitored through determination of serum levels of liver enzymes and α-fetoprotein although the obtained information is generally not sufficient for either early detection of hepatic insult or effective follow up of therapeutic effects. More sensitive biomarkers may help to achieve these goals. MiRNAs are small non-coding RNAs that have an important role in gene expression and regulation. Many, such as miR-224, miR-215, miR-143 are correlated with tumor appearance and with the degree of fibrosis in lung, breast and colon cancer. This study was performed to estimate the level of these miRNAs in serum of patients with HCV-associated hepatitis and HCC in relation to grade of hepatitis, stage of fibrosis and differentiation of tumor tissue. In addition, correlations between serological and tissue levels were assessed. A total of 80 patients were examined, out of which 50 were included in the study. Blood samples and tissue specimens from malignant tumor and corresponding non-tumor tissue of HCV hepatitis patients were collected. Blood samples from 20 healthy volunteers were also obtained as controls. It was found that miRNAs profiles differed in HCC patients compared to controls and HCV-associated hepatitis cases. Distinction of tumor grade and fibrosis stage of patients as well as between different grades of tumor differentiation proved possible, making miRNAs promising biomarkers for diagnosis and assessment of treatment response of HCC patients. Creative Commons Attribution License

Sex differences in absolute myocardial perfusion. Non-invasive H2(15)O-PET in young healthy adults.

Science.gov (United States)

Range, Felix T; Kies, Peter; Schäfers, Klaus P; Breithardt, Günter; Schober, Otmar; Wichter, Thomas; Schäfers, Michael A

2016-09-26

To investigate sex differences in myocardial perfusion especially in healthy individuals since former studies are rare and findings are controversial. Participants, methods: 26 subjects were enrolled: 16 healthy women (age: 34 ±7 years) were compared with 10 healthy men (age: 34 ± 3 years; p = ns). Myocardial blood flow (MBF) and coronary vascular resistance (CVR) were quantified at rest, during adenosine infusion and cold-pressor-testing, using positron emission tomography and radioactive-labelled water (H2(15)O-PET). Women showed higher MBF than men at rest (1.10 ± 0.18 vs. 0.85 ± 0.20 ml/min/ml; p = 0.003) and cold-stress (1.39 ± 0.38 vs. 1.06 ± 0.28 ml/min/ml; p = 0.026). Corrected for rate-pressure-product, baseline findings maintained significance (1.41 ± 0.33 vs. 1.16 ± 0.19 ml/min/ml; p = 0.024). CVR was lower in women at baseline (81 ± 14 vs. 107 ± 22 mmHg*ml(-1)*min*ml; p = 0.006) and during cold-pressor-testing (71 ± 17 vs. 91 ± 20 mmHg*ml(-1)*min*ml; p = 0.013). Under adenosine neither maximal MBF (4.06 ± 1.0 vs. 3.91 ± 0.88 ml/min/ml; p = ns) nor coronary flow reserve (3.07 ± 1.12 vs. 3.44 ± 0.92; p = ns) nor CVR (24 ± 8 vs. 24 ± 6 mmHg*ml(-1)*min*ml; p = ns) showed sex-related differences. Women show higher myocardial perfusion and lower coronary vascular resistance than men in physiologic states. Maximum perfusion and vasodilation under adenosine are not sex-specific.

Half-life and mass measurement of the short-lived {sup 215}Po isotope (1.78 ms) at the FRS ion catcher

Energy Technology Data Exchange (ETDEWEB)

Rink, Ann-Kathrin; Bergmann, Julian; Ebert, Jens; Hornung, Christine; Miskun, Ivan; Reiter, Moritz P. [Justus-Liebig Universitaet Giessen (Germany); Ayet San Andres, Samuel; Dickel, Timo; Plass, Wolfgang R.; Scheidenberger, Christoph [Justus-Liebig Universitaet Giessen (Germany); GSI, Darmstadt (Germany); Geissel, Hans; Purushothaman, Sivaji [GSI, Darmstadt (Germany)

2016-07-01

At the Low-Energy Branch (LEB) of the Super-FRS at FAIR, precision experiments with exotic nuclei will be performed using ion traps and lasers. The nuclei will be produced at relativistic energies, slowed down, thermalised in a cryogenic stopping cell (CSC) and made available to various experiments. The thermalisation is a challenging task because of the large energy straggling of the nuclei after production, which requires a stopping cell with large areal densities. Also, the process needs to be performed on a millisecond time scale in order to give access to short-lived nuclides. This method has already been successfully applied at the FRS Ion Catcher at GSI using a prototype CSC. Recently the potential of the method has been demonstrated by the mass and half-life measurement of the {sup 215}Po nuclide with a half-life of 1.78 ms only. The multiple-reflection time-of-flight mass spectrometer at the FRS Ion Catcher has been used to determine the mass to a sub-ppm accuracy and to provide a mass-selected beam for alpha spectroscopy. Furthermore, experiments have been performed with the prototype CSC in order to test novel concepts to be used with the final version of the CSC for the LEB.

Community-based IEC campaign. TFR has dropped to 2.15 in Binh Thanh District, Ho Chi Minh City.

Science.gov (United States)

Nguyen Ngoc Lich

1995-01-01

Binh Thanh District of Ho Chin Minh City in 1989 had a crude birth rate (CBR) of 20.3 per 1000 population and an average of 5.5 persons per household. The rate of total fertility (TFR) in the district was one of the highest among the city's 18 districts in 1990. Concerned about these demographics, the Binh Thanh District Committee for Population and Family Planning reviewed the family planning program with the goal of developing a special information, education, and communication (IEC) campaign. The following incentive scheme for sterilization was developed: each poor entrepreneur in need of seed money for new business ventures who allows himself to be sterilized receives dong 120,000 (US$11) from the National Committee for Population and Family Planning and dong 220,000 from the District Committee for Population and Family Planning to buy medicine and supplementary food. An IEC room was established in each commune health center to disseminate the relevant information. The results of the campaign have been positive, with 910 people requesting sterilization in 1994, 34% of whom were male. Over the period January-April 1995, the proportion of male sterilization increased dramatically, such that men accounted for 68% of the 153 people who underwent sterilization. The district now ranks the lowest among the 18 districts with regard to the percentage of couples with three children, the CBR is 15.3/1000, TFR is 2.15, the contraceptive prevalence rate is 68%, and sterilization is the fourth most popular method of contraception (13%) behind the IUD (37%), condom (30%), and oral pill (18.5%).

Valency and spin states of substituent cations in Bi2.15Sr1.85CaCu2O8+δ

Science.gov (United States)

Benseman, T. M.; Cooper, J. R.; Zentile, C. L.; Lemberger, L.; Balakrishnan, G.

2011-10-01

We studied the valency and spin behavior of M = Mn, Fe, Co, Li, and Al in the high-temperature superconducting compound Bi2.15Sr1.85Ca(Cu1-zMz)2O8+δ (Bi-2212) for small values of z. Mn, Fe, and Co retain their magnetic moments, and our thermopower and magnetic susceptibility data imply ionization states Mn3+, Fe2+, and Co2+, while Li and Al are accommodated in the charge reservoir layers. Single-crystal studies show that the susceptibility of Co2+ ions in Bi-2212 is strongly anisotropic, with a weak anisotropy detected for Mn3+ and none for Fe2+. Fits to a pseudogap formula for a pure Bi-2212 crystal suggest that the spin susceptibility of the host compound is more anisotropic than previously realized. Data in the superconducting state allow us to compare the pair-breaking properties of the different impurities. Several aspects of the data, including the stronger suppression of the superconducting transition temperature Tc by Co compared with Fe for underdoped and optimally doped samples, show that the d-level structure of the magnetic ions and multiorbital effects are important. We also find that the temperatures of the magnetization crossing points are equal to the low-field Tc values to within 1% or 2%. This agrees with a 2D thermodynamic fluctuation argument given by Junod

Forward scattering amplitudes for π+- on Al, Ca, Cu, Sn, Ho, and Pb in the energy range 114-215 MeV

International Nuclear Information System (INIS)

Jeppesen, R.H.

1980-01-01

Measurements have been made of the attenuation cross section, sigma(Ω), for both π + and π- projectiles on Al, 40 Ca, Cu, Sn, Ho, and Pb nuclei. The measurements were made over a range of energies including 114, 140, 165, and 215 MeV. A new method of analyzing transmission experiments data has been used to extract both the real and the imaginary parts of a forward scattering amplitude f/sub N/(0), where f/sub N/(0) is defined to be the limit as Ω → 0 of F(Ω)-f/sub c/(Ω). F(Ω) is the full elastic scattering amplitude and f/sub c/(Ω) is the relativistic point Coulomb amplitude. The values of f/sub N/(0) are compared with forward amplitudes from model calculation. These comparisons demonstrate that much of the observed rotation of the forward scattering amplitude, when plotted in the Argand plane, can be attributed to the Coulomb phase contained in the definition of f/sub N/(0). Results are also compared to those of other experiments. A difference is observed in attenuation measurements between this experiment and a Brookhaven experiment which measured total cross sections on Pb, Sn, and Al. There have been only a few published results in which experimental values of f/sub N/(0) are given. In those cases, general agreement is obsserved with the results of this experiment

76 FR 6536 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T...

Science.gov (United States)

2011-02-07

... the number of flight cycles accumulated by each of the applicable accumulators (i.e., brake, aileron, elevator, and rudder accumulators) having part number (P/N) 08-8423-010 (MS28700- 3) installed on the...

40 CFR 52.720 - Identification of plan.

Science.gov (United States)

2010-07-01

... deletes Rule 204(c)(1)(D) and the reference to it in Rule 204(h) from the IPCB Air Pollution Control... 215); section 215.205 of subpart F (part 215); sections 215.240, 215.241, and 215.249 of subpart H... Pollution Control, Illinois Environmental Protection Agency (IEPA) to Stephen Rothblatt, Chief, Regulation...

The Prevalence of Transmitted Drug Resistance in Newly Diagnosed HIV-Infected Individuals in Croatia: The Role of Transmission Clusters of Men Who Have Sex with Men Carrying the T215S Surveillance Drug Resistance Mutation

Science.gov (United States)

Grgic, Ivana; Lunar, Maja M.; Poljak, Mario; Vince, Adriana; Vrakela, Ivana Baca; Planinic, Ana; Seme, Katja; Begovac, Josip

2013-01-01

Abstract The aim of this study was to determine the prevalence of transmitted drug resistance (TDR) in newly diagnosed and treatment-naive HIV-infected patients from Croatia and evaluate a possible contribution of transmission clusters to the spread of resistant virus. The study enrolled treatment-naive HIV-infected patients that entered clinical care at the Croatian Reference Center for HIV/AIDS between 2006 and 2008. The protease gene and a part of the reverse transcriptase gene of the HIV-1 genome were sequenced by using the Trugene HIV-1 Genotyping System. The prevalence of transmitted drug resistance was analyzed by using the surveillance drug resistance mutations (SDRM) list recommended by the WHO in 2009. We report findings for 118 of 180 eligible patients (65.6% coverage). SDRM were detected in 26 of 118 patients (22.0%) who were infected with subtype B and belonged mostly to the men having sex with men (MSM). The majority of patients with primary resistance carried SDRM associated with resistance to nucleoside analogues reverse transcriptase inhibitors (NRTIs, 23 of 118 patients, 19.5%). The most frequently found NRTI SDRM was T215S (17 of 118 patients, 14.4%). SDRM associated with resistance to nonnucleoside reverse transcriptase inhibitors were detected in three (2.5%) patients and primary resistance to protease inhibitors was not detected. Non-B subtypes were detected in 13/118 patients (11%). A total of 12 transmission pairs and eight distinct transmission clusters were identified with the largest cluster harboring sequences from 19 patients; among them all but two were carrying the T215S mutation. This study showed a high prevalence of TDR in newly diagnosed MSM from Croatia and is an important contribution concerning the relationship between local transmission clusters and the spread of resistant virus. PMID:22906365

Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

International Nuclear Information System (INIS)

Kolachkovski, A.; Khalkin, V.A.

1976-01-01

Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

Postoperative treatment of glioblastoma multiforme with radiation therapy plus concomitant and adjuvant temozolomide : A mono-institutional experience of 215 patients

Directory of Open Access Journals (Sweden)

Pramod Kumar Julka

2013-01-01

Full Text Available Objective: To study the clinical results and prognostic factors of patients with glioblastoma multiforme (GBM treated by postoperative radiation therapy (PORT and concomitant temozolomide followed by adjuvant temozolomide. Methods: From 2005 to 2008, 215 patients (median age 48 years with GBM were treated with PORT plus temozolomide chemotherapy. Radiation therapy (RT was employed with a dose of 60 Gy in 30 fractions over 6 weeks by conventional fractionation with concomitant temozolomide (75 mg/m 2 /day. Adjuvant therapy consisted of 6 cycles of temozolomide (150 mg/m 2 for 5 days, 28 days cycle. The primary end point of the study was overall survival (OS, and the secondary end points were progression free survival (PFS and toxicity. OS was determined with respect to different variables to study the prognostic significance. Results: Median follow up was 11 months (range 2-50 months. Median OS and PFS were 13 months and 11 months respectively. The 1-year and 2-year OS was 44% and 18% respectively. There was no statistical significant impact of age, sex, KP score, anatomical location and extent of surgery. Presentation without seizures (on univariate analysis and 6 cycles of adjuvant temozolomide therapy (on univariate as well as multivariate analysis were found significant prognostic factors. Sixteen patients developed grade III-IV neutropenia/thrombocytopenia during the course of RT. Conclusion: Our results authenticate the role of concomitant and adjuvant temozolomide chemotherapy in combination with PORT for the management of GBM patients. We strongly recommend complete 6 cycle of adjuvant temozolomide since it significantly improved the survival in our study.

Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

International Nuclear Information System (INIS)

Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

1982-01-01

The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

International Nuclear Information System (INIS)

Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

2011-01-01

Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

Resultados del tratamiento de 215 tumores pancreáticos y periampulares en el Hospital "Hermanos Ameijeiras"

Directory of Open Access Journals (Sweden)

José Luis González González

Full Text Available Introducción. el cáncer pancreático es una de las neoplasias más letales, ocupa el quinto lugar en frecuencia en occidente y tiene una supervivencia asociada inferior al 20 % al año y al 3 % a los 5 años. La única posibilidad de curación la brindan intervenciones quirúrgicas de gran envergadura que conllevan una alta tasa de morbilidad y mortalidad. Objetivo: caracterizar a los pacientes según variables demográficas, enfermedades asociadas y manifestaciones clínicas, e identificar estudios de mayor valor para el diagnóstico y la relación entre las variables perioperatorias y la aparición de complicaciones, mortalidad hospitalaria y evolucion posoperatoria. Métodos. se realizó un estudio observacional, longitudinal y prospectivo con pacientes con tumores pancreáticos y periampulares que fueron tratados en el Servicio de Cirugía General del Hospital Clínico Quirúrgico "Hermanos Ameijeiras" entre enero de 2006 y diciembre de 2011. Resultados. hubo un total de 215 pacientes con tumores de páncreas: 178 lesiones periampulares y 37 lesiones del cuerpo y la cola de páncreas. Se resecaron 24 lesiones pancreáticas distales y fueron intervenidos quirúrgicamente 153 pacientes con lesiones periampulares, de las cuales se resecaron 83. Se realizaron 78 pancreatoduodenectomías cefálicas y la localización más frecuente fue la ampolla de Vater (36 pacientes, 50,7 %, seguida de la cabeza del páncreas (26 pacientes, 36,6 %. Hubo complicaciones en el 66,2 % de los pacientes. La mortalidad perioperatoria fue del 4,2 % y la hospitalaria del 23,9 %. Conclusiones. los tumores periampulares fueron más frecuentes entre los 50 y 69 años. La enfermedad asociada más frecuente fue la hipertensión arterial, y la ictericia, el síntoma fundamental. La colangiopancreatografía retrógrada endoscópica fue el examen de mayor sensibilidad. La mortalidad hospitalaria estuvo relacionada con las enfermedades asociadas, el tiempo quirúrgico, la

SPECTRUM OF CERVICAL LESIONS IN CIMS, BILASPUR: A 5 YEAR RETROSPECTIVE STUDY OF 215 CASES IN A TERTIARY HOSPITAL OF CENTRAL INDIA

Directory of Open Access Journals (Sweden)

Sadhna

2015-10-01

Full Text Available BACKGROUND AND OBJEC TIVE: Cancer of the cervix is a leading cause of morbidity and mortality among women W orld W ide. Therefore to curb the disease there is need of awareness of this disease. This study is aimed to categorize the premalignant and malignant lesions at the earliest, to reduce the mortality and morbidity. It also aimed to know the incidence of malignancies at our set up and to calculate distribution of patient in relation to parity and symptoms. DESIGN AND SETTING: Study included 215 patients with complain of white dis charge per vagina, per vaginal bleeding and backache attending the gynecology OPD over a period of 05 years. PATIENT AND METHODS: Patients were subjected to cervical biopsy and biopsies were sent to pathology department. Detailed clinical history, age, age at marriage, parity and socio - economic status was obtained. RESULT: Result were classified histopathological l y as inflammatory lesions 70 cases, polypoidal lesion were 30, LSIL accounted for 32 cases and HSIL were 20 cases and 30 were malignant lesions. U nder malignant category moderately differentiated squamous cell carcinoma was the commonest. Maximum numbers of patients were subjected to cervical biopsies in 3 rd decade of life. Malignancies were common in 3 rd & 4 th decade of life. Most of the cases were of parity 4. CONCLUSION : Tissue biopsy is a valuable diagnostic procedure on which surgeons and radiologists still rely.

CFTR depletion results in changes in fatty acid composition and promotes lipogenesis in intestinal Caco 2/15 cells.

Directory of Open Access Journals (Sweden)

Geneviève Mailhot

2010-05-01

Full Text Available Abnormal fatty acid composition (FA in plasma and tissue lipids frequently occurs in homozygous and even in heterozygous carriers of cystic fibrosis transmembrane conductance regulator (CFTR mutations. The mechanism(s underlying these abnormalities remained, however, poorly understood despite the potentially CFTR contributing role.The aim of the present study was to investigate the impact of CFTR depletion on FA uptake, composition and metabolism using the intestinal Caco-2/15 cell line. shRNA-mediated cftr gene silencing induced qualitative and quantitative modifications in FA composition in differentiated enterocytes as determined by gas-liquid chromatography. With the cftr gene disruption, there was a 1,5 fold increase in the total FA amount, largely attributable to monounsaturated and saturated FA compared to controls. The activity of delta-7 desaturase, estimated by the 16:1(n-7/16:0, was significantly higher in knockdown cells and consistent with the striking elevation of the n-7 FA family. When incubated with [14C]-oleic acid, CFTR-depleted cells were capable of quick incorporation and export to the medium concomitantly with the high protein expression of L-FABP known to promote intracellular FA trafficking. Accordingly, lipoprotein vehicles (CM, VLDL, LDL and HDL, isolated from CFTR knockdown cells, exhibited higher levels of radiolabeled FA. Moreover, in the presence of [14C]-acetate, knockdown cells exhibited enhanced secretion of newly synthesized phospholipids, triglycerides, cholesteryl esters and free FA, thereby suggesting a stimulation of the lipogenic pathway. Conformably, gene expression of SREBP-1c, a key lipogenic transcription factor, was increased while protein expression of the phosphorylated and inactive form of acetylCoA carboxylase was reduced, confirming lipogenesis induction. Finally, CFTR-depleted cells exhibited lower gene expression of transcription factors (PPARalpha, LXRalpha, LXRbeta and RXRalpha

Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

DEFF Research Database (Denmark)

Back, T.; Haraldsson, B.; Hultborn, R

2009-01-01

of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

Boiling points of the superheavy elements 117 and 118

International Nuclear Information System (INIS)

Takahashi, N.

2001-01-01

It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

DEFF Research Database (Denmark)

Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

2014-01-01

Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

THE EXPRESSION OF Hsa-miR-21-5p AS MINIMAL INVASIVE MARKER TO ADJUVANT CHEMOTHERAPY IN BREAST CANCER PATIENTS

Directory of Open Access Journals (Sweden)

Dewi Safitri Tanjung

2017-02-01

Full Text Available Abstract Breast cancer remains the leading cause of death among women, and there is a need to develop minimally invasive marker. In our previous study based on clinicopathologic in pre-chemotherapy patients showed miR-21 was upregulated 1.32 times higher at advanced stage compared with early stage. Therefore the matched patients for post-chemotherapy samples were used. The aim of this research is to examine the expression of miR-21 as potential marker to adjuvant chemotherapy in breast cancer patients. The samples were taken by using cross sectional method with total 39 blood plasma samples from breast cancer patients in adjuvant chemotherapy and 12 healthy control samples. Plasma was obtained from blood samples and then RNA isolated were performed. Total RNA was reverse transcribed using cDNA synthesis. The expression of miR-21 was then analyzed using specific primer for miR-21 and miR-16 as the reference gene. Livak Method was used to calculate the expression level in each group. The result showed that there is significant downregulated expression of miR-21 in postchemotherapy 2.61 fold compared with pre-chemotherapy (p<0.05. The expression of miR-21 upregulated 2.2 folds (p<0.05 in pre-chemotherapy compared with healthy control, while in post-chemotherapy compared with healthy control, the expression of miR-21 was 0.8 fold (p<0.05. In conclusion, Hsa-miR-21-5p can be used as marker for adjuvant chemotherapy response in breast cancer because there is significant different expression between prechemotherapy, post-chemotherapy and healthy control. The continuation research in the near future for detecting the expression of tumor suppressor protein regulated by miR-21 is needed. Keywords: breast cancer, adjuvant chemotherapy, miR-21, minimal invasive marker

Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

Energy Technology Data Exchange (ETDEWEB)

Wilbur, Daniel Scott

2012-12-12

Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

International Nuclear Information System (INIS)

Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

2008-01-01

We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

International Nuclear Information System (INIS)

Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

1998-01-01

We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

29 CFR 1910.901-1910.999 - [Reserved

Science.gov (United States)

2010-07-01

...) Guard Exposure Angles .215(b)(2) Band Type .215(b)(11) Bench and Floor Stands .215(b)(3) Cup Wheels .215... Systems .104(b)(2)(ii) Cranes .179(c)(2) Exposure and medical records .1020 Industrial Plants .106(e)(9...) Medical surveillance .1003(g) Examinations .1003(g)(1) Records .1003(g)(2) Regulated area requirements...

New developments of the in-source spectroscopy method at RILIS/ISOLDE

CERN Document Server

Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

2013-01-01

At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

Studies of Stable Octupole Deformations in the Radium Region

CERN Multimedia

2002-01-01

The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

International Nuclear Information System (INIS)

Hofer, K.G.

1980-06-01

Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application

Effect of Sol-Gel Ageing Time on Three Dimensionally Ordered Macroporous Structure of 80SiO2-15CaO-5P2O5 Bioactive Glasses

Directory of Open Access Journals (Sweden)

Thanida CHAROENSUK

2014-04-01

Full Text Available Three dimensionally ordered macroporous bioactive glasses (3DOM-BGs, namely 80SiO2-15CaO-5P2O5, were synthesized by sol-gel method. PMMA colloidal crystals and non-ionic block copolymers P123 were used as cotemplates. The amorphous 3DOM-BGs had skeletal walls enclosing macropores. Such structure resulted from octahedral and tetrahedral holes of the face-centered cubic (fcc closest packed PMMA templates and windows interconnecting through macropores network. The thicknesses of the walls were around 50 nm – 80 nm and the windows were 90 nm – 110 nm in diameter. These wall thickness is increased by with an increase in ageing time up to 24 h and  then gradually reduced with further increase in aging time. Vibration bands of Si–O–Si and P–O were evident in infrared spectra which are in agreement with EDS spectra indicating Si, P and Ca compositions. After in vitro bioactivity testing by soaking 3DOM-BGs in simulated body fluid at 37 °C, the crystallization of amorphous calcium phosphate layers compatible to the bone component of hydroxyl carbonate apatite were rapidly formed within 3 h. These results indicated that these 3DOM-BGs resembled ideal bone implant materials.DOI: http://dx.doi.org/10.5755/j01.ms.20.1.4755

Production of Astatine-211 at the Duke University Medical Center for its regional distribution

Energy Technology Data Exchange (ETDEWEB)

Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

2016-01-01

Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as ²¹¹At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of ²¹¹At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve ²¹¹At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used ²¹¹At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a ²¹¹At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

Table:2

Indian Academy of Sciences (India)

CHC+ 0.042261 -115.619792 -115.577531 -115.291056 -115.482384. c-C3H3+ 0.045333 -115.733846 -115.688513 -115.396826 -115.589954. H2CCCH+ +HF 0.052087 -216.111454 -215.059367 -215.631844 -215.944155. c-C3H3+ +HF ...

Elisante 215-222.pmd

African Journals Online (AJOL)

Prof. Adipala Ekwamu

methods of extracting inulin from sisal bole in a readily utilisable form. Inulin was ... sèche comme un potential du feedstock pour la production de l'éthanol. ..... Conversion and Management 42 (11):1357-. 1378. ... Handbook of Cane Sugar.

Bulletin of Materials Science | News

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science; Volume 32; Issue 3. Issue front cover thumbnail. Volume 32, Issue 3. June 2009, pages 215-367. pp 215-215. Foreword · S B Krupanidhi H L Bhat · More Details Fulltext PDF. pp 217-225. Molecule-based magnets · J V Yakhmi · More Details Abstract Fulltext PDF.

Nuclear and chemical data for life sciences

International Nuclear Information System (INIS)

Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand

2013-01-01

Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

CERN Document Server

De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer

International Nuclear Information System (INIS)

Wilbur, D. Scott

2011-01-01

This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.

76 FR 34014 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and...

Science.gov (United States)

2011-06-10

... either universal solid (round head) rivets or flush rivets of the bracket assembly of the emergency water... their substance. But we might have found it necessary to use different words from those in the MCAI to..., whichever occurs first, do a general visual inspection to determine if either universal solid (round head...

Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

Energy Technology Data Exchange (ETDEWEB)

Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

2016-08-15

Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

International Nuclear Information System (INIS)

Meyer, G.J.; Roessler, K.; Stoecklin, G.

1979-01-01

Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

International Nuclear Information System (INIS)

Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

2015-01-01

Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

Science.gov (United States)

Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

2015-11-01

Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

Energy Technology Data Exchange (ETDEWEB)

Hohloch, Karin; Lankeit, H.K.; Truemper, L. [Georg August University, Hematology and Oncology, Goettingen (Germany); Zinzani, P.L. [University of Bologna, Institute of Hematology and Medical Oncology ' ' L. e A. Seragnoli' ' , Bologna (Italy); Scholz, C.W. [Charite, University Berlin, Hematology, Oncology and Tumor Immunology, Berlin (Germany); Lorsbach, M.; Windemuth-Kieselbach, C. [Alcedis GmbH, Giessen (Germany)

2014-08-15

Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

Regional gastrointestinal transit and pH studied in 215 healthy volunteers using the wireless motility capsule: influence of age, gender, study country and testing protocol.

Science.gov (United States)

Wang, Y T; Mohammed, S D; Farmer, A D; Wang, D; Zarate, N; Hobson, A R; Hellström, P M; Semler, J R; Kuo, B; Rao, S S; Hasler, W L; Camilleri, M; Scott, S M

2015-09-01

The wireless motility capsule (WMC) offers the ability to investigate luminal gastrointestinal (GI) physiology in a minimally invasive manner. To investigate the effect of testing protocol, gender, age and study country on regional GI transit times and associated pH values using the WMC. Regional GI transit times and pH values were determined in 215 healthy volunteers from USA and Sweden studied using the WMC over a 6.5-year period. The effects of test protocol, gender, age and study country were examined. For GI transit times, testing protocol was associated with differences in gastric emptying time (GET; shorter with protocol 2 (motility capsule ingested immediately after meal) vs. protocol 1 (motility capsule immediately before): median difference: 52 min, P = 0.0063) and colonic transit time (CTT; longer with protocol 2: median 140 min, P = 0.0189), but had no overall effect on whole gut transit time. Females had longer GET (by median 17 min, P = 0.0307), and also longer CTT by (104 min, P = 0.0285) and whole gut transit time by (263 min, P = 0.0077). Increasing age was associated with shorter small bowel transit time (P = 0.002), and study country also influenced small bowel and CTTs. Whole gut and CTTs showed clustering of data at values separated by 24 h, suggesting that describing these measures as continuous variables is invalid. Testing protocol, gender and study country also significantly influenced pH values. Regional GI transit times and pH values, delineated using the wireless motility capsule (WMC), vary based on testing protocol, gender, age and country. Standardisation of testing is crucial for cross-referencing in clinical practice and future research. © 2015 John Wiley & Sons Ltd.

A polymorphism (rs1042522) in TP53 gene is a risk factor for Down Syndrome in Sicilian mothers.

Science.gov (United States)

Salemi, Michele; Barone, Concetta; Salluzzo, Maria Grazia; Giambirtone, Mariaconcetta; Scillato, Francesco; Galati Rando, Rosanna; Romano, Carmelo; Morale, Maria Concetta; Ridolfo, Federico; Romano, Corrado

2017-11-01

Trisomy 21 is the most frequent genetic cause of intellectual disability. Tumor Protein 53 (TP53) gene down-regulation triggers chromosomal instability. A TP53 gene polymorphism c.215G > C (rs1042522) is associated with accumulation of aneuploid cells. We analyzed the TP53 c.215G > C (rs1042522) polymorphism in Sicilian mothers of subjects with Down Syndrome (DS) within a case-control study. Nucleotide polymorphism was detected by pyrosequencing technology. The distribution of TP53 c.215G > C polymorphism showed significant difference between mothers of subjects with DS and controls. Our data show that TP53 c.215G > C polymorphism is a risk factor for DS in Sicilian mothers.

Pollen stratigraphy, vegetation and climate history of the last 215 ka in the Azzano Decimo core (plain of Friuli, north-eastern Italy)

Science.gov (United States)

Pini, R.; Ravazzi, C.; Donegana, M.

2009-06-01

The pollen record of the long succession of marine and continental deposits filling the subsident north-Adriatic foredeep basin (NE Italy) documents the history of vegetation, the landscape evolution and the climate forcing during the last 215 ka at the south-eastern Alpine foreland. The chronology relies on several 14C determinations as well as on estimated ages of pollen-stratigraphical and sea-level event tie-points derived from comparison with high-resolution marine records, speleothemes and ice cores. Mixed temperate rainforests persisted throughout MIS 7a-7c, being replaced by conifer forests after the local glacioeustatic regression during early MIS 6. The Alpine piedmont facing the Adriatic foredeeep was glaciated at the culmination of the penultimate glaciation, as directly testified by in situ fluvioglacial aggradation related to the building of a large morainic amphitheatre. The pollen record allows correlation with other European records and with the IRD from N-Atlantic and off Iberia, thus the duration of the penultimate glacial culmination at the southalpine fringe is estimated less than 13 ka between 148 ± 1 and >135 ka. The site was not reached by the Last Interglacial maximum sea transgression and enregistered a typical, though incomplete, Eemian forest record, lacking Mediterranean evergreen trees. A complex sequence of stadial-interstadial episodes is reconstructed during the Early and Middle Würm: major xerophyte peaks match IRD maxima occurred during Heinrich events in deep-sea cores offshore Iberia and in the N-Atlantic and allows to frame lumps of interstadial phases, marked by Picea peaks, each one including several DO warm events. Broad-leaved thermophilous forests disappeared from the north-eastern plain of Italy at the end of the Early Würm, whereas reduced populations of Abies and Fagus probably sheltered even during the Last Glacial Maximum. A renewed fluvioglacial in situ deposition between 30.4 ± 0.4 and 21.6 ± 0.5 ka cal BP sets

32 CFR 215.5 - Policies.

Science.gov (United States)

2010-07-01

... resources for assistance to civil authorities in controlling civil disturbances will normally be predicated... from States for such aid will be made to the President, who will determine what Federal action will be...

25 CFR 215.0 - Definitions.

Science.gov (United States)

2010-04-01

... AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW... corporation, their legal representatives, heirs, or assigns, to whom a lead and zinc mining lease has been... mean any leased restricted or trust lands within and under jurisdiction of the Quapaw Indian Agency...

2 CFR 215.2 - Definitions.

Science.gov (United States)

2010-01-01

... indirect expense charged, the value of third party in-kind contributions applied and the amount of cash... of cash disbursements for direct charges for goods and services, the amount of indirect expense... completion. (kk) Third party in-kind contributions means the value of non-cash contributions provided by non...

2 CFR 215.34 - Equipment.

Science.gov (United States)

2010-01-01

... REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT... quantities determined by the physical inspection and those shown in the accounting records shall be... other Federal agencies. The Federal awarding agency shall issue instructions to the recipient no later...

49 CFR 215.5 - Definitions.

Science.gov (United States)

2010-10-01

...) Refrigerator car; (3) Ventilator car; (4) Stock car; (5) Gondola car; (6) Hopper car; (7) Flat car; (8) Special...: (1) The cars are operated— (i) Primarily on track that is inside an industrial or other non-railroad...

7 CFR 215.2 - Definitions.

Science.gov (United States)

2010-01-01

... Circulars A-87, C(4) and A-122, Attachment A, A(5), respectively. For availability of OMB circulars... for, public or private nonprofit elementary schools or secondary schools in a city, county, township...

Korean Affairs Report No. 215.

Science.gov (United States)

1982-05-25

21 Aug 81 p 2] 89 ROMANIAN FILM SHOW—The following attended the opening of a Romanian film week on 20 August at the Nagwon Cinema , in honor of the...decoration of the Pyongyang City Sosong District General Restaurant with the title of Guard Commerce. Premier Li and his party confer with the Malaysian ...National Power transmission workers’ meeting closes a two-day meeting held in Moranbong Theater. The (north) Korean and Malaysian governments sign

20 CFR 627.215 - Relocation.

Science.gov (United States)

2010-04-01

... the original location. (b) For 120 days after the commencement or the expansion of commercial... original location. (c) For the purposes of this section, relocating establishment means a business entity... review should include names under which the establishment does business, including successors-in-interest...

10 CFR 21.5 - Communications.

Science.gov (United States)

2010-01-01

... this part must be addressed to the NRC's Document Control Desk, and sent by mail to the U.S. Nuclear... Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the NRC to...

31 CFR 215.2 - Definitions.

Science.gov (United States)

2010-07-01

... form of tax for which, under a city ordinance: (1) Collection is provided by imposing on employers... designated city officer, department, or instrumentality; and (2) The duty to withhold generally is imposed on... any form of tax for which, under a county ordinance: (1) Collection is provided by imposing on...

36 CFR 2.15 - Pets.

Science.gov (United States)

2010-07-01

... dogs accompanying visually impaired persons or hearing ear dogs accompanying hearing-impaired persons... superintendent. (b) In park areas where hunting is allowed, dogs may be used in support of these activities in... authorized person in the act of killing, injuring or molesting humans, livestock, or wildlife may be...

Incorporating AFEWC IMOM as an Instructional Asset for NPS Radar and Electronic Warfare Curricula

Science.gov (United States)

1992-09-01

Backlobe EL. dB down - 20 dB Backlobe AZ. dB down = 20 dB Ru - 400 km 215.983 nmi Scope Range = 200 km 107.991 nmi PRF = 375 Hz Pay = 600 W RCS = 10 sq m...10 dB Backlobe EL. dB down = 20 dB Backlobe AZ. dB down = 20 dB Ru = 400 km 215.983 nmi Scope Range = 400 km 215.983 nmi PRF = 375 Hz Pay = 93.75 W

211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

OpenAIRE

Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

2016-01-01

International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

International Nuclear Information System (INIS)

Wilbur, Daniel Scott

2016-01-01

This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

International Nuclear Information System (INIS)

Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

1997-01-01

Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability

International Nuclear Information System (INIS)

Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.

1993-01-01

Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)

Outcome at 10 years after treatment for adolescent idiopathic scoliosis

DEFF Research Database (Denmark)

Andersen, Mikkel O; Christensen, Steen Bach; Thomsen, Karsten

2006-01-01

A total of 215 consecutive patients treated either by bracing or operation received a questionnaire after 9.7 years.......A total of 215 consecutive patients treated either by bracing or operation received a questionnaire after 9.7 years....

76 FR 34289 - Proposed Agency Information Collection Activities; Comment Request

Science.gov (United States)

2011-06-13

... September 30, 2013. (11.) OMB No. 2130-0519, Bad Order and Home Shop Card (49 CFR part 215). The new... Reporting Mark on Freight Cars (49 CFR part 215). The new expiration date for this information collection is... 34290

76 FR 13297 - Defense Federal Acquisition Regulation Supplement; Technical Amendments

Science.gov (United States)

2011-03-11

... 215 Government procurement. Ynette R. Shelkin, Editor, Defense Acquisition Regulations System... Director, Defense Procurement and Acquisition Policy. DATES: Effective Date: March 11, 2011. Applicability... adding a section at 215.300 with a reference to Director, Defense Procurement and Acquisition Policy...

Proceedings – Mathematical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Proceedings – Mathematical Sciences; Volume 114; Issue 2. A Variational Proof for the Existence of a Conformal Metric with Preassigned Negative Gaussian Curvature for Compact Riemann Surfaces of Genus >1. Rukmini Dey. Erratum Volume 114 Issue 2 May 2004 pp 215-215 ...

77 FR 24189 - Commission Information Collection Activities (FERC-725); Comment Request; Extension

Science.gov (United States)

2012-04-23

... of Section 215 of the Federal Power Act (FPA).\\2\\ \\1\\ ``Electric Reliability Organization'' or ``ERO... Reliability Standards for the Bulk-Power System, subject to Commission review. \\2\\ Section 215 was added by... information collection, FERC-725, Certification of Electric Reliability Organization; Procedures for Electric...

Integration of Systems with Varying Levels of Autonomy (Integration de Systemes a Niveau d’Autonomie Variable)

Science.gov (United States)

2008-09-01

2.2.2.1 Theseus AUV 2-15 2.2.3 Air and Space 2-18 2.2.3.1 F-22A Flying Qualities Development 2-18 2.2.3.2 Apollo and Space Shuttle 2-19 2.2.3.3...Figure 2.14 The Multi-Mission Spartan Vehicle and the Remote Minehunting Vehicle Dorado 2-15 Figure 2.15 Theseus Schematic 2-16 Figure 2.16 The...Disciplines 6-3 RTO-TR-SCI-144 ix List of Tables Table Page Table 2.1 Thrust and Pitch Attitude Before the Accident 2-6 Table 2.2 Theseus

Viral phenotype, antiretroviral resistance and clinical evolution in human immunodeficiency virus-infected children.

Science.gov (United States)

Mellado, M J; Cilleruelo, M J; Ortiz, M; Villota, J; García, M; Perez-Jurado, M L; Barreiro, G; Martín-Fontelos, P; Bernal, A

1997-11-01

The syncytium-inducing (SI) viral phenotype and the emergence of viral strains resistant to zidovudine have been described in persons infected with HIV, and in some cases they have been associated with poor prognosis. HIV isolates obtained from 37 HIV-infected children were analyzed to determine whether the SI viral phenotype and the mutation on the 215 position of the reverse transcriptase (M215) could be used as markers of disease progression. We performed peripheral blood coculture mononuclear cells, and we analyzed the induction of syncytia using the MT-2 cell line. The emergence of mutations on the 215 position was determined by PCR. We found a statistically significant association (P < 0.05) between SI viral phenotype and (1) recurrent serious bacterial infections, (2) absolute CD4+ cell counts <2 SD, (3) progression to AIDS and (4) death. Sixty percent of the children treated with zidovudine developed 215 mutant viral strains without statistically significant association with clinical or immunologic findings. The SI viral phenotype was statistically associated with the presence of the 215 mutation (P < 0.05). SI viral phenotype is a marker associated with a poor clinical and immunologic progression of the disease and it may facilitate the emergence of mutant strains in children treated with zidovudine.

48 CFR 570.601 - FAR provisions and clauses.

Science.gov (United States)

2010-10-01

... Business Participation Program—Targets.52.219-25Small Disadvantaged Business Participation Program...-24Preaward On-Site Equal Opportunity Compliance Review. (i) you require cost or pricing data for work or services exceeding $500,000 52.215-10Price Reduction for Defective Cost or Pricing Data.52.215...

Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

Energy Technology Data Exchange (ETDEWEB)

Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

2016-07-19

This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate ²¹¹At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar ²¹¹At capture (>95%) from 8M HCl solutions and release with conc. NH₄OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of ²¹¹At when loading [²¹¹At]astatate appeared to be similar to that of [²¹¹At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of ²¹¹At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO₃, but higher capture rates (e.g. 99%) can be obtained when 10M HNO₃ is mixed with an equal quantity of 8M HCl; Addition of reductants to the ²¹¹At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated ²¹¹At isolation studies have been conducted with full-scale target dissolution and ²¹¹At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO₃ was used (rather than HCl) for loading the ²¹¹At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for ²¹¹At separation from bismuth, which allow use of HNO₃/HCl mixtures for loading and NaOH for eluting ²¹¹At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

75 FR 44276 - Bureau of Ocean Energy Management, Regulation, and Enforcement (BOEMRE); Cancellation of Oil and...

Science.gov (United States)

2010-07-28

... (OCS) in the Gulf of Mexico (GOM) AGENCY: Bureau of Ocean Energy Management, Regulation, and Enforcement, Interior. ACTION: Cancellation of WPA Gulf of Mexico Lease Sale 215. SUMMARY: On May 27, 2010, the President announced the Secretary of the Interior's decision to cancel WPA Sale 215 that was...

49 CFR 215.7 - Prohibited acts.

Science.gov (United States)

2010-10-01

... persons, or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations, and, where a grossly...

40 CFR 2.215 - Confidentiality agreements.

Science.gov (United States)

2010-07-01

... power to compel submission of the information directly from the affected business, or (ii) While EPA has statutory power to compel submission of the information directly from the affected business, compelling... another source; (5) The manner in which EPA will treat the information; and (6) That EPA will treat the...

Publications | Page 215 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

The research study looked at the uses of new media among women''s organizations and activists for community building and campaigns for social justice. Whereas ... Managing climate risk for agriculture and water resources development in South Africa : quantifying the costs, benefits and risks associated with planning and ...

22 CFR 215.14 - Specific exemptions.

Science.gov (United States)

2010-04-01

..., or qualifications for Federal civilian employment, military service, Federal contracts, or access to... functioning and integrity of law enforcement activities, to prevent disclosure of investigative techniques, to... integrity of law enforcement activities, to prevent disclosure of investigative techniques, to maintain the...

Publications | Page 215 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

29 CFR 825.215 - Equivalent position.

Science.gov (United States)

2010-07-01

... family or dependent coverages). For example, if an employee was covered by a life insurance policy before... AND MEDICAL LEAVE ACT OF 1993 Employee Leave Entitlements Under the Family and Medical Leave Act § 825... group life insurance, health insurance, disability insurance, sick leave, annual leave, educational...

48 CFR 233.215 - Contract clause.

Science.gov (United States)

2010-10-01

... acquisition is for— (i) Aircraft (ii) Spacecraft and launch vehicles (iii) Naval vessels (iv) Missile systems (v) Tracked combat vehicles (vi) Related electronic systems; (2) The contracting officer determines...

17 CFR 230.215 - Accredited investor.

Science.gov (United States)

2010-04-01

... following persons: (a) Any savings and loan association or other institution specified in section 3(a)(5)(A... Code, corporation, Massachusetts or similar business trust, or partnership, not formed for the specific... years and has a reasonable expectation of reaching the same income level in the current year; (g) Any...

7 CFR 1160.215 - Assessment exemption.

Science.gov (United States)

2010-01-01

... described in § 1160.211(a) who operates under an approved National Organic Program (NOP) (7 CFR part 205) system plan; processes only products that are eligible to be labeled as 100 percent organic under the NOP... the organic farm or organic handling operation certificate provided by a USDA-accredited certifying...

2 CFR 215.31 - Insurance coverage.

Science.gov (United States)

2010-01-01

... Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for real property and equipment acquired with Federal funds as provided to property owned by the recipient. Federally-owned property need not be insured unless required by the terms and conditions of the award. ...

Publications | Page 215 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Through books, articles, research publications, and studies, we aim to widen the impact of our ... Journal articles ... Education in the United Kingdom expressed a vision for a higher education where access and connection were championed.

18 CFR 281.215 - Additional relief.

Science.gov (United States)

2010-04-01

... request (for any reason including the provisions of § 281.210) classification under § 281.206 on behalf of its high priority uses or reclassification on behalf of its essential agricultural users, the person... request shall contain the information required in § 2.78(b) of the Commission Regulations. [44 FR 26862...

2 CFR 215.36 - Intangible property.

Science.gov (United States)

2010-01-01

... Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... recipient shall provide, within a reasonable time, the research data so that they can be made available to... journal; or (B) A Federal agency publicly and officially cites the research findings in support of an...

49 CFR 215.103 - Defective wheel.

Science.gov (United States)

2010-10-01

... of the rim; or, (i) A wheel on the car has been welded unless the car is being moved for repair in... on the car shows evidence of being loose such as oil seepage on the back hub or back plate; (h) A...

24 CFR 91.215 - Strategic plan.

Science.gov (United States)

2010-04-01

... public housing residents to become more involved in management and participate in homeownership. If the... describe the manner in which it will provide financial or other assistance to improve its operations and... section 3 residents pursuant to 24 CFR part 135. (k) Institutional structure. (1) The consolidated plan...

2 CFR 215.44 - Procurement procedures.

Science.gov (United States)

2010-01-01

... facilitate participation by small businesses, minority-owned firms, and women's business enterprises. (3..., and women's business enterprises, whenever possible. Recipients of Federal awards shall take all of... women's business enterprises are used to the fullest extent practicable. (2) Make information on...

7 CFR 215.8 - Reimbursement payments.

Science.gov (United States)

2010-01-01

... reimbursement for each half-pint (236 ml.) of milk served to children exceed the cost of the milk to the school or child care institution. (2) The rate of reimbursement for milk purchased and served free to needy... shall be the average cost of milk, i.e., the total cost of all milk purchased during the claim period...

Kinetics of the methylglyoxal scavenging by antidiabetic biguanide drugs investigated using ion transfer voltammetry and capillary electrophoresis

Czech Academy of Sciences Publication Activity Database

Langmaier, Jan; Samec, Zdeněk; Tůma, P.; Samcová, E.

2015-01-01

Roč. 61, č. 3 (2015), s. 215-215 ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR(CZ) GA15-03139S Institutional support: RVO:61388955 Keywords : electrochemistry * methylglyoxal * electrophoresis Subject RIV: CG - Electrochemistry

New Fellows and Honorary Fellow

Indian Academy of Sciences (India)

Home; Fellowship. Fellow Profile. Elected: 2006 Honorary. Klein, Michael L FRS. Date of birth: 1940. Address: Director, ICMS, Temple University, CST, SERC Building, 704E, 1925 North 12th Street, Philadelphia, PA 19122, U.S.A.. Contact: Office: (+1-215) 898 8571. Fax: (+1-215) 898 8296. Email: mlklein@temple.edu.

OctreoScan 111 for imaging of a somatostatin receptor-positive islet cell tumor in rat

International Nuclear Information System (INIS)

Bruns, C.; Stolz, B.; Albert, R.; Marbach, P.; Pless, J.

1993-01-01

We report here the in vitro characterization of SDZ 215-811 and the in vivo imaging of a islet cell tumor gown in rats using [ 111 In]SDZ 215-811. In vitro autoradiographies revelaed a high density of SRIF receptors on the pancreatic tumor tissue. As early as 5 min after intravenous injection of [ 111 In]SDZ 215-811 into tumour-bearing rats, the tumors were clearly localized by gamma-camera scintigraphy. Even 24 h post injection, the islet cell tumor was still detectable. The radioligand was mainly cleared from the circulation via the Kidneys, with a rapid α-phase (t 1/2 =5.6 min) and a slow elimination phase (t 1/2 =7.3 h). Biodistribution studies revealed a relatively high accumulation of radioactivity in the kidneys, but low uptake into the liver and the intestine. High uptake of [ 111 In]SDZ 215-811 was observed for the tumor tissue (0.92±0.07% ID/g; 1 h post injection). Interestingly, a tumor load of 0.14±0.01% ID/g was still measured after 24 h. The tumor/blood ratio was 4.93 after 24 h, indicating specific accumulation of radioactivity in the islet cell tumour. [ 111 In]SDZ 215-811 appears to be sensitive and specific ligand for SRIF receptorpositive tumors and offers an easy procedure for scintigraphic imaging of such tumors in man. (orig.)

Comparisons: Technical-Tactical and Time-Motion Analysis of Mixed Martial Arts by Outcomes.

Science.gov (United States)

Miarka, Bianca; Vecchio, Fabrício B D; Camey, Suzi; Amtmann, John A

2016-07-01

Miarka, B, Vecchio, FBD, Camey, S, and Amtmann, JA. Comparisons: technical-tactical and time-motion analysis of mixed martial arts by outcomes. J Strength Cond Res 30(7): 1975-1984, 2016-The aim of this study was to compare time-motion and technical-tactical analysis between paired outcomes and rounds of mixed martial arts (MMA) matches. The sample consisted of 645 rounds of MMA competition paired by outcomes (first round, winners n = 215 and losers n = 215; second round, winners n = 215 and losers n = 215; third round, winners n = 215 and losers n = 215). The time-motion variables were categorized into low-intensity or high-intensity, stand-up or groundwork situations. Stand-up techniques were analyzed by observing total strikes to the head and body, and takedowns. The actions on the ground were analyzed by observing submission activity, including successful choking and joint locking actions, and also positional improvements, including advances to the mount, half guard, and side and back positions. Chi-squared and Wilcoxon tests were conducted with a significance level of p ≤ 0.05. Results showed that winners had higher values for total strikes and submissions in all rounds, and also positional improvements, over losers. The standing combat with low-intensity comparisons presented differences between the rounds first, with a median of 2:33.5 (P25-P75%: 1:20-3:56) minute, second, with 2:37 (1:24-3:59) minute, and third, with 2:07 (1:06-3:39.2) minute. These data suggest a focus on the intermittent demand presented in combat phases with a special attention to the strike and ground technical-tactical skills; strength and conditioning coaches could emphasize the effort pause ratios for both standing and ground combat that mimic the requirements of MMA, especially during the third round.

Remediation Trends in an Undergraduate Anatomy Course and Assessment of an Anatomy Supplemental Study Skills Course

Science.gov (United States)

Schutte, Audra Faye

2013-01-01

Anatomy A215: Basic Human Anatomy (Anat A215) is an undergraduate human anatomy course at Indiana University Bloomington (IUB) that serves as a requirement for many degree programs at IUB. The difficulty of the course, coupled with pressure to achieve grades for admittance into specific programs, has resulted in high remediation rates. In an…

Establishment of new transmissible and drug-sensitive human immunodeficiency virus type 1 wild types due to transmission of nucleoside analogue-resistant virus.

Science.gov (United States)

de Ronde, A; van Dooren, M; van Der Hoek, L; Bouwhuis, D; de Rooij, E; van Gemen, B; de Boer, R; Goudsmit, J

2001-01-01

Sequence analysis of human immunodeficiency virus type 1 (HIV-1) from 74 persons with acute infections identified eight strains with mutations in the reverse transcriptase (RT) gene at positions 41, 67, 68, 70, 215, and 219 associated with resistance to the nucleoside analogue zidovudine (AZT). Follow-up of the fate of these resistant HIV-1 strains in four newly infected individuals revealed that they were readily replaced by sensitive strains. The RT of the resistant viruses changed at amino acid 215 from tyrosine (Y) to aspartic acid (D) or serine (S), with asparagine (N) as a transient intermediate, indicating the establishment of new wild types. When we introduced these mutations and the original threonine (T)-containing wild type into infectious molecular clones and assessed their competitive advantage in vitro, the order of fitness was in accord with the in vivo observations: 215Y types with D, S, or N residues at position 215 may be warranted in order to estimate the threat to long-term efficacy of regimens including nucleoside analogues.

High burden of Schistosoma mansoni infection in school-aged children in Marolambo District, Madagascar.

Science.gov (United States)

Spencer, Stephen A; Penney, James M St John; Russell, Hannah J; Howe, Anthony P; Linder, Cortland; Rakotomampianina, Andriamahitsisambatra L D; Nandimbiniaina, Anjara M; Squire, S Bertel; Stothard, J Russell; Bustinduy, Amaya L; Rahetilahy, Alain M

2017-06-24

A school-based survey was undertaken to assess prevalence and infection intensity of schistosomiasis in school-aged children in the Marolambo District of Madagascar. School-aged children from six purposively selected schools were tested for Schistosoma haematobium by urine filtration and Schistosoma mansoni using circulating cathodic antigen (CCA) and Kato-Katz stool analysis. The investigators did not address soil-transmitted helminths (STH) in this study. Of 399 school-aged children screened, 93.7% were infected with S. mansoni based on CCA analysis. Kato-Katz analysis of stool revealed S. mansoni infection in 73.6% (215/ 292). Heavy infections (> 400 eggs per gram) were common (32.1%; 69/ 215), with a mean of 482 eggs per gram of stool. Moderate infection intensities were detected in 31.2% (67/ 215) and light infection intensities in 36.7% (79/ 215) of infected participants. No infection with S. haematobium was detected by urine filtration. Intestinal schistosomiasis appears a considerable public health issue in this remote area of Madagascar where there is a pressing need for mass drug administration.

[Prevalence of transmission of zidovudine-resistant viruses in Switzerland. l'Etude suisse de cohorte VIH].

Science.gov (United States)

Yerly, S; Rakik, A; Kinloch-de-Loes, S; Erb, P; Vernazza, P; Hirschel, B; Perrin, L

1996-10-26

Zidovudine (ZDV) was the most widely used anti-HIV drug between 1987 and 1995, and, as already reported, transmission of ZDV-resistant viruses occurs. Several mutations of the reverse transcriptase gene have been identified; one of them affects the 215 codon and is associated with a high degree of resistance. We have determined, using selective PCR, the prevalence of transmission of 215 mutant isolates in 134 patients with primary HIV infection (PHI) and have identified 8 patients with 215 mutant virus between 1989 and 1995 in Switzerland. Mutant resistant viruses have been isolated from patients treated with most antiviral drugs. A systematic search for mutant viruses may provide useful information for the adaptation of treatment strategies.

Alpha particle emitters in medicine

International Nuclear Information System (INIS)

Fisher, D.R.

1989-09-01

Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system

International Nuclear Information System (INIS)

Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.

1982-01-01

A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies

Operating System Support for Shared Hardware Data Structures

Science.gov (United States)

2013-01-31

2.1.4 Systolic Priority Queues . . . . . . . . . . . . . . . . . . . . . . . . . 16 2.1.5 Abstract Datatype Processors...intelligent software support is necessary to achieve good perfor- mance from HWDSs in the presence of overflow and sharing. 2.1.5 Abstract Datatype ...abstract datatype processors, which accelerate data types with mechanisms and performance similar to HWDSs. Abstract datatype instructions can reduce

78 FR 65214 - Defense Federal Acquisition Regulation Supplement: Only One Offer-Further Implementation (DFARS...

Science.gov (United States)

2013-10-31

... exclusions. In accordance with FAR 19.805-1, an acquisition offered to the SBA shall be awarded on the basis... certified cost or pricing data is covered in FAR 15.4 and associated clauses in 52.215, OMB clearance 9000... 15.4 and associated clauses in FAR 52.215, and in OMB clearance 9000-013, Cost or Pricing Data...

A novel recombinant pseudorabies virus expressing parvovirus VP2 gene: Immunogenicity and protective efficacy in swine.

Science.gov (United States)

Chen, Yang; Guo, Wanzhu; Xu, Zhiwen; Yan, Qigui; Luo, Yan; Shi, Qian; Chen, Dishi; Zhu, Ling; Wang, Xiaoyu

2011-06-16

Porcine parvovirus (PPV) VP2 gene has been successfully expressed in many expression systems resulting in self-assembly of virus-like particles (VLPs) with similar morphology to the native capsid. Here, a pseudorabies virus (PRV) system was adopted to express the PPV VP2 gene. A recombinant PRV SA215/VP2 was obtained by homologous recombination between the vector PRV viral DNA and a transfer plasmid. Then recombinant virus was purified with plaque purification, and its identity confirmed by PCR amplification, Western blot and indirect immunofluorescence (IFA) analyses. Electronic microscopy of PRV SA215/VP2 confirmed self-assembly of both pseudorabies virus and VLPs from VP2 protein. Immunization of piglets with recombinant virus elicited PRV-specific and PPV-specific humoral immune responses and provided complete protection against a lethal dose of PRV challenges. Gilts immunized with recombinant viruses induced PPV-specific antibodies, and significantly reduced the mortality rate of (1 of 28) following virulent PPV challenge compared with the control (7 of 31). Furthermore, PPV virus DNA was not detected in the fetuses of recombinant virus immunized gilts. In this study, a recombinant PRV SA215/VP2 virus expressing PPV VP2 protein was constructed using PRV SA215 vector. The safety, immunogenicity, and protective efficacy of the recombinant virus were demonstrated in piglets and primiparous gilts. This recombinant PRV SA215/VP2 represents a suitable candidate for the development of a bivalent vaccine against both PRV and PPV infection.

Differential expression of circulating microRNAs in blood and haematoma samples from patients with intracerebral haemorrhage.

Science.gov (United States)

Wang, Jialu; Zhu, Ying; Jin, Feng; Tang, Ling; He, Zhenwei; He, Zhiyi

2016-06-01

To measure the differential expression of microRNAs (miRNAs) in peripheral blood samples from patients with intracerebral haemorrhage (ICH) and to measure the levels of hsa-miR-21-5p in peripheral blood and haematoma samples from patients with ICH. This case-control study enrolled individuals with ICH in the putamen treated by craniotomy and age- and sex-matched healthy control subjects. Serum miRNA expression profiles were determined in the patient and control groups using miRNA polymerase chain reaction (PCR) arrays. The ICH-related miRNA hsa-miR-21-5p was selected and its differential expression was assessed in peripheral blood and haematoma specimens from patients with ICH compared with peripheral blood samples controls using real-time PCR. Seven patients and five control subjects were included in the miRNA expression profile analysis; and 31 patients and 22 control subjects provided samples for the real-time PCR of hsa-miR-21-5p expression. A total of 59 miRNAs were significantly downregulated in patients with ICH. Relative hsa-miR-21-5p levels of 0.43 and 0.31 for peripheral blood and haematoma samples, respectively, were obtained in the patient group compared with the control subjects. Hsa-miR-21-5p levels were significantly reduced in both peripheral blood and haematoma samples in patients with ICH. © The Author(s) 2016.

Impact of nucleotide polymorphisms at drug resistance sites on ...

African Journals Online (AJOL)

Rachel

2011-11-02

Nov 2, 2011 ... Also, at codon K219, AAA in subtype B is replaced by AAG in most subtypes C viruses. Similarly,. AAC is the codon that predominates in subtype B viruses at position T215, whereas ACT encodes T215 in most A and all recombinant A/E viruses. Also, V106 is encoded by GTG in majority of subtype C ...

Tensor product of left n-invertible operators

Czech Academy of Sciences Publication Activity Database

Duggal, B.P.; Müller, Vladimír

2013-01-01

Roč. 215, č. 2 (2013), s. 113-125 ISSN 0039-3223 R&D Projects: GA ČR GA201/09/0473 Institutional support: RVO:67985840 Keywords : Banach space * essentially left n- invertible operator * left n-invertible operator Subject RIV: BA - General Mathematics Impact factor: 0.630, year: 2013 http://journals.impan.pl/cgi-bin/doi?sm215-2-2

Thermomechanical processing of 5083 aluminum to increase strength without increasing susceptibility to stress corrosion cracking

International Nuclear Information System (INIS)

Edstrom, C.M.; Blakeslee, J.J.

1980-01-01

5083 aluminium with 25% cold work must be processed above 215 0 C or below 70 0 C to avoid forming continuous precipitate in the grain boundaries which makes the material susceptible to stress corrosion cracking. Time at temperature above 215 0 C should be held to minimum (less than 30 min) to retain some strength from the 25% cold work

High rate of hypoglycemia in 6770 type 2 diabetes patients with comorbid dementia: A multicenter cohort study on 215,932 patients from the German/Austrian diabetes registry.

Science.gov (United States)

Prinz, Nicole; Stingl, Julia; Dapp, Albrecht; Denkinger, Michael D; Fasching, Peter; Jehle, Peter M; Merger, Sigrun; Mühldorfer, Steffen; Pieper, Urte; Schuler, Andreas; Zeyfang, Andrej; Holl, Reinhard W

2016-02-01

Dementia and type 2 diabetes (T2D) are two major phenomena in older people. To compare anti-hyperglycemic therapy and diabetes-related comorbidities between elderly T2D patients with or without comorbid dementia. 215,932 type 2 diabetes patients aged ≥ 40 years (median [Q1;Q3]: 70.4 [61.2;77.7] years) from the standardized, multicenter German/Austrian diabetes patient registry, DPV, were studied. To identify patients with comorbid dementia, the registry was searched by ICD-10 codes, DSM-IV/-5 codes, respective search terms and/or disease-specific medication. For group comparisons, multiple hierarchic regression modeling with adjustments for age, sex, and duration of diabetes was applied. 3.1% (n=6770; 57% females) of the eligible T2D patients had clinically recognized comorbid dementia. After adjustment for demographics, severe hypoglycemia (insulin group: 14.8 ± 0.6 vs. 10.4 ± 0.2 events per 100 patient-years, p<0.001), hypoglycemia with coma (insulin group: 7.6 ± 0.4 vs. 3.9 ± 0.1 events per 100 patient-years, p<0.001), depression (9.9 vs. 4.7%, p<0.001), hypertension (74.7 vs. 72.2%, p<0.001), stroke (25.3 vs. 6.5%, p<0.001), diabetic foot syndrome (6.0 vs. 5.2%, p=0.004), and microalbuminuria (34.7 vs. 32.2%, p<0.001) were more common in dementia patients compared to T2D without dementia. Moreover, patients with dementia received insulin therapy more frequently (59.3 vs. 54.7%, p<0.001), but metabolic control (7.7 ± 0.1 vs. 7.7 ± 0.1%) was comparable to T2D without dementia. In T2D with dementia, higher rates of hypoglycemia and other diabetes-related comorbidities were observed. Hence, the risks of a glucocentric and intense diabetes management with insulin and a focus on tight glycemic control without considering other factors may outweigh the benefits in elderly T2D patients with comorbid dementia. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Clinical characteristics and outcome of 467 patients with a clinically recognized eating disorder identified among 52,215 patients with type 1 diabetes: a multicenter german/austrian study.

Science.gov (United States)

Scheuing, Nicole; Bartus, Béla; Berger, Gabriele; Haberland, Holger; Icks, Andrea; Knauth, Burkhild; Nellen-Hellmuth, Nicole; Rosenbauer, Joachim; Teufel, Martin; Holl, Reinhard W

2014-06-01

To compare clinical characteristics and outcome of type 1 diabetes mellitus (T1DM) between patients with and without a clinically recognized eating disorder (ED). A total of 52,215 T1DM patients aged 8 to anorexia nervosa [AN], n = 141 [female: 94.3%]; bulimia nervosa [BN], n = 62 [90.3%]; and EDs not otherwise specified, including binge-eating disorder [EDNOS], n = 264 [74.2%]). Groups were compared using multivariable regression. Cox proportional hazard ratios were calculated for the association between ED and retinopathy. After adjustment for age, sex, and duration of diabetes, patients with ED revealed higher HbA1c (no ED vs. AN, BN, or EDNOS, respectively: 8.29 ± 0.01% [67.1 ± 0.1 mmol/mol] vs. 8.61 ± 0.15% [70.6 ± 1.6 mmol/mol], 9.11 ± 0.23% [76.1 ± 2.5 mmol/mol], or 9.00 ± 0.11% [74.9 ± 1.2 mmol/mol]) and a higher rate of pathological insulin injection sites (48.4 vs. 64.3, 64.1, or 62.1%). Furthermore, ketoacidosis (5.7 ± 0.1 vs. 12.1 ± 2.1, 18.0 ± 4.1, or 12.9 ± 1.6 events per 100 person-years) and hospitalization (54.9 ± 0.3 vs. 89.3 ± 6.0, 132.0 ± 12.7, or 91.0 ± 4.4 per 100 person-years) were more common, and duration of hospital stay was longer (4.81 ± 0.01 vs. 11.31 ± 0.21, 18.05 ± 0.48, or 8.44 ± 0.13 days per year). All P values were EDNOS had a 2.5-fold (95% CI 1.3-4.8) and a 1.4-fold (0.8-2.3) higher risk for retinopathy, whereas AN patients had no increased risk (0.9 [95% CI 0.4-2.3]). Diabetes health care professionals should be aware of comorbid EDs in pediatric/young-adult T1DM patients. An ED diagnosis is associated with worse metabolic control and higher rates of diabetes complications. © 2014 by the American Diabetes Association.

78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM...

Science.gov (United States)

2013-10-31

... energy storage capacity less than or equal to 10 Wh, provided in special provision of A186 of the ICAO TI... Division 4.1 (Flammable Solid) material for transportation by motor vehicle, rail car, vessel, or cargo... transportation by motor vehicle, rail car, vessel, or cargo-only aircraft, subject to the following conditions...

A novel recombinant pseudorabies virus expressing parvovirus VP2 gene: Immunogenicity and protective efficacy in swine

Directory of Open Access Journals (Sweden)

Chen Dishi

2011-06-01

Full Text Available Abstract Background Porcine parvovirus (PPV VP2 gene has been successfully expressed in many expression systems resulting in self-assembly of virus-like particles (VLPs with similar morphology to the native capsid. Here, a pseudorabies virus (PRV system was adopted to express the PPV VP2 gene. Methods A recombinant PRV SA215/VP2 was obtained by homologous recombination between the vector PRV viral DNA and a transfer plasmid. Then recombinant virus was purified with plaque purification, and its identity confirmed by PCR amplification, Western blot and indirect immunofluorescence (IFA analyses. Electronic microscopy of PRV SA215/VP2 confirmed self-assembly of both pseudorabies virus and VLPs from VP2 protein. Results Immunization of piglets with recombinant virus elicited PRV-specific and PPV-specific humoral immune responses and provided complete protection against a lethal dose of PRV challenges. Gilts immunized with recombinant viruses induced PPV-specific antibodies, and significantly reduced the mortality rate of (1 of 28 following virulent PPV challenge compared with the control (7 of 31. Furthermore, PPV virus DNA was not detected in the fetuses of recombinant virus immunized gilts. Conclusions In this study, a recombinant PRV SA215/VP2 virus expressing PPV VP2 protein was constructed using PRV SA215 vector. The safety, immunogenicity, and protective efficacy of the recombinant virus were demonstrated in piglets and primiparous gilts. This recombinant PRV SA215/VP2 represents a suitable candidate for the development of a bivalent vaccine against both PRV and PPV infection.

Alterations in microRNA expression profile in HCV-infected hepatoma cells: Involvement of miR-491 in regulation of HCV replication via the PI3 kinase/Akt pathway

Energy Technology Data Exchange (ETDEWEB)

Ishida, Hisashi; Tatsumi, Tomohide; Hosui, Atsushi; Nawa, Takatoshi; Kodama, Takahiro; Shimizu, Satoshi; Hikita, Hayato; Hiramatsu, Naoki; Kanto, Tatsuya [Department of Gastroenterology and Hepatology, Osaka University Graduate School of Medicine, 2-2, Yamadaoka, Suita 565-0871 (Japan); Hayashi, Norio [Kansai Rosai Hospital, 3-1-69, Inabaso, Amagasaki 660-8511 (Japan); Takehara, Tetsuo, E-mail: takehara@gh.med.osaka-u.ac.jp [Department of Gastroenterology and Hepatology, Osaka University Graduate School of Medicine, 2-2, Yamadaoka, Suita 565-0871 (Japan)

2011-08-19

Highlights: {yields} HCV infection upregulated miR-192, -194, -215, downregulated miR-320, -491. {yields} Transfection of miR-192, -215, and -491 enhanced HCV replication. {yields} Transfection of miR-491 inhibited Akt phosphorylation. {yields} Akt inhibition could be responsible for augmentation of HCV replication by miR-491. -- Abstract: The aim of this study was to investigate the role of microRNA (miRNA) on hepatitis C virus (HCV) replication in hepatoma cells. Using miRNA array analysis, miR-192/miR-215, miR-194, miR-320, and miR-491 were identified as miRNAs whose expression levels were altered by HCV infection. Among them, miR-192/miR-215 and miR-491 were capable of enhancing replication of the HCV replicon as well as HCV itself. HCV IRES activity or cell proliferation was not increased by forced expression of miR-192/miR-215 or miR-491. Investigation of signaling pathways revealed that miR-491 specifically suppressed the phosphoinositol-3 (PI3) kinase/Akt pathway. Under inhibition of PI3 kinase by LY294002, the suppressive effect of miR-491 on HCV replication was abolished, indicating that suppression of HCV replication by miR-491 was dependent on the PI3 kinase/Akt pathway. miRNAs altered by HCV infection would then affect HCV replication, which implies a complicated mechanism for regulating HCV replication. HCV-induced miRNA may be involved in changes in cellular properties including hepatocarcinogenesis.

Impact of a Mobile Phone Intervention to Reduce Sedentary Behavior in a Community Sample of Adults: A Quasi-Experimental Evaluation.

Science.gov (United States)

Kendzor, Darla E; Shuval, Kerem; Gabriel, Kelley Pettee; Businelle, Michael S; Ma, Ping; High, Robin R; Cuate, Erica L; Poonawalla, Insiya B; Rios, Debra M; Demark-Wahnefried, Wendy; Swartz, Michael D; Wetter, David W

2016-01-25

Greater time spent sedentary is linked with increased risk of breast, colorectal, ovarian, endometrial, and prostate cancers. Given steadily increasing rates of mobile phone ownership, mobile phone interventions may have the potential to broadly influence sedentary behavior across settings. The purpose of this study was to examine the short-term impact of a mobile phone intervention that targeted sedentary time in a diverse community sample. Adults participated in a quasi-experimental evaluation of a mobile phone intervention designed to reduce sedentary time through prompts to interrupt periods of sitting. Participants carried mobile phones and wore accelerometers for 7 consecutive days. Intervention participants additionally received mobile phone prompts during self-reported sitting and information about the negative health impact of prolonged sedentariness. The study was conducted from December 2012 to November 2013 in Dallas, Texas. Linear mixed model regression analyses were conducted to evaluate the influence of the intervention on daily accelerometer-determined estimates of sedentary and active time. Participants (N=215) were predominantly female (67.9%, 146/215) and nonwhite (black: 50.7%, 109/215; Latino: 12.1%, 26/215; other: 5.6%, 12/215). Analyses revealed that participants who received the mobile phone intervention had significantly fewer daily minutes of sedentary time (B=-22.09, P=.045) and more daily active minutes (B=23.01, P=.04) than control participants. A simple mobile phone intervention was associated with engaging in less sedentary time and more physical activity. Findings underscore the potential impact of mobile phone interventions to positively influence sedentary behavior and physical activity.

Installation Management Command - Flattening or Flat-lining?

Science.gov (United States)

2012-03-22

3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on Higher Education is an institutional accrediting agency recognized by...3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on Higher Education is an institutional accrediting agency recognized by...for functional support. Key account management is a concept used in the corporate realm, with companies such as Pepsi Bottling Group, International

U.S. Cyber Command Support to Geographic Combatant Commands

Science.gov (United States)

2011-03-02

State Association of Colleges and Schools, 3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on Higher Education is an...the Middle States Association of Colleges and Schools, 3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on Higher...Defense Regarding Cybersecurity. 33 The NCCIC is augmented by the Cyber Unified Coordination Group ( UCG ) made up of public and private sector officials

Mathematical Modeling of Physical and Cognitive Performance Decrement from Mechanical and Inhalation Insults

Science.gov (United States)

2009-12-01

12  2.1.5  The effect of hypoxia and carboxyhemoglobin concentration on exercise performance in goats...B.L., Ng, L., and Stuhmiller, J.H. “The effects of hypoxia and carboxyhemoglobin concentration on a ‘phenomenological’ model’s recovery parameter...State. 2.1.5 The effect of hypoxia and carboxyhemoglobin concentration on exercise performance in goats The purpose of this study was to quantify if

Empire Maintenance in the Information Age: Influence of Mediaverse on Strategy

Science.gov (United States)

2013-03-01

Education of the Middle States Association of Colleges and Schools, 3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on Higher...Schools, 3624 Market Street, Philadelphia, PA 19104, (215) 662-5606. The Commission on Higher Education is an institutional accrediting agency...as Facebook, LinkedIn, Twitter, Instagram , Pinterest, and Tumblr are connecting people with loved ones abroad and exposing them to content beyond

Role of scaffold mean pore size in meniscus regeneration.

Science.gov (United States)

Zhang, Zheng-Zheng; Jiang, Dong; Ding, Jian-Xun; Wang, Shao-Jie; Zhang, Lei; Zhang, Ji-Ying; Qi, Yan-Song; Chen, Xue-Si; Yu, Jia-Kuo

2016-10-01

Recently, meniscus tissue engineering offers a promising management for meniscus regeneration. Although rarely reported, the microarchitectures of scaffolds can deeply influence the behaviors of endogenous or exogenous stem/progenitor cells and subsequent tissue formation in meniscus tissue engineering. Herein, a series of three-dimensional (3D) poly(ε-caprolactone) (PCL) scaffolds with three distinct mean pore sizes (i.e., 215, 320, and 515μm) were fabricated via fused deposition modeling. The scaffold with the mean pore size of 215μm significantly improved both the proliferation and extracellular matrix (ECM) production/deposition of mesenchymal stem cells compared to all other groups in vitro. Moreover, scaffolds with mean pore size of 215μm exhibited the greatest tensile and compressive moduli in all the acellular and cellular studies. In addition, the relatively better results of fibrocartilaginous tissue formation and chondroprotection were observed in the 215μm scaffold group after substituting the rabbit medial meniscectomy for 12weeks. Overall, the mean pore size of 3D-printed PCL scaffold could affect cell behavior, ECM production, biomechanics, and repair effect significantly. The PCL scaffold with mean pore size of 215μm presented superior results both in vitro and in vivo, which could be an alternative for meniscus tissue engineering. Meniscus tissue engineering provides a promising strategy for meniscus regeneration. In this regard, the microarchitectures (e.g., mean pore size) of scaffolds remarkably impact the behaviors of cells and subsequent tissue formation, which has been rarely reported. Herein, three three-dimensional poly(ε-caprolactone) scaffolds with different mean pore sizes (i.e., 215, 320, and 515μm) were fabricated via fused deposition modeling. The results suggested that the mean pore size significantly affected the behaviors of endogenous or exogenous stem/progenitor cells and subsequent tissue formation. This study furthers

Book Review: Jessica F Green, Rethinking Private Authority: Agents and Entrepreneurs in Global Environmental Governance

DEFF Research Database (Denmark)

Keremis, Anestis

2017-01-01

Book review of "Rethinking Private Authority: Agents and Entrepreneurs in Global Environmental Governance" by Jessica F Green. Princeton,NJ and Oxford: Princeton University Press, 2014.215 pp., £16.95 (p/b), ISBN 9780691157597......Book review of "Rethinking Private Authority: Agents and Entrepreneurs in Global Environmental Governance" by Jessica F Green. Princeton,NJ and Oxford: Princeton University Press, 2014.215 pp., £16.95 (p/b), ISBN 9780691157597...

2 CFR 215.11 - Pre-award policies.

Science.gov (United States)

2010-01-01

... Government. (b) Public Notice and Priority Setting. Federal awarding agencies shall notify the public of its intended funding priorities for discretionary grant programs, unless funding priorities are established by...

48 CFR 1352.215-70 - Proposal preparation.

Science.gov (United States)

2010-10-01

..., double-spaced, with one inch margins, using elite font, 12 pitch type (or equivalent) and printed... included in Volume II. However, the type and quantity of labor and materials is to be included in the... offeror shall submit one original of Volume III, marked as such, and copies. [INSERT FOR COST TYPE...

48 CFR 252.215-7000 - Pricing adjustments.

Science.gov (United States)

2010-10-01

... clauses entitled “Price Reduction for Defective Cost or Pricing Data—Modifications,” “Subcontractor Cost or Pricing Data,” and “Subcontractor Cost or Pricing Data—Modifications,” means the aggregate increases and/or decreases in cost plus applicable profits. (End of clause) [56 FR 36479, July 31, 1991, as...

21 CFR 172.215 - Coumarone-indene resin.

Science.gov (United States)

2010-04-01

... examined at the National Archives and Records Administration (NARA). For information on the availability of this material at NARA, call 202-741-6030, or go to: http://www.archives.gov/federal_register/code_of... fresh-weight basis. (d) To assure safe use of the additive: (1) The label of the market package or any...

215 ECONOMIC CONTRIBUTION OF CASSAVA PRODUCTION (A ...

African Journals Online (AJOL)

DR. AMINU

2010-06-01

Jun 1, 2010 ... The study determined the economics of cassava production in Kuje Area Council FCT. Simple random ... their main dish. Because of its high demand both .... elasticity of production with respect to each input categories and ...

48 CFR 2052.215-76 - Preproposal conference.

Science.gov (United States)

2010-10-01

... 1993) (a) A preproposal conference is scheduled for: Date: * Location: * Time: * (b) This conference is... preparing any necessary amendment to the solicitation. If you plan to attend the conference, notify * by letter or telephone * , no later than close of business * . Notification of your intention to attend is...

7 CFR 215.14a - Procurement standards.

Science.gov (United States)

2010-01-01

... to the local, State or Federal authority that has proper jurisdiction. (c) Procedures. The State... food authority or child care institution may use its own procurement procedures which reflect applicable State or local laws and regulations, provided that procurements made with nonprofit school food...

36 CFR 215.13 - Who may appeal.

Science.gov (United States)

2010-07-01

... comment period for an environmental assessment, or 45-day comment period for a draft environmental impact... interest statutes at 18 U.S.C. 202-209 and with employee ethics requirements at 5 CFR part 2635...

48 CFR 1352.215-75 - Evaluation criteria.

Science.gov (United States)

2010-10-01

...-price (technical) evaluation factors are [significantly more important/somewhat more important/approximately equal in importance/somewhat less important/significantly less important] than evaluated price... customer satisfaction. The Government reserves the right to assess the past performance of proposed...

Telomere dysfunction and cell survival: Roles for distinct TIN2-containing complexes

Energy Technology Data Exchange (ETDEWEB)

Kim, Sahn-ho; Davalos, Albert R.; Heo, Seok-Jin; Rodier, Francis; Zou, Ying; Beausejour, Christian; Kaminker, Patrick; Yannone, Steven M.; Campisi, Judith

2007-10-02

Telomeres are maintained by three DNA binding proteins (TRF1, TRF2 and POT1), and several associated factors. One factor, TIN2, binds TRF1 and TRF2 directly and POT1 indirectly. Along with two other proteins, TPP1 and hRap1, these form a soluble complex that may be the core telomere maintenance complex. It is not clear whether sub-complexes also exist in vivo. We provide evidence for two TIN2 sub-complexes with distinct functions in human cells. We isolated these two TIN2 sub-complexes from nuclear lysates of unperturbed cells and cells expressing TIN2 mutants TIN2-13, TIN2-15C, which cannot bind TRF2 or TRF1, respectively. In cells with wild-type p53 function, TIN2-15C was more potent than TIN2-13 in causing telomere uncapping and eventual growth arrest. In cells lacking p53 function, TIN2-15C was more potent than TIN2-13 in causing telomere dysfunction and cell death. Our findings suggest that distinct TIN2 complexes exist, and that TIN2-15C-sensitive subcomplexes are particularly important for cell survival in the absence of functional p53.

’Don’t Ask, Don’t Tell’ Policy: Is It Time to Talk?

Science.gov (United States)

2009-03-26

by the Commission on Higher Education of the Middle State Association of Colleges and Schools, 3624 Market Street, Philadelphia, PA 19104, (215) 662...accredited by the Commission on Higher Education of the Middle States Association of Colleges and Schools, 3624 Market Street, Philadelphia, PA 19104, (215...Lesbians, Bisexual and Transgender (GLBTs). 2 P.W. Singer, How The Real World Ended “Don’t Ask, Don’t Tell” (Washington, DC: Brooking Institute, August

Beta-decay measurements of neutron-rich thallium, lead, and bismuth by means of resonant laser ionisation

Science.gov (United States)

Franchoo, S.; de Witte, H.; Andreyev, A. N.; Cederka¨Ll, J.; Dean, S.; de Smet, A.; Eeckhaudt, S.; Fedorov, D. V.; Fedosseev, V. N.; G´Rska, M.; Huber, G.; Huyse, M.; Janas, Z.; Ko¨Ster, U.; Kurcewicz, W.; Kurpeta, J.; Mayer, P.; Płchocki, A.; van de Vel, K.; van Duppen, P.; Weissman, L.; Isolde Collaboration

2004-04-01

Neutron-rich thallium, lead, and bismuth isotopes were investigated at the ISOLDE facility. After mass separation and resonant laser ionisation of the produced activity, new spectroscopic data were obtained for 215,218Bi and 215Pb. An attempt to reach heavy thallium had to be abandoned because of a strong francium component in the beam that gave rise to a neutron background through (α,n) reactions on the aluminium walls of the experimental chamber.

The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

International Nuclear Information System (INIS)

Chatal, J. F.

2000-01-01

The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

On the theory of time dilation in chemical kinetics

Science.gov (United States)

Baig, Mirza Wasif

2017-10-01

The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

Energy Technology Data Exchange (ETDEWEB)

Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

2016-08-01

The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

Energy Technology Data Exchange (ETDEWEB)

Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

2005-08-01

Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

Early Paleogene variations in the calcite compensation depth: new constraints using old borehole sediments from across Ninetyeast Ridge, central Indian Ocean

Science.gov (United States)

Slotnick, B. S.; Lauretano, V.; Backman, J.; Dickens, G. R.; Sluijs, A.; Lourens, L.

2015-03-01

Major variations in global carbon cycling occurred between 62 and 48 Ma, and these very likely related to changes in the total carbon inventory of the ocean-atmosphere system. Based on carbon cycle theory, variations in the mass of the ocean carbon should be reflected in contemporaneous global ocean carbonate accumulation on the seafloor and, thereby, the depth of the calcite compensation depth (CCD). To better constrain the cause and magnitude of these changes, the community needs early Paleogene carbon isotope and carbonate accumulation records from widely separated deep-sea sediment sections, especially including the Indian Ocean. Several CCD reconstructions for this time interval have been generated using scientific drill sites in the Atlantic and Pacific oceans; however, corresponding information from the Indian Ocean has been extremely limited. To assess the depth of the CCD and the potential for renewed scientific drilling of Paleogene sequences in the Indian Ocean, we examine lithologic, nannofossil, carbon isotope, and carbonate content records for late Paleocene - early Eocene sediments recovered at three sites spanning Ninetyeast Ridge: Deep Sea Drilling Project (DSDP) Sites 213 (deep, east), 214 (shallow, central), and 215 (deep, west). The disturbed, discontinuous sediment sections are not ideal, because they were recovered in single holes using rotary coring methods, but remain the best Paleogene sediments available from the central Indian Ocean. The δ13C records at Sites 213 and 215 are similar to those generated at several locations in the Atlantic and Pacific, including the prominent high in δ13C across the Paleocene carbon isotope maximum (PCIM) at Site 215, and the prominent low in δ13C across the early Eocene Climatic Optimum (EECO) at both Site 213 and Site 215. The Paleocene-Eocene thermal maximum (PETM) and the K/X event are found at Site 213 but not at Site 215, presumably because of coring gaps. Carbonate content at both Sites 213 and

Targeting MT1-MMP as an ImmunoPET-Based Strategy for Imaging Gliomas.

Directory of Open Access Journals (Sweden)

A G de Lucas

Full Text Available A critical challenge in the management of Glioblastoma Multiforme (GBM tumors is the accurate diagnosis and assessment of tumor progression in a noninvasive manner. We have identified Membrane-type 1 matrix metalloproteinase (MT1-MMP as an attractive biomarker for GBM imaging since this protein is actively involved in tumor growth and progression, correlates with tumor grade and is closely associated with poor prognosis in GBM patients. Here, we report the development of an immunoPET tracer for effective detection of MT1-MMP in GBM models.An anti-human MT1-MMP monoclonal antibody (mAb, LEM2/15, was conjugated to p-isothiocyanatobenzyl-desferrioxamine (DFO-NCS for 89Zr labeling. Biodistribution and PET imaging studies were performed in xenograft mice bearing human GBM cells (U251 expressing MT1-MMP and non-expressing breast carcinoma cells (MCF-7 as negative control. Two orthotopic brain GBM models, patient-derived neurospheres (TS543 and U251 cells, with different degrees of blood-brain barrier (BBB disruption were also used for PET imaging experiments.89Zr labeling of DFO-LEM2/15 was achieved with high yield (>90% and specific activity (78.5 MBq/mg. Biodistribution experiments indicated that 89Zr-DFO-LEM2/15 showed excellent potential as a radiotracer for detection of MT1-MMP positive GBM tumors. PET imaging also indicated a specific and prominent 89Zr-DFO-LEM2/15 uptake in MT1-MMP+ U251 GBM tumors compared to MT1-MMP- MCF-7 breast tumors. Results obtained in orthotopic brain GBM models revealed a high dependence of a disrupted BBB for tracer penetrance into tumors. 89Zr-DFO-LEM2/15 showed much higher accumulation in TS543 tumors with a highly disrupted BBB than in U251 orthotopic model in which the BBB permeability was only partially increased. Histological analysis confirmed the specificity of the immunoconjugate in all GBM models.A new anti MT1-MMP-mAb tracer, 89Zr-DFO-LEM2/15, was synthesized efficiently. In vivo validation showed high

Environmental Assessment for MQ-1 Launch and Recovery Element Training Operations at Southern California Logistics Airport Victorville, California

Science.gov (United States)

2008-02-01

Department of Housing and Urban Development I- Interstate IFR instrument flight rules IICEP Interagency and Intergovernmental Coordination for...rules ( IFR ). If necessary or desired, the UAV – once in Class A airspace above 18,000 feet MSL – could travel to R-2501 above MCAGCC Twentynine...178 178 190 14 138 18 40 15 215 15 15 15 5 5 10 215 10 10 EL MIRAGE AIRPORT SOUTHERN CALIFORNIA LOGISTICS AIRPORT EDWARDS AFB NAWS CHINA LAKE SOUTH

Immunoblot Patterns of Taenia asiatica Taeniasis

Science.gov (United States)

Jeon, Hyeong-Kyu

2009-01-01

Differential diagnosis of Taenia asiatica infection from other human taeniases by serology has been tested. An enzyme-linked immunoelectrotransfer blot (EITB) was applied to subjected human sera and tapeworm materials. Thirty-eight proteins reactive to serum IgG were observed between 121 and 10 kDa in adult worms, and more than 22 serum-reactive components between 97 kDa and 21.5 kDa were observed in eggs of T. asiatica. Antigens of adult T. asiatica revealed immunoblot bands between 120 and 21.5 kDa against T. asiatica infected sera. Antigens of adult Taenia saginata revealed 110-100, 66, 58-56, and 46 kDa immunoblot bands against T. asiatica infected sera. Antigens of adult Taenia solium also revealed 99-97, 68-66, and 46 kDa bands against T. asiatica infected sera. The immunoblot band of 21.5 kDa exhibited specificity to T. asiatica. PMID:19290097

Immunoblot patterns of Taenia asiatica taeniasis.

Science.gov (United States)

Jeon, Hyeong-Kyu; Eom, Keeseon S

2009-03-01

Differential diagnosis of Taenia asiatica infection from other human taeniases by serology has been tested. An enzyme-linked immunoelectrotransfer blot (EITB) was applied to subjected human sera and tapeworm materials. Thirty-eight proteins reactive to serum IgG were observed between 121 and 10 kDa in adult worms, and more than 22 serum-reactive components between 97 kDa and 21.5 kDa were observed in eggs of T. asiatica. Antigens of adult T. asiatica revealed immunoblot bands between 120 and 21.5 kDa against T. asiatica infected sera. Antigens of adult Taenia saginata revealed 110-100, 66, 58-56, and 46 kDa immunoblot bands against T. asiatica infected sera. Antigens of adult Taenia solium also revealed 99-97, 68-66, and 46 kDa bands against T. asiatica infected sera. The immunoblot band of 21.5 kDa exhibited specificity to T. asiatica.

The behavioral and immunological impact of maternal separation: a matter of timing

Directory of Open Access Journals (Sweden)

Susana eRoque

2014-05-01

Full Text Available Maternal separation (MS, an early life stressful event, has been demonstrated to trigger neuropsychiatric disorders later in life, in particular depression. Experiments using rodents subjected to MS protocols have been very informative for the establishment of this association. However, the mechanism by which MS leads to neuropsychiatric disorders is far from being understood. This is probably associated with the multifactorial nature of depression but also with the fact that different research MS protocols have been used (that vary on temporal windows and time of exposure to MS. In the present study MS was induced in rats in two developmental periods: for 6 h per day for 14 days between postnatal days 2-15 (MS2-15 and 7-20 (MS7-20. These two periods, were defined to differ essentially on the almost complete (MS2-15 or partial (MS7-20 overlap with the stress hypo-responsive period. Behavioral, immunological and endocrine parameters, frequently associated with depressive-like behavior, were analyzed in adulthood. Irrespectively from the temporal window, both MS exposure periods led to increased sera corticosterone levels. However, only MS2-15 animals displayed depressive and anxious-like behaviors. Moreover, MS2-15 was also the only group presenting alterations in the immune system, displaying decreased percentage of CD8+ T cells, increased spleen T cell CD4/CD8 ratio, and thymocytes with increased resistance to dexamethasone-induced cell death. A linear regression model performed to predict depressive-like behavior showed that both corticosterone levels and T cell CD4/CD8 ratio explained 37% of the variance observed in depressive-like behavior. Overall, these findings highlight the existence of critical periods for early life stressful events to exert programming effects on both central and peripheral systems, which are of relevance for distinct patterns of susceptibility to emotional disorders later in life.

The influence of electron beam irradiation on the mechanical and thermal properties of Poly (ether-block-amide) blends

International Nuclear Information System (INIS)

Murray, Kieran A.; Kennedy, James E.; McEvoy, Brian; Vrain, Olivier; Ryan, Damien; Cowman, Richard; Higginbotham, Clement L.

2014-01-01

High energy electron beam irradiation of Poly (ether-block-amide) (Pebax) can induce modifications and/or degradation to transpire in the material subsequent to treatment. To minimise this, Pebax was blended with three stabilisers where each formulation was subjected to electron beam radiation at doses of 25, 50 and 75 kGy. Mechanical testing revealed that the virgin Pebax and the Pebax blended with Irganox B215 provided the best radiation resistance in terms of the tensile strength, elongation at break and Young's modulus. Upon increase in radiation dose from 25 to 75 kGy, a gradual diminution was observed for the melt flow index (MFI) of the virgin Pebax, whereas Pebax blended with Irganox B215 had a minute effect on the properties post irradiation. This study provides evidence that the stabilisers used can either promote undesirable effects or enhance the radiation resistance of Pebax material following radiation exposure. Highlights: • Mechanical properties of Pebax and Irganox 565 can be controlled by radiation dose • Virgin Pebax and Pebax blended with Irgnaox B215 provides good radiation resistance • MFI decreases gradually for the Virgin Pebax with an increase in radiation dose • Molecular weight of Pebax and Irganox B215 is less effected by radiation dose • Simultaneous chain scission and crosslinking/branching occurs during irradiation

Membrane localization and dynamics of geranylgeranylated Rab5 hypervariable region.

Science.gov (United States)

Edler, Eileen; Schulze, Eric; Stein, Matthias

2017-08-01

The small GTPase Rab5 is a key regulator of endosomal trafficking processes and a marker for the early endosome. The C-terminal hypervariable region (HVR) of Rab5 is post-translationally modified at residues Cys 212 and Cys 213 to accommodate two geranylgeranyl anchors (C20 carbon chain length) in order to associate Rab5 with the membrane. The structural role of the HVR regarding protein-early endosome membrane recruitment is not resolved due to its high degree of flexibility and lack of crystallographic information. Here, full-atomistic and coarse-grained molecular dynamics simulations of the truncated Rab5 HVR 206-215 in three model membranes of increasing complexity (pure phospholipid bilayer, ternary membrane with cholesterol, six-component early endosome) were performed. Specific electrostatic interactions between the HVR 206-215 Arg 209 residue and the phosphate group of the inositol ring of PI(3)P were detected. This shows that PI(3)P acts as a first contact site of protein recruitment to the early endosome. The free energy change of HVR 206-215 extraction from the bilayer was largest for the physiological negatively charged membrane. 5μs coarse-grained simulations revealed an active recruitment of PI(3)P to the HVR 206-215 supporting the formation of Rab5- and PI(3)P enriched signaling platforms. Copyright © 2017 Elsevier B.V. All rights reserved.

Modification of the activity of an alpha-amylase from Bacillus licheniformis by several surfactants

OpenAIRE

Bravo Rodríguez,Vicente; Jurado Alameda,Encarnación; Martínez Gallegos,Juan Francisco; Reyes Requena,Antonia; García López,Ana Isabel; Sampaio Cabral,Joaquim Manuel; Fernandes,Pedro; Pina da Fonseca,Luis Joaquim

2006-01-01

The influence of different commercial surfactants on the enzymatic activity of a commercial alpha-amylase from Bacillus licheniformis (Termamyl 300 L) has been studied. As non-ionic surfactants, alkyl polyglycosides (Glucopon® 215, Glucopon® 600 and Glucopon® 650) were studied, as were fatty alcohol ethoxylates (Findet 1214N/23 and Findet 10/15), and nonyl phenol ethoxylate (Findet 9Q/21.5NF). Also, an anionic surfactant, linear alkyl benzene sulfonate (LAS) was assayed. In general, none of t...

United States Air Force Statistical Digest. Fiscal Year 1970. 25th Edition

Science.gov (United States)

1971-02-22

GUIDED MISSILE. AIR TO AIR MISSILE. AND TARGET DRONEACCEPTANCES BY MANUFACTURER. BY MONTI -!- FY 1970 o ACCEPl’ED ACCEPTANCES FOR FY 1970 TOTAL...AUTOMATICALLY DECLASSIFIEDDOD VIR. 5200.10 CONFIDENTIAL Ceylon •••••.•.•..• 19 19 - 1 - 6 - 12 - - - - - Federation of Malaysia . • • • 215 215 67 17 1...Medical Service Squadrons & Flights • • • • • • • • Air Postal & Courier ,Groups& Fligl:ts ••••••• Censorship Squadrons

2 CFR 1326.215 - Which nonprocurement transactions, in addition to those listed in 2 CFR 180.215, are not covered...

Science.gov (United States)

2010-01-01

... Commerce, an incidental benefit that results from ordinary governmental operations includes: (1) Export... and Agreements Federal Agency Regulations for Grants and Agreements DEPARTMENT OF COMMERCE... of Commerce, a transaction that the Department needs to respond to a national or agency-recognized...

PENGARUH PENAMBAHAN SIKA GROUT PADA MORTAR SEBAGAI BAHAN GROUTING TERHADAP LEKATAN TULANGAN DALAM BETON DENGAN COPPER SLAG SEBAGAI CEMENTITIOUS

Directory of Open Access Journals (Sweden)

Mohammad Sulton

2012-09-01

Full Text Available Abstract: The Impact of Sika Grout Addition on Grouting Mortar Toward Concrete Reinforcement Stickness with Copper Slag as Cementitious. The aim of this research is to identify the impact of Sika Grout addition on grouting mortar toward concrete reinforcement stickness with copper slag as cementitious. The experiment result of this research shows that (1 the addition of Sika Grout 215 in grouting mortar can improve the reinforcement stickness; (2 the use of 100% Sika Grout 215 in grouting mortar produces maximum stickness; (3 the stickness of 100% Sika Grout 215 has 12.800 kg stronger (2,8% of improvement than those of using copper slag reinforcement (without grouting as 12.450 kg; (4 the use of less than 100% Sika Grout produces less stickness of no-grouting reinforcement; and (5 there is similar slip characteristic between  concrete reinforcement added with grouting and without grouting as 2,5 mm on outer part of the mortar.

Prevalence of drug resistance mutations and non-B subtypes in newly diagnosed HIV-1 patients in Denmark

DEFF Research Database (Denmark)

Jørgensen, Louise B; Christensen, Marianne B; Gerstoft, Jan

2003-01-01

The aim of this study was to monitor the prevalence of drug resistance mutations in newly diagnosed HIV-1 positive individuals in Denmark. In addition we assessed the prevalence of non-B subtypes based on phylogenetic analysis of the pol gene. Plasma samples from 104 newly diagnosed HIV-1 positive...... patients were obtained in the year 2000. The entire protease gene and 320 amino acids of the reverse transcriptase gene were genotyped. Sequences were obtained from 97 patients. No subjects displayed primary resistance mutations in the protease gene, whereas all carried 1 or more secondary mutations....... Resistance mutations in the RT-gene associated with NRTI-resistance were found in 1 patient, who was infected with zidovudine resistant HIV-1 harbouring the M41L mutation in combination with T215S and L210S. The T215S mutation has been showed to be associated with reversion of zidovudine resistance. The T215...

ORF Alignment: NC_003210 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 215 EINIPETLVEICNNKLGVGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGE 274 ... E...INIPETLVEICNNKLGVGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGE Sbjct: 131 EINIPETLVEICNNKLGVGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGE 190 ...

Effect of different factors on phase transformations in Fe-Mn alloys

International Nuclear Information System (INIS)

Balychev, Yu.M.; Tkachenko, F.K.

1983-01-01

Phase transformations proceeding under Fe-Mn alloy heating are studied and the effect of previous working conditions, particularly, cooling rate on these transformations is investigated. Investigations have been conducted on pure Fe-Mn alloys with 2-15% Mn. Phase transformations are shown to proceed according to α → #betta# and epsilon → #betta# reaction in Fe-Mn alloys containing 2-15% Mn under heating. Cooling rate in the range of approximately 5-1000 deg/min in preliminary working essentially affects phase transformations under subsequent heating

Red list of the ichthyofauna of the Czech Republic: development and present status

Czech Academy of Sciences Publication Activity Database

Lusk, Stanislav; Hanel, L.; Lusková, Věra

2004-01-01

Roč. 53, č. 2 (2004), s. 215-226 ISSN 0139-7893 R&D Projects: GA AV ČR IAA6093105; GA AV ČR IAA6045005; GA AV ČR IBS6093007; GA AV ČR IBS5045111; GA ČR GA206/00/0668; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : biodiversity * endangered species Subject RIV: EG - Zoology Impact factor: 0.536, year: 2004 http://www.ivb.cz/folia/53/2/215-226.pdf

ORF Alignment: NC_004606 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 215 ... Query: 19 ... SQLAYADENLKDLKRSLRFAYNITPCDYENVEIAFVTTNSIHINTKQKRSECILYVDSIV 78 ... ... ... SQLAYADENLKDLKRSLRFAYNITPCDYENVEIAFVTTNSIHINTKQKRSECILYVDSIV Sbjct: 1 ... SQLAYADENLKDLKRSLRFAYNITPCDYENVEIAFVTTNSIHINTKQKRSECI

Pulsed Electromagnetic Field Regulates MicroRNA 21 Expression to Activate TGF-β Signaling in Human Bone Marrow Stromal Cells to Enhance Osteoblast Differentiation

Directory of Open Access Journals (Sweden)

Nagarajan Selvamurugan

2017-01-01

Full Text Available Pulsed electromagnetic fields (PEMFs have been documented to promote bone fracture healing in nonunions and increase lumbar spinal fusion rates. However, the molecular mechanisms by which PEMF stimulates differentiation of human bone marrow stromal cells (hBMSCs into osteoblasts are not well understood. In this study the PEMF effects on hBMSCs were studied by microarray analysis. PEMF stimulation of hBMSCs’ cell numbers mainly affected genes of cell cycle regulation, cell structure, and growth receptors or kinase pathways. In the differentiation and mineralization stages, PEMF regulated preosteoblast gene expression and notably, the transforming growth factor-beta (TGF-β signaling pathway and microRNA 21 (miR21 were most highly regulated. PEMF stimulated activation of Smad2 and miR21-5p expression in differentiated osteoblasts, and TGF-β signaling was essential for PEMF stimulation of alkaline phosphatase mRNA expression. Smad7, an antagonist of the TGF-β signaling pathway, was found to be miR21-5p’s putative target gene and PEMF caused a decrease in Smad7 expression. Expression of Runx2 was increased by PEMF treatment and the miR21-5p inhibitor prevented the PEMF stimulation of Runx2 expression in differentiating cells. Thus, PEMF could mediate its effects on bone metabolism by activation of the TGF-β signaling pathway and stimulation of expression of miR21-5p in hBMSCs.

48 CFR 215.404-71-2 - Performance risk.

Science.gov (United States)

2010-10-01

... Technical (1) (2) N/A N/A 22 Management/Cost Control (1) (2) N/A N/A 23 Performance Risk (Composite) N/A (3... management and internal control systems using contracting office information and reviews made by field...—the technical uncertainties of performance. (2) Management/cost control—the degree of management...

43 CFR 46.215 - Categorical exclusions: Extraordinary circumstances.

Science.gov (United States)

2010-10-01

... populations (EO 12898). (k) Limit access to and ceremonial use of Indian sacred sites on Federal lands by Indian religious practitioners or significantly adversely affect the physical integrity of such sacred...

33 CFR 104.215 - Vessel Security Officer (VSO).

Science.gov (United States)

2010-07-01

...) Understanding of the importance of creating and maintaining safe working and living conditions for passengers... responsibility to preserve the marine environment; and (B) Basic working knowledge of pollution prevention... space numbering; and (B) Understanding of various vessel types; and working knowledge of nautical terms...

Dicty_cDB: SLJ215 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available .7_1.5_KB Zea mays genomic clone ZMMBMa0453M17, genomic survey sequence. 42 4.5 1 BF012148 |BF012148.1 us38h03.y1 Soares_NMEBA_branch...ial_arch Mus musculus cDNA clone IMAGE:3169397 5' similar to TR:Q9QYU2 Q9QYU2 ELONG

15 CFR 280.215 - Interlocutory review of rulings.

Science.gov (United States)

2010-01-01

... party, or on the administrative law judge's own initiative, the administrative law judge may certify to... administrative law judge determines that immediate review may hasten or facilitate the final disposition of the... replies, following which the Under Secretary will decide the matter promptly. ...

2 CFR 215.23 - Cost sharing or matching.

Science.gov (United States)

2010-01-01

... of paragraphs (c)(1) or (2) of this section. (1) The certified value of the remaining life of the property recorded in the recipient's accounting records at the time of donation. (2) The current fair... volunteer services shall be consistent with those paid for similar work in the recipient's organization. In...

25 CFR 215.16 - Requirements of corporate lessees.

Science.gov (United States)

2010-04-01

... assessment. (3) How much cash the company has in its treasury and elsewhere and from what source it was received. (4) What property, exclusive of cash, is owned by the company and its value. (5) What the total indebtedness of the company is, and, specifically, the nature of its obligations. (b) Subsequent applications...

34 CFR 682.215 - Income-based repayment plan.

Science.gov (United States)

2010-07-01

... for the year the borrower certifies family size. Support includes money, gifts, loans, housing, food... holder determines— (A) Each borrower's percentage of the couple's total eligible loan debt; (B) The...

48 CFR 2052.215-71 - Project officer authority.

Science.gov (United States)

2010-10-01

... directive whatever. (d) All technical directions must be issued in writing by the project officer or must be... advise the contractor in writing that, in the contracting officer's opinion, the technical direction is... subject to the technical direction of the NRC project officer. The term technical direction is defined to...

48 CFR 215.404-1 - Proposal analysis techniques.

Science.gov (United States)

2010-10-01

...; (iii) Significant high-dollar-value items. If there are no obvious high-dollar-value items, include an analysis of a random sample of items; and (iv) A random sample of the remaining low-dollar value items... reliability of its estimating and accounting systems. [63 FR 55040, Oct. 14, 1998, as amended at 71 FR 69494...

48 CFR 1352.215-74 - Best value evaluation.

Science.gov (United States)

2010-10-01

... integrated assessment of price/cost and non-price evaluation factors, to provide the best value to the... ensure that their initial proposal constitutes their best offer in terms of both price and the technical... at which an efficient competition can be conducted, the Contracting Officer may limit the number of...

24 CFR 572.215 - Implementation grants-eligible activities.

Science.gov (United States)

2010-04-01

...) Homebuyer outreach and selection. Reasonable and necessary costs of marketing the program to potential... related to implementing the affirmative fair housing marketing strategy required under § 572.110. (k... management, home maintenance, home repair, construction skills (especially where the eligible family will do...

29 CFR 1952.215 - Level of Federal enforcement.

Science.gov (United States)

2010-07-01

... OSHA authority to issue citations for violations of such standards under sections 5(a)(2) and 9 of the... proceedings in contested cases under section 10; to institute proceedings to correct imminent dangers under... accordance with section 18(e), final approval relinquishes Federal OSHA authority only with regard to...

The significance of Good Chair as part of children’s school and home environment in the preventive treatment of body statistics distortions

OpenAIRE

Mirosław Mrozkowiak; Hanna Żukowska

2015-01-01

Mrozkowiak Mirosław, Żukowska Hanna. Znaczenie Dobrego Krzesła, jako elementu szkolnego i domowego środowiska ucznia, w profilaktyce zaburzeń statyki postawy ciała = The significance of Good Chair as part of children’s school and home environment in the preventive treatment of body statistics distortions. Journal of Education, Health and Sport. 2015;5(7):179-215. ISSN 2391-8306. DOI 10.5281/zenodo.19832 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%287%29%3A179-215 https:...

ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available VGI 60 ... Query: 156 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 215 ... VGGFNKDRTPFLKYVDLLGVTYHASTM...ATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK Sbjct: 121 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 180 ...

Ocular pharmacokinetics of bimatoprost formulated in DuraSite compared to bimatoprost 0.03% ophthalmic solution in pigmented rabbit eyes

Directory of Open Access Journals (Sweden)

Shafiee A

2013-07-01

Full Text Available Afshin Shafiee,1 Lyle M Bowman,2 Eddie Hou,2 Kamran Hosseini1,3 1Preclinical, 2Development, 3Clinical, InSite Vision, Alameda, CA, USA Purpose: To compare the aqueous humor (AH and iris-ciliary body (ICB concentration of bimatoprost in rabbit eyes treated with ISV-215 (0.03% bimatoprost formulated in DuraSite with the marketed product bimatoprost 0.03% ophthalmic solution. Methods: The left eye of rabbits received a single topical instillation of either ISV-215 (n = 32 eyes or bimatoprost 0.03% (n = 32 eyes. At predetermined time points, levels of bimatoprost and bimatoprost acid in the AH and the ICB were quantified by HPLC-MS/MS. Results: Both bimatoprost and bimatoprost acid were detected in the AH and the ICB within 15 minutes of dosing. Bimatoprost acid concentrations in both compartments were markedly higher than bimatoprost. There was a statistically significant (P < 0.01 increase in the concentration of the prodrug in the AH and its acid form in the ICB in animals treated with ISV-215 compared to bimatoprost 0.03%. In the ISV-215-treated rabbit eyes, the highest concentrations of bimatoprost and bimatoprost acid were in the ICB and AH, respectively, while in the bimatoprost 0.03%-treated eyes, no differences in the drug content of the selected ocular tissues were observed. Conclusions: Bimatoprost 0.03% formulated in DuraSite has superior ocular distribution and area under the curve compared to bimatoprost 0.03% in rabbit eyes. This improvement in the pharmacokinetic parameters of ISV-215 may provide us with a better platform to optimize a bimatoprost formulation that offers the same degree of efficacy in lowering intraocular pressure and improved therapeutic index in glaucomatous patients by lessening the ocular side effects associated with long-term use of topical prostaglandin F2α analogs. Keywords: drug delivery, intraocular pressure, glaucoma, aqueous humor, prostaglandin (PGF2α analogs

Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

Energy Technology Data Exchange (ETDEWEB)

Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

2011-01-15

Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

International Nuclear Information System (INIS)

Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

1981-01-01

This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

Energy Technology Data Exchange (ETDEWEB)

Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

1981-01-01

This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

International Nuclear Information System (INIS)

Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir

2011-01-01

Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

Proceedings of transuranium elements

International Nuclear Information System (INIS)

Anon.

1992-01-01

The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

A study of the higher excitation levels of 11B via the 10B(n,n)10B and 10B(n,n')10B*(0.72, 1.74, 2.15, 3.59, 4.77 MeV) reactions

International Nuclear Information System (INIS)

Sadowski, E.T.

1988-11-01

As part of the study of the higher energy-level structure of 11 B, cross sections for elastic and inelastic scattering of neutrons from isotopically enriched 10 B samples have been measured for incident neutron energies from 3.03 MeV to 6.45 MeV in 250 keV increments and from 7.02 MeV to 12.01 MeV in 500 keV increments. Inelastic angular distributions for scattering to the states in parentheses in 10 B have been measured from the indicated energy up to 12.01 MeV; (0.718) from 3.02 MeV; (1.74) from 3.27 MeV; (2.15) from 3.77 MeV; (3.59) from 5.52 MeV; (4.77) from 7.02 MeV. The measurements at 3.02, 3.51, 4.02, and 4.51 MeV were done at nine laboratory angles from 20/degree/ to 158/degree/ in 17.5/degree/ increments with a sample that is isotopically 95.86% 10 B. All other distributions measured scattering at 11 laboratory angles from 18/degree/ to 158/degree/ in 15/degree/ increments from a sample that is isotopically 99.49% 10 B. The data are corrected for air scattering, sample attenuation, minor isotope impurity, multiple scattering, and elastic and inelastic scattering from the sample of the neutron source continuum and contaminants. An eight-channel, multilevel R-matrix analysis was performed on the data. Level energies, spins, and parities were deduced for twelve levels above 13 MeV excitation in 11 B. Only two definite and three tentative assignments for T = /1/2/ levels had been made previously above 13 MeV. The two definite levels were confirmed. Good agreement between the data and the R-matrix calculation in all analyzed channels was obtained for the proposed structure. 122 refs., 40 figs., 7 tabs

(1+1) resonant enhanced multiphoton ionization via the A 2Σ+ state of NO: Ionic rotational branching ratios and their intensity dependence

International Nuclear Information System (INIS)

Rudolph, H.; Dixit, S.N.; McKoy, V.; Huo, W.M.

1988-01-01

Recent high resolution photoelectron spectroscopic studies of the (1+1) resonant enhanced multiphoton ionization (REMPI) of NO via the 0--0 transition of the A--X band (γ band) have shown a pronounced ΔN = 0 signal (ΔNequivalentN/sub +/-N/sub i/) and smaller, but measurable, ΔN = +- 2 peaks. The authors [K. S. Viswanathan et al., J. Phys. Chem. 90, 5078 (1986)] assign the excitation to be via an R(21.5) line, with no further specification. We have performed ab initio calculations of the rotational branching ratios for the four possible ''R(21.5)'' transitions, namely, the rotationally ''clean'' R 21 and R 22 , and the ''mixed'' R 12 +Q 22 and R 11 +Q 21 branches. We find the mixed R 12 +Q 22 (21.5) branch to agree best with the observed photoelectron spectrum collected parallel to the polarization vector of the light. The discrepancy is larger for detection perpendicular to the polarization. To understand this difference, we have assessed the influence of laser intensity and polarization ''contamination'' on the branching ratios and photoelectron angular distributions

Prostaglandins, masculinization and its disorders: effects of fetal exposure of the rat to the cyclooxygenase inhibitor- indomethacin.

Directory of Open Access Journals (Sweden)

Afshan Dean

Full Text Available Recent studies have established that masculinization of the male reproductive tract is programmed by androgens in a critical fetal 'masculinization programming window' (MPW. What is peculiar to androgen action during this period is, however, unknown. Studies from 20 years ago in mice implicated prostaglandin (PG-mediation of androgen-induced masculinization, but this has never been followed up. We therefore investigated if PGs might mediate androgen effects in the MPW by exposing pregnant rats to indomethacin (which blocks PG production by inhibiting cyclooxygenase activity during this period and then examining if androgen production or action (masculinization was affected. Pregnant rats were treated with indomethacin (0.8 mg/kg/day; e15.5-e18.5 to encompass the MPW. Indomethacin exposure decreased fetal bodyweight (e21.5, testis weight (e21.5 and testicular PGE2 (e17.5, e21.5, but had no effect on intratesticular testosterone (ITT; e17.5 or anogenital index (AGI; e21.5. Postnatally, AGI, testis weight and blood testosterone were unaffected by indomethacin exposure and no cryptorchidism or hypospadias occurred. Penis length was normal in indomethacin-exposed animals at Pnd25 but was reduced by 26% (p<0.001 in adulthood, an effect that is unexplained. Our results demonstrate that indomethacin can effectively decrease intra-testicular PGE2 level. However, the resulting male phenotype does not support a role for PGs in mediating androgen-induced masculinization during the MPW in rats. The contrast with previous mouse studies is unexplained but may reflect a species difference.

Equivalence factors for standardizing catch data across multiple beach seine nets to account for differences in relative bias

Science.gov (United States)

Hallett, Chris S.; Hall, Norm G.

2012-06-01

We describe a method for modelling the relative effects of seine net biases and for deriving equivalence factors to standardize fish abundance data sets collected using multiple sampling gears. Nearshore fish communities were sampled from 10 sites in each of the basin and riverine portions of the Swan-Canning Estuary, Western Australia, using beach seine nets of three different lengths (21.5, 41.5 and 133 m). The resulting data were subjected to generalized linear modelling to derive equivalence factors relating catches from the two larger net types to those from the 21.5 m net. Equivalence factors were derived on the basis of functional habitat guilds of fish (small benthic, small pelagic, demersal, pelagic). Prior to standardization, catches from the 41.5 and 133 m nets consistently underestimated fish densities relative to those from the 21.5 m net. Following standardization, the degree to which fish densities were underestimated by the two larger nets was reduced and/or eliminated for most guilds, and particularly in the case of the 133 m net. For both of the larger nets, standardized estimates of total fish density across all species were far closer to those recorded using the 21.5 m seine, thus indicating that standardization of the fish abundance data had greatly reduced the overall effects of the biases introduced by the different net types. This approach could be applied to other systems and sampling methods, to facilitate more robust comparisons of fish abundances between studies with divergent sampling methodologies.

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available KLQDVTPFIDFGPRIGDIPDALLARIMACRPLVSLNRQEAEIAAERFAL 215 ... PCGELLVEWLEKLQDVTPFIDFGPRIGDIPDALLARIMACRPL...VSLNRQEAEIAAERFAL Sbjct: 138 PCGELLVEWLEKLQDVTPFIDFGPRIGDIPDALLARIMACRPLVSLNRQEAE...NRMAKEDLI Sbjct: 18 ... LPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNALPLGQGVWAEIIRNRMAKEDLI 77 ... Query: 156 PCGELLVEWLE

Airborne Systems Course Textbook. Electro-Optical Systems Test and Evaluation,

Science.gov (United States)

1981-06-01

by twice the angle between the reflecting faces. The porro - prism shown in Figure 2.2.3.1(c) is used to deflect the beam by 1800. Beam Retro-Reflection...Reflection of Electromagnetic Radiation at the Interface Between Two Media 2.13 2.2 Optics 2.15 2.2.1 The Lens 2.15 2.2.2 The Mirror 2.25 2.2.3 The Prism 2.30...2.5.2 The Optical Resonator 2.77 2.5.3 Laser Implementation 2.79 2.5.4 Laser Radiation Characteristics 2.81 2.6 Electro-Optical Sensors 2.83 2.6.1

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... associated protein [Photobacterium profundum] ... Length = 215 ... Query: 2 ... QVFKEDAVTWLSTLADASVDLIVTDPP...YESLEKHRKIGTTTRLKVSKSSSNQWFEIFPNN 61 ... QVFKEDAVTWLSTLADASVDLIVTDPP...YESLEKHRKIGTTTRLKVSKSSSNQWFEIFPNN Sbjct: 1 ... QVFKEDAVTWLSTLADASVDLIVTDPPYESLEKHRKIGTTTRLKVSKSSSNQWFEIF

Characterization of a novel domain ‘GATE’ in the ABC protein DrrA and its role in drug efflux by the DrrAB complex

International Nuclear Information System (INIS)

Zhang, Han; Rahman, Sadia; Li, Wen; Fu, Guoxing; Kaur, Parjit

2015-01-01

A novel domain, GATE (Glycine-loop And Transducer Element), is identified in the ABC protein DrrA. This domain shows sequence and structural conservation among close homologs of DrrA as well as distantly-related ABC proteins. Among the highly conserved residues in this domain are three glycines, G215, G221 and G231, of which G215 was found to be critical for stable expression of the DrrAB complex. Other conserved residues, including E201, G221, K227 and G231, were found to be critical for the catalytic and transport functions of the DrrAB transporter. Structural analysis of both the previously published crystal structure of the DrrA homolog MalK and the modeled structure of DrrA showed that G215 makes close contacts with residues in and around the Walker A motif, suggesting that these interactions may be critical for maintaining the integrity of the ATP binding pocket as well as the complex. It is also shown that G215A or K227R mutation diminishes some of the atomic interactions essential for ATP catalysis and overall transport function. Therefore, based on both the biochemical and structural analyses, it is proposed that the GATE domain, located outside of the previously identified ATP binding and hydrolysis motifs, is an additional element involved in ATP catalysis. - Highlights: • A novel domain ‘GATE’ is identified in the ABC protein DrrA. • GATE shows high sequence and structural conservation among diverse ABC proteins. • GATE is located outside of the previously studied ATP binding and hydrolysis motifs. • Conserved GATE residues are critical for stability of DrrAB and for ATP catalysis

Expeditious syntheses of stable and radioactive isotope-labeled anticonvulsant agent, JNJ-26990990, and its metabolites.

Science.gov (United States)

Lin, Ronghui; Weaner, Larry E; Hoerr, David C; Salter, Rhys; Gong, Yong

2013-01-01

Syntheses of stable and radioactive isotope-labeled anticonvulsant agent, JNJ-26990990, that is, N-(benzo[b]thien-3-ylmethyl)-sulfamide and its metabolites are described. [(13)C(15)N]Benzo[b]thiophene-3-carbonitrile was first prepared by coupling of 3-bromo-benzo[b]thiophene with [(13)C(15)N]-copper cyanide. The resultant [(13)C(15)N]benzo[b]thiophene-3-carbonitrile was reduced with lithium aluminum deuteride to give [(13)CD2(15)N]benzo[b]thiophen-3-yl-methylamine; which was then coupled with sulfamide to afford [(13)CD2(15)N]-N-(benzo[b]thien-3-ylmethyl)-sulfamide, the stable isotope-labeled compound with four stable isotope atoms. Direct oxidation of [(13)CD2(15)N]-N-(benzo[b]thien-3-ylmethyl)-sulfamide with hydrogen peroxide and peracetic acid gave the stable isotope-labeled sulfoxide and sulfone metabolites. On the other hand, radioactive (14)C-labeled N-(benzo[b]thien-3-ylmethyl)-sulfamide was prepared conveniently by sequential coupling of 3-bromo-benzo[b]thiophene with [(14)C]-copper cyanide, reduction of the carbonitrile to carboxaldehyde, and reductive amination with sulfamide. Copyright © 2013 John Wiley & Sons, Ltd.

Micromechanical Behavior of Single-Crystal Superalloy with Different Crystal Orientations by Microindentation

Directory of Open Access Journals (Sweden)

Jinghui Li

2015-01-01

Full Text Available In order to investigate the anisotropic micromechanical properties of single-crystal nickel-based superalloy DD99 of four crystallographic orientations, (001, (215, (405, and (605, microindentation test (MIT was conducted with different loads and loading velocities by a sharp Berkovich indenter. Some material parameters reflecting the micromechanical behavior of DD99, such as microhardness H, Young’s modulus E, yield stress σy, strain hardening component n, and tensile strength σb, can be obtained from load-displacement relations. H and E of four different crystal planes evidently decrease with the increase of h. The reduction of H is due to dislocation hardening while E is related to interplanar spacing and crystal variable. σy of (215 is the largest among four crystal planes, followed by (605, and (001 has the lowest value. n of (215 is the lowest, followed by (605, and that of (001 is the largest. Subsequently, a simplified elastic-plastic material model was employed for 3D microindentation simulation of DD99 with various crystal orientations. The simulation results agreed well with experimental, which confirmed the accuracy of the simplified material model.

Telomere dysfunction and cell survival: roles for distinctTIN2-containing complexes

Energy Technology Data Exchange (ETDEWEB)

Kim, Sahn-Ho; Davalos, Albert R.; Heo, Seok-Jin; Rodier, Francis; Beausejour, Christian; Kaminker, Patrick; Campisi, Judith

2006-11-07

Telomeres are maintained by three DNA binding proteins, TRF1, TRF2 and POT1, and several associated factors. One factor, TIN2, binds TRF1 and TRF2 directly and POT1 indirectly. These and two other proteins form a soluble complex that may be the core telomere-maintenance complex. It is not clear whether subcomplexes exist or function in vivo. Here, we provide evidence for two TIN2 subcomplexes with distinct functions in human cells. TIN2 ablation by RNA interference caused telomere uncapping and p53-independent cell death in all cells tested. However, we isolated two TIN2 complexes from cell lysates, each selectively sensitive to a TIN2 mutant (TIN2-13, TIN2-15C). In cells with wild-type p53 function, TIN2-15C was more potent than TIN2-13 in causing telomere uncapping and eventual growth arrest. In cells lacking p53 function, TIN215C more than TIN2-13 caused genomic instability and cell death. Thus, TIN2 subcomplexes likely have distinct functions in telomere maintenance, and may provide selective targets for eliminating cells with mutant p53.

Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

Directory of Open Access Journals (Sweden)

Behera B.R.

2015-01-01

Full Text Available In this talk results of the evaporation residue (ER cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr and 16,18O+198Pt (forming compound nuclei 214,216Rn systems measured at Hybrid Recoil mass Analyzer (HYRA spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC, New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer’s fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

Science.gov (United States)

Behera, B. R.

2015-01-01

In this talk results of the evaporation residue (ER) cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr) and 16,18O+198Pt (forming compound nuclei 214,216Rn) systems measured at Hybrid Recoil mass Analyzer (HYRA) spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC), New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer's fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

High rate of mutation K103N causing resistance to nevirapine in Indian children with acquired immunodeficiency syndrome

Directory of Open Access Journals (Sweden)

Sehgal S

2008-01-01

Full Text Available In north India the number of paediatric cases with acquired immunodeficiency syndrome (AIDS is on the rise. Most drug combinations used for treatment of AIDS incorporate nevirapine, resistance to which develops very fast if given singly or because of unplanned interruptions. This paper investigates presence of mutations at codon 103 and codon 215 of the HIV pol gene causing resistance to nevirapine and zidovudine (AZT respectively in 25 children with AIDS. Mutations T215Y and K103N were detected by a nested cum amplification refractory mutation system polymerase chain reaction (ARMS PCR and the results were confirmed by direct sequencing in five randomly selected cases. Nineteen patients had received nevirapine containing regimen and six were drug naive. Mutation K103N was observed in 56% (14/25 of the children while mutation T215Y was found in none. Two of the six drug naοve children also showed K103N mutation. Thus, Indian children drug naοve or treated with nevirapine containing regimens show a high rate of mutation conferring resistance to nevirapine which calls for a judicious use of nevirapine both in antenatal and postnatal setting.

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... palustris CGA009] ... Length = 157 ... Query: 95 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDA...KIETVLSDNGREFCGRP 154 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETV...LSDNGREFCGRP Sbjct: 1 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETVLSDNGREFCGRP 60 ... Query: 215 LDDYLVGY

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... parahaemolyticus RIMD 2210633] ... Length = 286 ... Query: 215 ETTRVLQRVEADHTRLDLFVIDDARKLPLGRPWLTLL...FDTHTKSVVGFYLGFEPPGYLSV 274 ... ETTRVLQRVEADHTRLDLFVIDDARKLPLGRPWLTLLFDTHT...KSVVGFYLGFEPPGYLSV Sbjct: 1 ... ETTRVLQRVEADHTRLDLFVIDDARKLPLGRPWLTLLFDTHTKSVVGFYLGFEPPGYLSV 60 ... Query: 335 NP

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... pyogenes MGAS8232] ... Length = 215 ... Query: 25 ... SQLAYADENLKDLKRSLRFVYNITPCDYENIEIAFVTTNSIHINTKQKRSECI...LYVDSIV 84 ... SQLAYADENLKDLKRSLRFVYNITPCDYENIEIAFVTTNSIHINTKQKRSECILY...VDSIV Sbjct: 1 ... SQLAYADENLKDLKRSLRFVYNITPCDYENIEIAFVTTNSIHINTKQKRSECILYVDSIV 60 ... Query: 145 LPSEAVRIKKKQFTL

Ultraviolet absorption spectra and kinetics of CH3S and CH2SH radicals

DEFF Research Database (Denmark)

Anastasi, C.; Broomfield, M.; Nielsen, O.J.

1991-01-01

The ultraviolet absorption spectra of CH3S and CH2SH radicals have been measured between 215 and 380 nm using the pulse-radiolysis/kinetic-absorption method. One absorption band between 250 and 300 nm and one around 215 nm have been tentatively assigned to the CH2SH and CH3S radicals, respectively....... This spectrum has been used to measure the self-reaction rates of these radicals. Rate constants of 4 x 10(-11) and 7 x 10(-11) cm3 molecule-1 s-1 have been measured at 298 K for CH3S and CH2SH recombination, respectively. The possible reaction pathways are discussed....

Cross sections and thermonuclear reaction rates of proton-induced reactions on 37Cl

International Nuclear Information System (INIS)

Weber, R.O.; Tingwell, C.I.W.; Mitchell, L.W.; Sevior, M.E.; Sargood, D.G.

1984-01-01

The yields of γ-rays from the reactions of 37 Cl(p,γ) 38 Ar and 37 Cl(p,αγ) 34 S have been measured as a of bombarding energy over the ranges 0.65 - 2.15 MeV and 1.25 -2.15 MeV respectively, and the yield of neutrons from 37 Cl(p,n) 37 Ar from threshold to 2.50 MeV. The results are compared with global statistical-model calculations and thermonuclear reaction rates are calculated for the temperature range 5 x 10 8 - 10 10 K. The significance of these thermonuclear reaction rates for stellar nucleosynthesis calculations is discussed

50 CFR 600.215 - Council nomination and appointment procedures.

Science.gov (United States)

2010-10-01

...: (i) Commercial fishing or the processing or marketing of fish, fish products, or fishing equipment.... This includes experience serving as a member of a Council, Advisory Panel, Scientific and Statistical... pertinent biographical data of individuals who would meet the requirements of this section that were not met...

36 CFR 215.5 - Legal notice of proposed actions.

Science.gov (United States)

2010-07-01

... emergency situation determination or it has been determined that an emergency situation exists for the..., title, telephone number, and addresses (street, postal, facsimile, and e-mail) to whom comments are to...

48 CFR 215.404-71-5 - Cost efficiency factor.

Science.gov (United States)

2010-10-01

..., outsourcing of functions such as information technology). Metrics developed by the contractor such as fully... contracting officer shall consider the impact that quantity differences, learning, changes in scope, and...

7 CFR 1260.215 - Patents, copyrights, inventions and publications.

Science.gov (United States)

2010-01-01

...) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF..., residual payments, or other income from the rental, sale, leasing, franchising, or other uses of such...

48 CFR 252.215-7002 - Cost estimating system requirements.

Science.gov (United States)

2010-10-01

... contract awards. Estimating system includes the Contractor's— (1) Organizational structure; (2) Established... (e) of this clause apply if the Contractor is a large business and either— (1) In its fiscal year...

32 CFR 22.215 - Distinguishing grants and cooperative agreements.

Science.gov (United States)

2010-07-01

... GRANT AND AGREEMENT REGULATIONS DoD GRANTS AND AGREEMENTS-AWARD AND ADMINISTRATION Selecting the... than an absolute, concept, and that it is primarily based on programmatic factors, rather than requirements for grant or cooperative agreement award or administration. For example, substantial involvement...

7 CFR 800.215 - Activities that shall be supervised.

Science.gov (United States)

2010-01-01

... the use of prototype equipment for use under the Act. ... of prototype equipment activities. Prototype or proposed equipment is tested to determine whether the equipment will improve the performance of activities under the Act. Prototype equipment-testing activities...

18 CFR 2.15 - Specified reasonable rate of return.

Science.gov (United States)

2010-04-01

... average cost of long-term debt and preferred stock for the year, and the cost of common equity shall be the interest rate on 10-year government bonds (reported as the Treasury Department's 10-year constant...

Dick Lord Covos Books: Johannesburg, 1998 215 pagcs illustrated ...

African Journals Online (AJOL)

the adventures of mountain climbing and skiing; from the icy Antarctic to the scotching heat of Namibia and ... that few have ever heard of; from the joy of another life saved to the sadness of one that could not be saved. ... read it only because of the sheer human ingenuity that Lord so eloquently conveys. Despite Lord's ...

12 CFR 347.215 - Exemptions from deposit insurance requirement.

Science.gov (United States)

2010-01-01

... exemption would give the foreign bank an unfair competitive advantage over United States banking... (including any affiliate thereof) has extended credit or provided other nondeposit banking services within the past twelve months or has entered into a written agreement to provide such services within the...

48 CFR 2052.215-75 - Proposal presentation and format.

Science.gov (United States)

2010-10-01

... contracting officer does not grant the offeror an exception from the requirement to submit cost or pricing... offeror's understanding of the scope of work may be evaluated. (2) The offeror shall submit in the written... information as set forth below to permit the Government to make a thorough evaluation and a sound...

48 CFR 215.404-71-4 - Facilities capital employed.

Science.gov (United States)

2010-10-01

... encouraging and rewarding capital investment in facilities that benefit DoD. It recognizes both the facilities... anticipated industrial base enhancing benefits resulting from the facilities capital investment, including— (A... investment recovery, such as termination protection clauses and capital investment indemnification. (2) Above...

All projects related to | Page 215 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Topic: RESEARCH CENTRES, POLITICAL CRISIS, Democracy, GOVERNMENT PROGRAMMES, EDUCATIONAL INSTITUTIONS, EDUCATIONAL REFORM, WEST AFRICA. Region: Ivory Coast, North of Sahara, South of Sahara. Total Funding: CA$ 75,000.00. Shaping Public Health Education, Research, and Policy in the ...

48 CFR 1552.215-74 - Advanced understanding-uncompensated time.

Science.gov (United States)

2010-10-01

... applicable direct labor costs (including applicable indirect costs). (c) Within three weeks after the end of... policy, entitled, ________. (b) Recognizing that the probable cost to the Government for the labor... adjusted amounts shall not be allowable as a direct or indirect cost to this or any other Government...

Cancer therapy with alpha-emitters labeled peptides.

Science.gov (United States)

Dadachova, Ekaterina

2010-05-01

Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.

Selective targeting of tumour neovasculature by a radiohalogenated human antibody fragment specific for the ED-B domain of fibronectin

International Nuclear Information System (INIS)

Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.

2001-01-01

Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)

DNA sequence polymorphisms in a panel of eight candidate bovine imprinted genes and their association with performance traits in Irish Holstein-Friesian cattle

Directory of Open Access Journals (Sweden)

Mullen Michael P

2010-10-01

Full Text Available Abstract Background Studies in mice and humans have shown that imprinted genes, whereby expression from one of the two parentally inherited alleles is attenuated or completely silenced, have a major effect on mammalian growth, metabolism and physiology. More recently, investigations in livestock species indicate that genes subject to this type of epigenetic regulation contribute to, or are associated with, several performance traits, most notably muscle mass and fat deposition. In the present study, a candidate gene approach was adopted to assess 17 validated single nucleotide polymorphisms (SNPs and their association with a range of performance traits in 848 progeny-tested Irish Holstein-Friesian artificial insemination sires. These SNPs are located proximal to, or within, the bovine orthologs of eight genes (CALCR, GRB10, PEG3, PHLDA2, RASGRF1, TSPAN32, ZIM2 and ZNF215 that have been shown to be imprinted in cattle or in at least one other mammalian species (i.e. human/mouse/pig/sheep. Results Heterozygosities for all SNPs analysed ranged from 0.09 to 0.46 and significant deviations from Hardy-Weinberg proportions (P ≤ 0.01 were observed at four loci. Phenotypic associations (P ≤ 0.05 were observed between nine SNPs proximal to, or within, six of the eight analysed genes and a number of performance traits evaluated, including milk protein percentage, somatic cell count, culled cow and progeny carcass weight, angularity, body conditioning score, progeny carcass conformation, body depth, rump angle, rump width, animal stature, calving difficulty, gestation length and calf perinatal mortality. Notably, SNPs within the imprinted paternally expressed gene 3 (PEG3 gene cluster were associated (P ≤ 0.05 with calving, calf performance and fertility traits, while a single SNP in the zinc finger protein 215 gene (ZNF215 was associated with milk protein percentage (P ≤ 0.05, progeny carcass weight (P ≤ 0.05, culled cow carcass weight (P ≤ 0

DNA sequence polymorphisms in a panel of eight candidate bovine imprinted genes and their association with performance traits in Irish Holstein-Friesian cattle

Science.gov (United States)

2010-01-01

Background Studies in mice and humans have shown that imprinted genes, whereby expression from one of the two parentally inherited alleles is attenuated or completely silenced, have a major effect on mammalian growth, metabolism and physiology. More recently, investigations in livestock species indicate that genes subject to this type of epigenetic regulation contribute to, or are associated with, several performance traits, most notably muscle mass and fat deposition. In the present study, a candidate gene approach was adopted to assess 17 validated single nucleotide polymorphisms (SNPs) and their association with a range of performance traits in 848 progeny-tested Irish Holstein-Friesian artificial insemination sires. These SNPs are located proximal to, or within, the bovine orthologs of eight genes (CALCR, GRB10, PEG3, PHLDA2, RASGRF1, TSPAN32, ZIM2 and ZNF215) that have been shown to be imprinted in cattle or in at least one other mammalian species (i.e. human/mouse/pig/sheep). Results Heterozygosities for all SNPs analysed ranged from 0.09 to 0.46 and significant deviations from Hardy-Weinberg proportions (P ≤ 0.01) were observed at four loci. Phenotypic associations (P ≤ 0.05) were observed between nine SNPs proximal to, or within, six of the eight analysed genes and a number of performance traits evaluated, including milk protein percentage, somatic cell count, culled cow and progeny carcass weight, angularity, body conditioning score, progeny carcass conformation, body depth, rump angle, rump width, animal stature, calving difficulty, gestation length and calf perinatal mortality. Notably, SNPs within the imprinted paternally expressed gene 3 (PEG3) gene cluster were associated (P ≤ 0.05) with calving, calf performance and fertility traits, while a single SNP in the zinc finger protein 215 gene (ZNF215) was associated with milk protein percentage (P ≤ 0.05), progeny carcass weight (P ≤ 0.05), culled cow carcass weight (P ≤ 0.01), angularity (P �

Optimization of Parameters for Semiempirical Methods 2. Applications

Science.gov (United States)

1989-01-01

173.0 184.6 11.6 15.5 3.4 i CsH, 2-Ethylisopropyl (+) 156.0 171.9 15.9 25.6 10.5 i C5111 Neopentyl (+) 188.0 171.8 -16.2 -6.4 -21.5 t CH, 2...Dimethyl peroxide -30.1 -34.1 -4.0 1.8 3.1 f C2H 60 2 Ethylene glycol ..................... -93.9 -95.2 -1.3 -12.2 -13.6 f C30 2 Carbon suboxide...fluoridate -215.1 -222.9 -7.8 53.8 78.4 g C&H14PO2F Neopentyl methylphosphono- fluoridate .......................... -224.2 -226.6 -2.4 70.4 87.8 g POF2 POF

$\\beta$-decay study of neutron-rich Tl and Pb isotopes

CERN Multimedia

It is proposed to study the structure of neutron-rich nuclei beyond $^{208}$Pb. The one-proton hole $^{211-215}$Tl and the semi magic $^{213}$Pb will be produced and studied via nuclear and atomic spectroscopy searching for long-lived isomers and investigating the $\\beta$-delayed $\\gamma$- emission to build level schemes. Information on the single particle structure in $^{211-215}$Pb, especially the position of the g$_{9/2}$ and i$_{11/2}$ neutron orbitals, will be extracted along with lifetimes. The $\\beta$-decay will be complemented with the higher spin selectivity that can be obtained by resonant laser ionization to single-out the decay properties of long-living isomers in $^{211,213}$Tl and $^{213}$Pb.

Review of forensically important entomological specimens collected from human cadavers in Malaysia (2005-2010).

Science.gov (United States)

Kavitha, Rajagopal; Nazni, Wasi Ahmad; Tan, Tian Chye; Lee, Han Lim; Azirun, Mohd Sofian

2013-07-01

Forensic entomological specimens collected from human decedents during crime scene investigations in Malaysia in the past 6 years (2005-2010) are reviewed. A total of 80 cases were recorded and 93 specimens were collected. From these specimens, 10 species of cyclorrphagic flies were identified, consisting of Chrysomya rufifacies (Macquart) -38 specimens (40.86%), Chrysomya megacephala (Fabricius) -36 specimens (38.70%), Chrysomya villeneuvi (Patton) -2 specimens (2.15%), Chrysomya nigripes (Aubertin) -2 specimens (2.15%), Chrysomya pinguis (Walker) -1 specimen (1.08%), Hermetia illucens (Linnaeus) -1 specimen (1.08%), Hemipyrellia liguriens (Wiedemann) -5 specimens (5.37%), Synthesiomyia nudiseta (Wulp) -1 specimen (1.08%), Megaselia scalaris (Loew)-1 specimen (1.08%) and Sarcophaga ruficornis (Fabricius) -4 specimens (4.30%). In two specimens (2.15%), the maggots were not identifiable. Ch. megacephala and Ch. rufifacies were the commonest species found in human decedents from three different ecological habitats. S. nudiseta is an uncommon species found only on human cadavers from indoors. A total of 75 cases (93.75%) had a single fly infestation and 5 cases (6.25%) had double fly infestation. In conclusion, although large numbers of fly species were found on human decedents, the predominant species are still those of Chrysomya. Copyright © 2013 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.

Hypomethylation of miR-142 promoter and upregulation of microRNAs that target the oxytocin receptor gene in the autism prefrontal cortex.

Science.gov (United States)

Mor, Michal; Nardone, Stefano; Sams, Dev Sharan; Elliott, Evan

2015-01-01

MicroRNAs are small RNA molecules that regulate the translation of protein from gene transcripts and are a powerful mechanism to regulate gene networks. Next-generation sequencing technologies have produced important insights into gene transcription changes that occur in the brain of individuals diagnosed with autism spectrum disorder (asd). However, these technologies have not yet been employed to uncover changes in microRNAs in the brain of individuals diagnosed with asd. Small RNA next-generation sequencing was performed on RNA extracted from 12 human autism brain samples and 12 controls. Real-time PCR was used to validate a sample of the differentially expressed microRNAs, and bioinformatic analysis determined common pathways of gene targets. MicroRNA expression data was correlated to genome-wide DNA methylation data to determine if there is epigenetic regulation of dysregulated microRNAs in the autism brain. Luciferase assays, real-time PCR, and Western blot analysis were used to determine how dysregulated microRNAs may regulate the expression and translation of an autism-related gene transcript. We determined that miR-142-5p, miR-142-3p, miR-451a, miR-144-3p, and miR-21-5p are overexpressed in the asd brain. Furthermore, the promoter region of the miR-142 gene is hypomethylated in the same brain samples, suggesting that epigenetics plays a role in dysregulation of microRNAs in the brain. Bioinformatic analysis revealed that these microRNAs target genes that are involved in synaptic function. Further bioinformatic analysis, coupled with in vitro luciferase assays, determined that miR-451a and miR-21-5p can target the oxytocin receptor (OXTR) gene. OXTR gene expression is increased in these same brain samples, and there is a positive correlation between miR-21-5p and OXTR expression. However, miR-21-5p expression negatively correlates to production of OXTR protein from the OXTR transcript. Therefore, we suggest that miR-21-5p may attenuate OXTR expression in

Sideropenia sem anemia em doadores de sangue do Hemocentro do Amazonas - Hemoam Sideropenia without anemia in blood donors of the Amazon Blood Bank - Hemoam

Directory of Open Access Journals (Sweden)

Leny N. M. Passos

2005-03-01

Full Text Available Uma doaç��o de aproximadamente 475mL de sangue depleta em média 242 ± 17 mg de ferro do doador, o que pode ter conseqüências variáveis em suas reservas e na sua saúde. Tivemos por objetivo avaliar se doadores de sangue do Hemocentro do Amazonas - Hemoam desenvolvem sideropenia sem anemia após doações consecutivas. A ferritina sérica foi medida em 528 doadores de sangue, do sexo masculino, com idade entre 18 a 61 anos, divididos em 313 doadores de repetição, com 4 ou mais doações regulares, e 215 primodoadores, que compareceram ao Hemocentro do Amazonas no período de setembro de 2001 a junho de 2002. Depleção do depósito de ferro, definida por níveis de ferritina menores de 20 ng/L, foi encontrada em 7,4% [16/215] dos primodoadores e em 48,6% [152/313] dos doadores de repetição. Utilizando-se de um critério mais rigoroso, como valores de ferritina A blood donation of 475 mL could deplete 242 ± 17 mg of iron from blood donors. The objective of this report is to evaluate if blood donors could develop sideropenia without anemia after several donations. Serum levels of ferritin were measured in 528 male blood donors, with ages ranging from 18 to 61 years old. A total of 313 of them had made 4 or more donations and 215 of them were first time donors. They donated blood in the Hemocentro do Amazonas - Hemoam, from September 2001 to June 2002. Deletion of iron stores characterized by serum ferritin levels of less than 20 ng/L was found in 7.4% (16/215 of first time donors, and in 48.6% (152/313 of multiple donors. With more stringent criteria of ferritin values less than 12 ng/L, 3.7% (8/215 of first-time donors as opposed to 24.9% (78/313 of multiple donors showed severe depletions. We concluded that multiple donors, after more than 5 repeated donations, are at risk of depleted iron and ferritin levels. It is important to implant protocols of iron supplementation for these donors to avoid damage to their health and

Intraspecific chemical communication in microalgae

Czech Academy of Sciences Publication Activity Database

Venuleo, M.; Raven, J. A.; Giordano, Mario

2017-01-01

Roč. 215, č. 2 (2017), s. 516-530 ISSN 1469-8137 Institutional support: RVO:61388971 Keywords : evolution * infochemicals * intraspecific communication Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology

75 FR 17701 - Environmental Management Site-Specific Advisory Board Chairs

Science.gov (United States)

2010-04-07

.... ADDRESSES: DoubleTree Hotel, 215 South Illinois Avenue, Oak Ridge, Tennessee 37830, Phone: (865) 481-2468...-Specific Issues, EM SSAB Accomplishments, and Major Board Activities [cir] EM Headquarters Budget...

75 FR 25238 - Environmental Impacts Statements; Notice of Availability

Science.gov (United States)

2010-05-07

... Ends: 06/28/2010, Contact: Thomas H. Stephan, 215-897-4916. EIS No. 20100163, Final EIS, BOP, 00... EIS, BLM, 00, Southern California Edison's Eldorado-Ivanpah Transmission Line Project, Construction...

[Migrant workers. The critical aspects of integration].

Science.gov (United States)

Berra, Alessandro

2011-01-01

The integration of migrant poplulations with the indigeneous population is regulated by the Italian Decree, D.Lgs 9/7/2003 n. 215 in enforcement of the directive 2000/43/EC implementing the principle of equal treatment between persons irrespective of racial or ethnic origin. The Italian decree, D.Lgs 215/2003, at present in force, according to regulation stipulated as to the equal treatment of diverse cohabiting populations, explicitly forbids any form of discrimination whatsoever, be it direct or indirect. A first description of today's migrant panorama is offered by the Caritas Migrantes and the CNEL (Italian National Council of the Economy of Labour). The most critical aspects on the integration of migrants are described and discussed in the text.

76 FR 58303 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses Involving No...

Science.gov (United States)

2011-09-20

... description of amendment: The amendment revised language in Technical Specification (TS) 2.10.2, ``Reactivity Control Systems and Core Physics Parameters Limits,'' and revised table items related to TS 2.15...

Comparison of the effectiveness of polymer gel dosimeters (Magic ...

African Journals Online (AJOL)

demonstrate that the gel dosimeters are best suited for nuclear medicine. Keywords: Magic ... International Pharmaceutical Abstract, Chemical Abstracts, Embase, Index Copernicus, EBSCO, African. Index Medicus .... Reaction rate. 2.15E-6.

Classification of some Linseed (Linum usitatissimum L. Genotypes for Salinity Tolerance using Germination, Seedling Growth, and Ion Content Clasificación de algunos Genotipos de Linaza (Linum usitatissimum L. para Tolerancia a Salinidad usando Germinación, Crecimiento de Plántulas y Contenido de Iones

Directory of Open Access Journals (Sweden)

Mehmet Demir Kaya

2012-03-01

Full Text Available Salinity reduces germination, delays emergence, and inhibits seedling growth of linseed (Linum usitatissimum L. while some varieties are less affected by salinity than others. In this study, we aimed to determine the effects of NaCl levels (0, 5, 10, 20 and 30 dS m-1 on germination and seedling growth of 10 linseed genotypes (lines 87, 89, 104, 114, 193, 194, 209, 215, C-90 and cv. San-85 and to classify the genotypes for salinity tolerance using germination and seedling characteristics. Germination percentage, mean germination time, root and shoot length, seedling fresh and dry weight, Na+ content and Na:K ratio of seedlings were investigated. Classification of linseed genotypes for salinity tolerance was done according to (i combination of Principal Component and Cluster Analysis, (ii Na+ content, and (iii Na:K ratio of seedling. The results showed that the highest values were obtained from lines 193, 194 and 215 except for mean germination time, while germination percentage was not adversely influenced by NaCl up to 20 dS m-1. Seedling growth was inhibited at 20 dS m-1 although genotypes exhibited varying responses. Na+ content was enhanced by NaCl, but seedling from lines 194, 193 and 215 had the lowest Na+ content at all NaCl levels. Cluster analysis performed by multiple parameters revealed three groups for salinity tolerance. It was concluded that lines 193, 194, and 215 were tolerant, lines 87, 209, C-90, and cv. Sari-85 were moderately tolerant and lines 89, 104, and 114 were salt-sensitive genotypes. Classification of genotypes for Na+ content and Na:K ratio showed similar result for tolerant genotypes while different genotypes for sensitive group were detected.La salinidad reduce germinación, retrasa emergencia, e inhibe el crecimiento de plántulas de lino (Linum usitatissimum L. mientras algunas variedades son menos afectadas por la salinidad que otras. El objetivo de este estudio fue determinar los efectos de niveles de NaCl (0, 5

Melhoramento do trigo: XVII. comportamento de linhagens de origem mexicana no estado de São Paulo Wheat breeding: XVII. evaluation of mexican inbred lines for the State of São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Carlos Eduardo de Oliveira Camargo

1988-01-01

Full Text Available Em ensaios instalados nas Estações Experimentais de Monte Alegre do Sul e Tatuí e no município de Maracaí, de 1984 a 1986, estudaram-se 23 linhagens de trigo introduzidas do Centro Internacional de Melhoramento de Milho e Trigo (CIMMYT, México, juntamente com os cultivares IAC-24 e Anahuac. Analisaram-se os seguintes parâmetros: rendimento de grãos, altura de plantas, ciclo em dias da emergência ao florescimento e da emergência à maturação, porcentagem de plantas acamadas, comprimento da espiga, número de grãos por espiga e por espigueta e de espiguetas por espiga, resistência às ferrugens do colmo e da folha em condições de campo e de casa de vegetação, tolerância à toxicidade de Al3+ empregando-se soluções nutritivas, em laboratório. As linhas mexicanas, nominadas como IAC-215, IAC-216, IAC-217 e IAC-219, destacaram-se quanto à produção de grãos, porém não diferiram do cultivar controle IAC-24. As linhagens Festiguay-Tecolote 363.30.6.1 x Ciguena e [4777² x (Frontana/Kenya 58//Newthatch] Gabo/Pavon-76 mostraram-se resistentes às nove raças do agente causal da ferrugem-do-colmo e às seis raças do agente causal da ferrugem-da-folha. Os resultados evidenciaram que são fontes genéticas de grande valor para o programa de melhoramento do trigo no Instituto Agronômico os genótipos seguintes: IAC-215, IAC-216, Yaco"S", IAC-218, Dougga-Bluejay (T-4, Buckbuck"S" - Bulbul"S", com ciclo precoce; IAC-215, Yaco"S" e Jupateco 73-Bluejay, com porte baixo, Bonanza-Yecora F-70/Florence 35.70, com espigas compridas e maior número de espiguetas e de grãos por espiga; Jupateco 73-Bluejay, com grande fertilidade de espigas; [(IAS-58-IAS-55 x Alondra"S"/IAC-5 Alondra"S" - IAS-58 103A x Alondra"S"] e IAC-215, IAC-216, IAC-219 e IAC-24, com tolerância a 10 mg/litro de Al3+.Twenty three Mexican inbred lines and the cultivars IAC-24 and Anahuac were evaluated in field experiments carried out at Monte Alegre do Sul and Tatu

USA terrorismivastane seadus ja jälitustegevuse erivolitused / Piibe Jõgi

Index Scriptorium Estoniae

Jõgi, Piibe, 1969-

2007-01-01

24. okt. 2001 Ameerika Ühendriikides vastu võetud terrorismivastase seaduse (nn USA Patriot Act) paragrahvist 215, mis käsitleb andmete salajast kogumist ja paragrahvist 213 salajaste läbiotsimisite kohta

Pine Bluff Arsenal Fish Survey

National Research Council Canada - National Science Library

Peacock, Lance

2000-01-01

Arkansas has a diverse ichthyofauna of over 215 species of fishes distributed in sixty-three genera and twenty-seven families which occupy a myriad of different aquatic habitats within its poltical boundaries...

Teachers’ individual action theories about competence-based education: the value of the cognitive apprenticeship model

NARCIS (Netherlands)

Seezink, Audrey; Poell, Rob; Kirschner, Paul A.

2009-01-01

Seezink, A., Poell, R. F., & Kirschner, P. A. (2009). Teachers' individual action theories about competence-based education: The value of the cognitive apprenticeship model. Journal of Vocational Education & Training, 61, 203-215.

Itolizumab – a humanized anti-CD6 monoclonal antibody with better side effects profile for the treatment of psoriasis [Corrigendum

Directory of Open Access Journals (Sweden)

Menon R

2015-06-01

Full Text Available Menon R, David BG. Clinical, Cosmetic and Investigational Dermatology. 2015;8:215–22.On page 215, please note correspondence should have been listed as:   Roshni Menon, D II/17,JIPMER Campus, Dhanvanthri Nagar,Pondicherry, India 605006Tel +91 944 320 8140Email roshnijagdish@gmail.com.On page 215, the first sentence of the Introduction was “Psoriasis is a chronic inflammatory disease of the skin characterized by exacerbations and remissions affecting 1%–3% of the world’s population, and approximately 20% of patients have moderate to severe disease.1,2” however should have been “Psoriasis is a chronic inflammatory disease of the skin characterized by exacerbations and remissions affecting 1%–3% of the world’s population. Approximately 20% of patients have moderate to severe disease.1,2”On page 217, 219, and 221 the running header was “Itolizumab – aCD6 monoclonal antibody for the treatment of psoriasis” however should have been “Itolizumab – a humanized anti CD6 monoclonal antibody for the treatment of psoriasis”.On page 218, Table 1, the second column heading was listed as “Anand et al25 n=40 (moderate–severe psoriasis” however should have been “Anand et al25 n=40/32 weeks (moderate–severe psoriasis”.Read the original article 

ACCURATE OH MASER POSITIONS FROM THE SPLASH PILOT REGION

Energy Technology Data Exchange (ETDEWEB)

Qiao, Hai-Hua; Shen, Zhi-Qiang [Shanghai Astronomical Observatory, Chinese Academy of Sciences, 80 Nandan Road, Shanghai, 200030 (China); Walsh, Andrew J.; Jordan, Christopher H. [International Centre for Radio Astronomy Research, Curtin University, GPO Box U1987, Perth WA 6845 (Australia); Green, James A. [CSIRO Astronomy and Space Science, Australia Telescope National Facility, PO Box 76, Epping, NSW 2121 (Australia); Breen, Shari L. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Dawson, J. R. [Department of Physics and Astronomy and MQ Research Centre in Astronomy, Astrophysics and Astrophotonics, Macquarie University, NSW 2109 (Australia); Ellingsen, Simon P. [School of Physical Sciences, Private Bag 37,University of Tasmania, Hobart 7001, TAS (Australia); Gómez, José F. [Instituto de Astrofísica de Andalucía, CSIC, Glorieta de la Astronomía s/n, E-18008, Granada (Spain); Lowe, Vicki; Jones, Paul A., E-mail: qiaohh@shao.ac.cn [Department of Astrophysics and Optic, School of Physics, University of New South Wales, Sydney, NSW 2052 (Australia)

2016-12-01

We report on high spatial resolution observations, using the Australia Telescope Compact Array (ATCA), of ground-state OH masers. These observations were carried out toward 196 pointing centers previously identified in the Southern Parkes Large-Area Survey in Hydroxyl (SPLASH) pilot region, between Galactic longitudes of 334° and 344° and Galactic latitudes of −2° and +2°. Supplementing our data with data from the MAGMO (Mapping the Galactic Magnetic field through OH masers) survey, we find maser emission toward 175 of the 196 target fields. We conclude that about half of the 21 nondetections were due to intrinsic variability. Due to the superior sensitivity of the followup ATCA observations, and the ability to resolve nearby sources into separate sites, we have identified 215 OH maser sites toward the 175 fields with detections. Among these 215 OH maser sites, 111 are new detections. After comparing the positions of these 215 maser sites to the literature, we identify 122 (57%) sites associated with evolved stars (one of which is a planetary nebula), 64 (30%) with star formation, two sites with supernova remnants, and 27 (13%) of unknown origin. The infrared colors of evolved star sites with symmetric maser profiles tend to be redder than those of evolved star sites with asymmetric maser profiles, which may indicate that symmetric sources are generally at an earlier evolutionary stage.

An Extract of Chinpi, the Dried Peel of the Citrus Fruit Unshiu, Enhances Axonal Remyelination via Promoting the Proliferation of Oligodendrocyte Progenitor Cells

Directory of Open Access Journals (Sweden)

Hideaki Tokunaga

2016-01-01

Full Text Available The aging-induced decrease in axonal myelination/remyelination is due to impaired recruitment and differentiation of oligodendrocyte progenitor cells (OPCs. Our previous studies have shown that a monoclonal antibody to DEAD (Asp-Glu-Ala-Asp box polypeptide 54 (Ddx54, a member of the DEAD box family of RNA helicases, (1 specifically labels oligodendrocyte lineages, (2 binds to mRNA and protein isoforms of myelin basic proteins (MBP, and (3 regulates migration of OPCs from ventricular zone to corpus callosum in mice. It has also been demonstrated that specific loss of a 21.5 kDa MBP isoform (MBP21.5 reflects demyelination status, and oral administration of an extract of Chinpi, citrus unshiu peel, reversed the aging-induced demyelination. Here, we report that Chinpi treatment induced a specific increase in the MBP21.5, led to the reappearance of Ddx54-expressing cells in ventricular-subventricular zone and corpus callosum of aged mice, and promoted remyelination. Treatment of in vitro OPC cultures with Chinpi constituents, hesperidin plus narirutin, led to an increase in 5-bromo-2′-deoxyuridine incorporation in Ddx54-expressing OPCs, but not in NG2- or Olig2-expressing cell populations. The present study suggests that Ddx54 plays crucial role in remyelination. Furthermore, Chinpi and Chinpi-containing herbal medicines may be a therapeutic option for the aging-induced demyelination diseases.