Determination of the electron affinity of astatine and polonium by laser photodetachment

CERN Multimedia

We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

International Nuclear Information System (INIS)

Eichler, B.; Son Chun, K.

1985-01-01

In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

International Nuclear Information System (INIS)

Otozai, K.; Takahashi, N.

1982-01-01

After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

7 CFR 1.198 - Settlement.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Settlement. 1.198 Section 1.198 Agriculture Office of....198 Settlement. The applicant and agency counsel may agree on a proposed settlement of the award before final action on the application, either in connection with a settlement of the underlying...

10 CFR 205.198 - Discovery.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Discovery. 205.198 Section 205.198 Energy DEPARTMENT OF... of Proposed Disallowance, and Order of Disallowance § 205.198 Discovery. (a) If a person intends to file a Motion for Discovery, he must file it at the same time that he files his Statement of Objections...

Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

CERN Multimedia

Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

2017-01-01

Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

CERN Document Server

Andreyev, Andrei

2013-01-01

Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

Energy Technology Data Exchange (ETDEWEB)

Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

2008-12-15

No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

International Nuclear Information System (INIS)

Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

2008-01-01

No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

Studies of the 198Hg(d,d') and 198Hg(d,p) reactions

Science.gov (United States)

Diaz Varela, Alejandra; Garrett, P. E.; Rand, E. T.; Ball, G. C.; Bilstein, V.; Laffoley, A. T.; Maclean, A. D.; Svensson, C. E.; Faestermann, T.; Hertenberger, R.; Wirth, H.-F.

2017-09-01

Limits on the electric dipole moment (EDM) continue to decrease for 199Hg, the most stringent upper limit for a nuclear EDM to date. The experimental limit on the observed atomic EDM for 199Hg is converted to a limit on the nuclear EDM via a calculation of the Schiff moment, requiring knowledge of the nuclear structure of 199Hg. The E 3 and E 1 strength distributions to the ground state of 199Hg, and E 2 transitions amongst excited states, would be ideal information to further constrain 199Hg Schiff moment theoretical models. The high level density of 199Hg makes those determinations challenging, however the similar information can be obtained from exploring surrounding even-even Hg isotopes. As part of a campaign to study the Hg isotopes near 199Hg, two experiments, 198Hg(d,d') 198Hg and 198Hg(d,p)199Hg reaction were performed using the Q3D spectrograph at the Maier-Leibnitz Laboratory (MLL) at Garching, Germany. A 22 MeV deuterium beam was used to impinge a 198Hg32S target. The (d,d') reaction allows us to probe the desired E 2 and E 3 matrix elements, while the (d,p) reaction provides information on the neutron single-particle states of 199Hg.

12 CFR 19.8 - Conflicts of interest.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Conflicts of interest. 19.8 Section 19.8 Banks... Uniform Rules of Practice and Procedure § 19.8 Conflicts of interest. (a) Conflict of interest in... measures at any stage of a proceeding to cure a conflict of interest in representation, including the...

Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

Energy Technology Data Exchange (ETDEWEB)

Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

2011-12-14

The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

Acquisition through Horizontal Gene Transfer of Plasmid pSMA198 by Streptococcus macedonicus ACA-DC 198 Points towards the Dairy Origin of the Species

Science.gov (United States)

Papadimitriou, Konstantinos; Anastasiou, Rania; Maistrou, Eleni; Plakas, Thomas; Papandreou, Nikos C.; Hamodrakas, Stavros J.; Ferreira, Stéphanie; Supply, Philip; Renault, Pierre; Pot, Bruno; Tsakalidou, Effie

2015-01-01

Background Streptococcus macedonicus is an intriguing streptococcal species whose most frequent source of isolation is fermented foods similarly to Streptococcus thermophilus. However, S. macedonicus is closely related to commensal opportunistic pathogens of the Streptococcus bovis/Streptococcus equinus complex. Methodology/Principal Findings We analyzed the pSMA198 plasmid isolated from the dairy strain Streptococcus macedonicus ACA-DC 198 in order to provide novel clues about the main ecological niche of this bacterium. pSMA198 belongs to the narrow host range pCI305/pWV02 family found primarily in lactococci and to the best of our knowledge it is the first such plasmid to be reported in streptococci. Comparative analysis of the pSMA198 sequence revealed a high degree of similarity with plasmids isolated from Lactococcus lactis strains deriving from milk or its products. Phylogenetic analysis of the pSMA198 Rep showed that the vast majority of closely related proteins derive from lactococcal dairy isolates. Additionally, cloning of the pSMA198 ori in L. lactis revealed a 100% stability of replication over 100 generations. Both pSMA198 and the chromosome of S. macedonicus exhibit a high percentage of potential pseudogenes, indicating that they have co-evolved under the same gene decay processes. We identified chromosomal regions in S. macedonicus that may have originated from pSMA198, also supporting a long co-existence of the two replicons. pSMA198 was also found in divergent biotypes of S. macedonicus and in strains isolated from dispersed geographic locations (e.g. Greece and Switzerland) showing that pSMA198’s acquisition is not a recent event. Conclusions/Significance Here we propose that S. macedonicus acquired plasmid pSMA198 from L. lactis via an ancestral genetic exchange event that took place most probably in milk or dairy products. We provide important evidence that point towards the dairy origin of this species. PMID:25584532

Bone Marrow Scans with Colloidal {sup 198}Au

Energy Technology Data Exchange (ETDEWEB)

Chang, Sung Soo; Whang, Kee Suk [Kyungpook National University College of Medicine, Daegu (Korea, Republic of)

1973-03-15

The bone marrow scans with colloidal {sup 198}Au were performed on 33 cases with hematologically normal patients and patients with various blood dyscrasia. Bone marrow aspirations were done at iliac crest in all cases but one. A correlation between the scan findings and an erythroid cellularity was evaluated. The following results were obtained. 1) Out of 33 cases, 23 (about 70%) showed a correlation between {sup 198}Au marrow uptakes on the scans and the erythroid cellularity. 2) The diseases in which no correlation existed between {sup 198}Au uptake and erythroid cellularity were aplastic anemia, acute leukemia and chronic myelogenous leukemia.

10 CFR 431.198 - Enforcement testing for distribution transformers.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Enforcement testing for distribution transformers. 431.198... COMMERCIAL AND INDUSTRIAL EQUIPMENT Distribution Transformers Compliance and Enforcement § 431.198 Enforcement testing for distribution transformers. (a) Test notice. Upon receiving information in writing...

37 CFR 1.98 - Content of information disclosure statement.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Content of information disclosure statement. 1.98 Section 1.98 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing...

14 CFR 198.13 - Premium insurance-payment of premiums.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Premium insurance-payment of premiums. 198... (CONTINUED) WAR RISK INSURANCE AVIATION INSURANCE § 198.13 Premium insurance—payment of premiums. The insured must pay the premium for insurance issued under this part within the stated period after receipt of...

21 CFR 211.198 - Complaint files.

Science.gov (United States)

2010-04-01

... CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.198 Complaint... for exemption under § 211.137, such written records shall be maintained for 3 years after distribution...

Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

International Nuclear Information System (INIS)

Zalutsky, Michael R.

2012-01-01

Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

Energy Technology Data Exchange (ETDEWEB)

MICHAEL R. ZALUTSKY

2012-08-08

Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

Electron Scattering from MERCURY-198 and Mercury -204.

Science.gov (United States)

Laksanaboonsong, Jarungsaeng

This experiment is the first electron scattering study on mercury isotopes. Electron scattering from ^{198}Hg and ^{204 }Hg has been performed at the NIKHEF-K Medium Energy Accelerator. Measured cross sections cover an effective momentum transfer range from 0.4 to 2.9 fm^ {-1}. Elastic cross sections were determined for scattering from both isotopes. Cross section for inelastic excitations in ^{198}Hg below 3 MeV were also determined. Measured cross sections were fit using DWBA phase shift codes to determine coefficients for Fourier-Bessel expansions of ground state and transition charge densities. Differences between the ground state charge densities of the two isotopes reveal the effect of the polarization of the proton core in response to the addition of neutrons. Spin and parity of several excited states of ^{198}Hg were determined. Extracted transition densities of these states show their predominantly collective nature. Charge densities for members of the ground state rotational band were compared with axially symmetric Hartree-Fock and geometrical model predictions.

Tritium stripping in a nitrogen glovebox using SAES St 198

International Nuclear Information System (INIS)

Klein, J.E.; Wermer, J.R.

1994-01-01

SAES metal getter material St 198 was chosen for glovebox stripper tests to evaluate its effectiveness of removing tritium from a nitrogen atmosphere. The St 198 material is unique from a number of other metal hydride-based getter materials in that it is relatively inert to nitrogen and can thus be used in nitrogen glovebox atmospheres. Six tritium stripper experiments which mock-up the use of a SAES St 198 stripper bed for a full-scale (10,500 liter) nitrogen glovebox have been completed. Experiments consisted of a release of small quantity of protium/deuterium spiked with tritium which were scaled to simulate tritium releases of 0.1 g., 1.0 g., and 10 g. into the glovebox. The tritium spike allows detection using tritium ion chambers. The St 198 stripper system produced a reduction in tritium activity of approximately two orders of magnitude in 24 hours (6--8 atmosphere turn-overs) of stripper operation

Oblate collectivity in 197,198Pb

International Nuclear Information System (INIS)

Kuhnert, A.; Wang, T.F.; Stoyer, M.A.; Becker, J.A.; Henry, E.A.; Brinkman, M.J.; Yates, S.W.; Draper, J.E.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Machiavelli, A.O.; Kelly, W.H.; Korten, W.; Azaiez, F.; Cizewski, J.A.

1993-01-01

Evidence for collective behavior in the high-spin region of neutron deficient lead nuclei is provided by the observation of four collective structures in 197,198 Pb. These bands consist of strong dipole (M1) transitions with a few E2 crossover transitions observed. The transition energies of three of these bands show a rather regular behavior while those of one of them show an irregular behavior. We interpret the regular bands as oblate collective bands built on oblate proton and neutron states, whereas the irregular band might either be built on a state with very small oblate deformation, or be a triaxial rotational band. A lifetime measurement (DSAM) has been done for the regular bands in 198 Pb. Neutron and proton configurations for the bands are suggested from the results of quasi particle Routhians and total Routhian surface (TRS) calculations. (orig.)

Oblate collectivity in 197,198Pb

International Nuclear Information System (INIS)

Kuhnert, A.; Wang, T.F.; Stoyer, M.A.; Becker, J.A.; Henry, E.A.; Brinkman, M.J.; Yates, S.W.; Draper, J.E.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Machiavelli, A.O.; Kelly, W.H.; Korten, W.; Azaiez, F.

1992-07-01

Evidence for collective behavior in the high-spin region of neutron deficient lead nuclei is provided by the observation of four collective structures in 197,198 Pb. These bands consist of strong dipole (M1) transitions with a few E2 crossover transitions observed. The transition energies of three of these bands show a rather regular behavior while those of one of them show an irregular behavior. We interpret the regular bands as oblate collective bands built on oblate proton and neutron states, whereas the irregular band might either be built on a state with very small oblate deformation, or be a triaxial rotational band. A lifetime measurement (DSAM) has been done for the regular bands in 198 Pb. Neutron and proton configurations for the bands are suggested from the results of quasi particle Routhians and total Routhian surface (TRS) calculations

MicroRNA-198 inhibited tumorous behaviors of human osteosarcoma through directly targeting ROCK1

International Nuclear Information System (INIS)

Zhang, Shilian; Zhao, Yuehua; Wang, Lijie

2016-01-01

Osteosarcoma is an aggressive primary sarcoma of bone and occurs mainly in adolescents and young adults. The prognosis of OS remains poor, and most of them will die due to local relapse or metastases. The discovery of microRNAs provides a new possibility for the early diagnosis and treatment of OS. Thus, the aim of this study was to explore the expression and functions of microRNA-198 (miR-198) in osteosarcoma. The expression levels of miR-198 were determined by qRT-PCR in osteosarcoma tissues and cell lines. Cell proliferation assays, migration and invasion assays were adopted to investigate the effects of miR-198 on tumorous behaviors of osteosarcoma cells. The results showed that miR-198 expression levels were lower in osteosarcoma tissues and cell lines. In addition, low miR-198 expression levels were correlated with TNM stage and distant metastasis. After miR-198 mimics transfection, cell proliferation, migration and invasion were significantly suppressed in the osteosarcoma cells. Furthermore, ROCK1 was identified as a novel direct target of miR-198 in osteosarcoma. These findings suggested that miR-198 may act not only as a novel prognostic marker, but also as a potential target for molecular therapy of osteosarcoma.

MicroRNA-198 inhibited tumorous behaviors of human osteosarcoma through directly targeting ROCK1

Energy Technology Data Exchange (ETDEWEB)

Zhang, Shilian, E-mail: shilian_zhang@126.com; Zhao, Yuehua; Wang, Lijie

2016-04-08

Osteosarcoma is an aggressive primary sarcoma of bone and occurs mainly in adolescents and young adults. The prognosis of OS remains poor, and most of them will die due to local relapse or metastases. The discovery of microRNAs provides a new possibility for the early diagnosis and treatment of OS. Thus, the aim of this study was to explore the expression and functions of microRNA-198 (miR-198) in osteosarcoma. The expression levels of miR-198 were determined by qRT-PCR in osteosarcoma tissues and cell lines. Cell proliferation assays, migration and invasion assays were adopted to investigate the effects of miR-198 on tumorous behaviors of osteosarcoma cells. The results showed that miR-198 expression levels were lower in osteosarcoma tissues and cell lines. In addition, low miR-198 expression levels were correlated with TNM stage and distant metastasis. After miR-198 mimics transfection, cell proliferation, migration and invasion were significantly suppressed in the osteosarcoma cells. Furthermore, ROCK1 was identified as a novel direct target of miR-198 in osteosarcoma. These findings suggested that miR-198 may act not only as a novel prognostic marker, but also as a potential target for molecular therapy of osteosarcoma.

Studies on implantation of 198Au-grain as a radiation therapy to cancer tissue

International Nuclear Information System (INIS)

Machida, Seiro

1975-01-01

The most effective dose of 198 Au-grain to be implanted and the clinicopathological findings after treatment are discussed. A safe dose of 198 Au-grain which could be implanted subcutaneously in rats, was under 2 mCi migration of 198 Au-grain was not recognized. In Yoshida sarcoma, transplanted subcutaneously into the backs of rats the most effective dose of 198 Au-grain was 2mCi/g of tumour tissue. However, about half of the rats implanted with this dosage died from the growing tumour. Histological examination of the implanted tumour tissue, revealed necrosis within a distance of only 0.4 mm from 198 Au-grain particles. In small metastatic tumours after 198 Au-grain implantation, there was necrosis i.e. pyknosis and karyolysis of the tumour cells, fibrosis and hyaline degeneration of the stroma. However, hardly any change in tumour size was detectable because of swelling and induration around the tumour. In some of the cases treated with 198 Au-grain combined with 60 Co or with chemotherapeutics, the tumour size was evidently reduced and became non-palable. Side effects were minimal except in one case which was afflicted temporarily with radiation sickness after an implantation of 200 mCi 198 Au-grain. In conclusion, the implantation of 198 Au-grain into the tumour was found to be very safe for the patients with surgically incurable cancer. Because of the short range of 198 Au-grain radioactivity, homogeneous density of 198 Au-grain into the whole tumour tissue is required. A combination with other radiations and/or with chemotherapeutics is also recommended. (author)

ISO-PC Version 1.98: User`s guide

Energy Technology Data Exchange (ETDEWEB)

Rittmann, P.D.

1995-05-02

This document describes how to use Version 1.98 of the shielding program named ISO-PC. Version 1.98 corrects all known errors in ISOSHLD-II. In addition, a few numeric problems have been eliminated. There are three new namelist variables, 25 additional shielding materials, and 5 more energy groups. The two major differences with the original ISOSHLD-II are the removal of RIBD(radioisotope buildup and decay) source generator, and the removal of the non-uniform source distribution parameter, SSV1. This version of ISO-PC works with photon energies from 10 KeV to 10 MeV using 30 energy groups.

40 CFR 264.198 - Special requirements for ignitable or reactive wastes.

Science.gov (United States)

2010-07-01

... waste, mixture, or dissolved material no longer meets the definition of ignitable or reactive waste... comply with the requirements for the maintenance of protective distances between the waste management... reactive wastes. 264.198 Section 264.198 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

40 CFR 265.198 - Special requirements for ignitable or reactive wastes.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive wastes. 265.198 Section 265.198 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

40 CFR 267.198 - What are the general operating requirements for my tank systems?

Science.gov (United States)

2010-07-01

... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.198 What are the general operating... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the general operating requirements for my tank systems? 267.198 Section 267.198 Protection of Environment ENVIRONMENTAL PROTECTION...

Synthesis and Characterization of Poly(Amidoamine Dendrimers Encapsulatd 198Au Nanoparticles

Directory of Open Access Journals (Sweden)

R. Ritawidya1,2

2012-12-01

Full Text Available Brachytherapy or internal radiotherapy is one of many methods used for treatment of cancer. This modality requires an agent with radionuclides that emits  or β particle with a proper energy. 198Au (99% β max = 0.96 MeV and t1/2 = 2.69 days is one of radionuclides that has been considered to be effective for the above-mentioned purpose. The purpose of this research was to synthesis and characterize poly(amidoamine (PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles as a new brachytherapy agent. PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles was successfully synthesized by a bottom-up method using sodium borohydride as a reductor. Purification was then performed by a size exclusion chromatography in order to separate large Au nanoparticles that were formed outside the cavity of PAMAM G3.0 dendrimers. Prior to the synthesis of PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles, the synthetic procedure was first established by using a non-radioactive Au. The PAMAM G3.0 dendrimers encapsulated Au nanoparticles produced was then characterized by using an UV-Vis spectroscopy, a transmission electron microscopy (TEM, particle size analyzer (PSA, and an atomic absorption spectroscopy (AAS. Characterization results revealed that PAMAM G3.0 dendrimers encapsulated Au nanoparticles that were prepared from a reaction mixture of PAMAM G3.0 dendrimers and Au HAuCl4 with mol ratio of 2.8, was found to be a proper formula. It produced PAMAM G3.0 dendrimers encapsulated Au nanoparticles with diameter of 1.743 nm, spheris, uniform and drug loading value of 26.34%. This formula was then used in synthesis using radioactive Au, 198Au. Characterization results of PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles gave a radiochemical purity of 99.4% and zero charge.

43 CFR 19.8 - Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest...

Science.gov (United States)

2010-10-01

... patents, and mineral leasing within National Forest Wilderness. 19.8 Section 19.8 Public Lands: Interior... § 19.8 Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest... locations, mineral patents, and mineral leasing within National Forest Wilderness are contained in parts...

Comment: 198 [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available ゲノム比較解析のためにゲノム解読が行われた。 撮影:成瀬清（基礎生物学研究所） Photo: Kiyoshi Naruse (National Institute for Basic Biology) bando 2009/10/01 14:48:45 2010/01/14 20:09:26 ... ...nal Institute for Basic Biology) licensed under CC Attribution2.1 Japan メダカ近交系 HNI-Ⅱ系統 北日本集団由来の純系。 Hd-rR系統との...Japanese medaka Oryzias latipes Oryzias_latipes_L.png 198.png Kiyoshi Naruse (Natio

Spectroscopy and measurement of electromagnetic moments in sup(198,200,210)Po

International Nuclear Information System (INIS)

Maier, K.H.

1985-01-01

The quadrupole coupling constants for the 210 Po Isup(π)=8 + , 11 - , 13 - isomers in Bi have been measured, and Q(11 - )=82(2) fm 2 and Q(13 - )=90(2) fm 2 normalized to Q( 210 Po8 + )=57 fm 2 are deduced. In beam γ-spectroscopy of sup(198,) 200 Po showed the (πh 2 sub(9/2) 8 + ) π(hsub(9/2)isub(13/2) 11 - ) and (visub(13/2) 12 + ) isomers. The B(E2 8 + ->6 + ) and Q(8 + ) in 198 Po to 210 Po are discussed, a sudden drop is found for the B(E2) in 198 Po. The B(E3, 11 - ->8 + ) rises very steeply in the light Po isotopes. (orig.)

miR-198 Represses the Proliferation of HaCaT Cells by Targeting Cyclin D2

Directory of Open Access Journals (Sweden)

Jian Wang

2015-07-01

Full Text Available Background: MiR-198 has been considered as an inhibitor of cell proliferation, invasion, migration and a promoter of apoptosis in most cancer cells, while its effect on non-cancer cells is poorly understood. Methods: The effect of miR-198 transfection on HaCaT cell proliferation was firstly detected using Cell Count Kit-8 and the cell cycle progression was analyzed by flow cytometry. Using bioinformatics analyses and luciferase assay, a new target of miR-198 was searched and identified. Then, the effect of the new target gene of miR-198 on cell proliferation and cell cycle was also detected. Results: Here we showed that miR-198 directly bound to the 3′-UTR of CCND2 mRNA, which was a key regulator in cell cycle progression. Overexpressed miR-198 repressed CCND2 expression at mRNA and protein levels and subsequently led to cell proliferation inhibition and cell cycle arrest in the G1 phase. Transfection ofSiCCND2 in HaCaT cells showed similar inhibitory effects on cell proliferation and cell cycle progression. Conclusion: In conclusion, we have identified that miR-198 inhibited HaCaT cell proliferation by directly targeting CCND2.

In-beam spectroscopy of 198Po and 200Po nuclei

International Nuclear Information System (INIS)

Maj, A.

1988-01-01

The main purpose of this thesis is to answer the question whether any signs of collectivity or deformation are evident in 198 Po and 200 Po nuclei, situated on the border of the predicted new region of oblate deformation. Bearing this in mind spectroscopic investigations were performed. The level schemes of 198 Po and 200 Po were established, transition rates were determined and g-factors of isomeric states and, for 200 Po, the quadrupole moment of the 8 + - state were measured. The experimental techniques are described and the methods of evaluating the obtained data are presented. 74 refs., 7 figs., 9 tabs. (M.F.W.)

15 CFR 19.8 - When will Commerce entities suspend or terminate debt collection on a Commerce debt?

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities suspend or terminate debt collection on a Commerce debt? 19.8 Section 19.8 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce Debts § 19.8 When will...

Collective oblate dipole rotational bands in 198Pb

International Nuclear Information System (INIS)

Clark, R.M.; Wadsworth, R.; Paul, E.S.; Beausang, C.W.; Ali, I.; Astier, A.; Cullen, D.M.; Dagnall, P.J.; Fallon, P.; Joyce, M.J.; Meyer, M.; Redon, N.; Regan, P.H.; Sharpey-Schafer, J.F.; Nazarewicz, W.; Wyss, R.

1993-01-01

The nucleus 198 Pb was populated via the 186 W( 17 O, 5n) 198 Pb reaction at beam energies of 92 and 98 MeV. Five collective rotational cascades of ΔI=1 transitions have been found. Four are highly regular, one much more irregular. The structures are incorporated into a level scheme which extends up to approximately spin 32 h and an excitation energy of about 10 MeV. Angular correlation measurements confirm the dipole character of the interband transitions. Their M1 multipolarity is inferred, and from this supposition the experimental data are interpreted in terms of oblate high-K two quasiproton configurations coupled to aligned neutron excitations. This interpretation is extended to include other ΔI=1 oblate structures observed in 194-201 Pb. It is shown that the pattern of observed moments of inertia can be understood in the simple unpaired picture involving neutron i 13/2 excitations. The identical bands observed are interpreted in terms of the normal-parity weakly-coupled singlet orbital. (orig.)

A novel derivative of doxorubicin, AD198, inhibits canine transitional cell carcinoma and osteosarcoma cells in vitro.

Science.gov (United States)

Rathore, Kusum; Cekanova, Maria

2015-01-01

Doxorubicin (DOX) is one of the most commonly used chemotherapeutic treatments for a wide range of cancers. N-benzyladriamycin-14-valerate (AD198) is a lipophilic anthracycline that has been shown to target conventional and novel isoforms of protein kinase C (PKC) in cytoplasm of cells. Because of the adverse effects of DOX, including hair loss, nausea, vomiting, liver dysfunction, and cardiotoxicity, novel derivatives of DOX have been synthesized and validated. In this study, we evaluated the effects of DOX and its derivative, AD198, on cell viability of three canine transitional cell carcinoma (K9TCC) (K9TCC#1-Lillie, K9TCC#2-Dakota, K9TCC#4-Molly) and three canine osteosarcoma (K9OSA) (K9OSA#1-Zoe, K9OSA#2-Nashville, K9OSA#3-JJ) primary cancer cell lines. DOX and AD198 significantly inhibited cell proliferation in all tested K9TCC and K9OSA cell lines in a dose-dependent manner. AD198 inhibited cell viability of tested K9TCC and K9OSA cell lines more efficiently as compared to DOX at the same concentration using MTS (3-(4,5-dimethyl-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2h-tetrazolium) assay. AD198 had lower IC50 values as compared to DOX for all tested K9TCC and K9OSA cell lines. In addition, AD198 increased apoptosis in all tested K9TCC and K9OSA cell lines. AD198 increased the caspase activity in tested K9TCC and K9OSA cell lines, which was confirmed by caspase-3/7 assay, and cleavage of poly (ADP-ribose) polymerase (PARP) was confirmed by Western blotting analysis. In addition, AD198 cleaved PKC-δ, which subsequently activated the p38 signaling pathway, resulting in the apoptosis of tested K9TCC and K9OSA cell lines. Inhibition of the p38 signaling pathway by SB203580 rescued DOX- and AD198-induced apoptosis in tested K9TCC and K9OSA cell lines. Our in vitro results suggest that AD198 might be considered as a new treatment option for K9TCC and K9OSA cell lines cancers in vivo.

Rational Design of Cyclic Antimicrobial Peptides Based on BPC194 and BPC198

Directory of Open Access Journals (Sweden)

Anna D. Cirac

2017-06-01

Full Text Available A strategy for the design of antimicrobial cyclic peptides derived from the lead compounds c(KKLKKFKKLQ (BPC194 and c(KLKKKFKKLQ (BPC198 is reported. First, the secondary β-structure of BPC194 and BPC198 was analyzed by carrying out molecular dynamics (MD simulations. Then, based on the sequence pattern and the β-structure of BPC194 or BPC198, fifteen analogues were designed and synthesized on solid-phase. The best peptides (BPC490, BPC918, and BPC924 showed minimum inhibitory concentration (MIC values <6.2 μM against Pseudomonas syringae pv. syringae and Xanthomonas axonopodis pv. vesicatoria, and an MIC value of 12.5 to 25 μM against Erwinia amylovora, being as active as BPC194 and BPC198. Interestingly, these three analogues followed the structural pattern defined from the MD simulations of the parent peptides. Thus, BPC490 maintained the parallel alignment of the hydrophilic pairs K1–K8, K2–K7, and K4–K5, whereas BPC918 and BPC924 included the two hydrophilic interactions K3–Q10 and K5–K8. In short, MD simulations have proved to be very useful for ascertaining the structural features of cyclic peptides that are crucial for their biological activity. Such approaches could be further employed for the development of new antibacterial cyclic peptides.

Measurement of hepatic blood flow in the unanesthetized rabbit using 198Au and 125I rose bengal clearance technique

International Nuclear Information System (INIS)

Balabaud, C.; Roche, M.-C.; Dangoumau, Jacques

1975-01-01

Hepatic blood flow was measured in the unanesthetized rabbit using the clearance technique of 198 Au and 125 I RB. The values are: 71.82+-16.24ml.min -1 .kg -1 for 198 Au, and 60.21+-9.94ml.min -1 .kg -1 for 125 I RB (P 198 Au [fr

A novel derivative of doxorubicin, AD198, inhibits canine transitional cell carcinoma and osteosarcoma cells in vitro

Directory of Open Access Journals (Sweden)

Rathore K

2015-09-01

Full Text Available Kusum Rathore, Maria Cekanova Department of Small Animal Clinical Sciences, College of Veterinary Medicine, The University of Tennessee, Knoxville, TN, USA Abstract: Doxorubicin (DOX is one of the most commonly used chemotherapeutic treatments for a wide range of cancers. N-benzyladriamycin-14-valerate (AD198 is a lipophilic anthracycline that has been shown to target conventional and novel isoforms of protein kinase C (PKC in cytoplasm of cells. Because of the adverse effects of DOX, including hair loss, nausea, vomiting, liver dysfunction, and cardiotoxicity, novel derivatives of DOX have been synthesized and validated. In this study, we evaluated the effects of DOX and its derivative, AD198, on cell viability of three canine transitional cell carcinoma (K9TCC (K9TCC#1-Lillie, K9TCC#2-Dakota, K9TCC#4-Molly and three canine osteosarcoma (K9OSA (K9OSA#1-Zoe, K9OSA#2-Nashville, K9OSA#3-JJ primary cancer cell lines. DOX and AD198 significantly inhibited cell proliferation in all tested K9TCC and K9OSA cell lines in a dose-dependent manner. AD198 inhibited cell viability of tested K9TCC and K9OSA cell lines more efficiently as compared to DOX at the same concentration using MTS (3-(4,5-dimethyl-2-yl-5-(3-carboxymethoxyphenyl-2-(4-sulfophenyl-2h-tetrazolium assay. AD198 had lower IC50 values as compared to DOX for all tested K9TCC and K9OSA cell lines. In addition, AD198 increased apoptosis in all tested K9TCC and K9OSA cell lines. AD198 increased the caspase activity in tested K9TCC and K9OSA cell lines, which was confirmed by caspase-3/7 assay, and cleavage of poly (ADP-ribose polymerase (PARP was confirmed by Western blotting analysis. In addition, AD198 cleaved PKC-δ, which subsequently activated the p38 signaling pathway, resulting in the apoptosis of tested K9TCC and K9OSA cell lines. Inhibition of the p38 signaling pathway by SB203580 rescued DOX- and AD198-induced apoptosis in tested K9TCC and K9OSA cell lines. Our in vitro results suggest

9 CFR 381.198 - Importer to make application for inspection of poultry products offered for entry.

Science.gov (United States)

2010-01-01

... MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Importer to make application for inspection of poultry products offered for entry. 381.198 Section 381.198 Animals and Animal Products FOOD...

SCM-198 attenuates early atherosclerotic lesions in hypercholesterolemic rabbits via modulation of the inflammatory and oxidative stress pathways.

Science.gov (United States)

Zhang, Yanfei; Guo, Wei; Wen, Yadan; Xiong, Qinghui; Liu, Hongrui; Wu, Jian; Zou, Yunzeng; Zhu, Yizhun

2012-09-01

To investigate SCM-198 (also known as "leonurine"), a compound in Herba leonuri, as well as its effect on the progression of atherosclerosis in hypercholesterolemic rabbits and underlying mechanisms. Thirty New Zealand male White rabbits (5 groups, n = 6) were fed either a normal diet or a high-cholesterol diet (1%). The rabbits on the high-cholesterol diet received treatments of low, moderate, and high doses of SCM-198 and placebo concurrently. Eight weeks later, the animals underwent ultrasonographic imaging. They were then sacrificed for further pathological and molecular biological analysis. SCM-198-treated rabbits showed a significant alleviation in the development of atherosclerosis in a dose-dependent manner. The lesions were smaller after the SCM-198 treatments. In addition, the elasticity of the arteries and hemodynamic status improved, accompanied with a decrease in smooth muscle cell migration and, macrophage infiltration, as well as the expression of platelet-endothelial cell adhesion molecule-1 (PECAM-1) in the aortas. Marginal changes in the lipid parameters were found in the SCM-198-treated rabbits, with high-density lipid cholesterol (HDL-C) elevation and triglyceride (TG) reduction at the high dose. SCM-198 treatment dose-dependently reduced levels of serum soluble vascular cell adhesion molecule-1 (sVCAM-1), soluble intercellular adhesion molecule-1 (sICAM-1), interleukin-6 (IL-6) and tumor necrosis factor-α (TNF-α), as well as the mRNA levels of VCAM-1, IL-6, TNF-α, monocyte chemoattractant protein-1 (MCP-1), iNOS and MMP-9 in the aorta. In addition, SCM-198 also dose-dependently increased the total antioxidant capacities and in parallel decreased the lipid peroxidation levels in the serum and liver. The antioxidant effects of SCM-198 were implicated by the enhanced activities of catalase (CAT), superoxide dismutase (SOD), glutathione peroxidase (GPx) and levels of glutathione (GSH) in the liver, as well as the mRNA levels of CAT, SOD-1 and

Application of Electrocoagulation Process for Reactive Red 198 Dye Removal from the Aqueous Solution

Directory of Open Access Journals (Sweden)

Mansooreh Dehghani

2014-04-01

Full Text Available Abstract Background and purpose:The main objectives of this research were to evaluating the application of electrocoagulation process for 198 dye from the aqueous phase and determining the optimum operating conditions to the dye removal using aluminum and iron electrodes. Materials and Methods:The present study was conducted in bench-scale. The spectrophotometer DR 5000 was used to determine the dye concentration. The effects of pH, retention time, voltage, dye concentration on the efficiency of electrocoagulation process were investigated. Data were analyzed in SPSS for Windows 16.0 using Pearson’scorrelation coefficient to analyze the relationship between these parameters. Results:The results showed that the optimal conditions for reactive red 198 (RR-198 dye removal from the aqueous solution are pH of 11, the voltage of 32 V, the initial dye concentration of 10 ppm, and the reaction time of 40 min. Pearson correlation analysis showed that there is a significant relationship between voltage and the reaction time with the removal efficiencies (P< 0.01. Conclusion:It was revealed that the removal efficiency of dye was directly proportional to the voltage and reaction time, but inversely proportional to the initial dye concentration. In conclusion, electrocoagulation process using two-fold iron and aluminum electrodes is an appropriate method for reducing the RR-198 dye in the aqueous phase.

Lower expressed miR-198 and its potential targets in hepatocellular carcinoma: a clinicopathological and in silico study

Directory of Open Access Journals (Sweden)

Huang WT

2016-08-01

Full Text Available Wen-Ting Huang,1,* Han-Lin Wang,1,* Hong Yang,2 Fang-Hui Ren,1 Yi-Huan Luo,1 Chun-Qin Huang,1 Yue-Ya Liang,1 Hai-Wei Liang,1 Gang Chen,1 Yi-Wu Dang1 1Department of Pathology, 2Department of Ultrasonography, First Affiliated Hospital of Guangxi Medical University, Nanning, People’s Republic of China *These authors contributed equally to this work Purpose: To investigate the clinicopathological value and potential roles of microRNA-198 (miR-198 in hepatocellular carcinoma (HCC.Methods: Ninety-five formalin-fixed paraffin-embedded HCC and the para-cancerous liver tissues were gathered. Real-time reverse transcription quantitative polymerase chain reaction was applied to determine the miR-198 expression. The association between the miR-198 expression and clinicopathological features was examined. Meanwhile, potential target messenger RNAs of miR-198 in HCC were obtained from 14 miRNA prediction databases and natural language processing method, in which we pooled the genes related to the tumorigenesis and progression of HCC and classified them by their frequency. The selected target genes were finally analyzed in the Gene Ontology analysis and Kyoto Encyclopedia of Genes and Genomes pathway.Results: miR-198 expression was significantly lower in HCC than that in adjacent noncancerous liver tissues (1.30±0.72 vs 2.01±0.58, P<0.001. Low miR-198 expression was also correlated to hepatitis C virus infection (r=-0.48, P<0.001, tumor capsular infiltration (r=-0.43, P<0.001, metastasis (r=-0.26, P<0.010, number of tumor nodes (r=-0.25, P=0.013, vaso-invasion (r=-0.24, P=0.017, and clinical tumor node metastasis stage (r=-0.23, P=0.024. Altogether, 1,048 genes were achieved by the concurrent prediction from at least four databases and natural language processing indicated 1,800 genes for HCC. Further, 127 overlapping targets were further proceeded with for pathway analysis. The most enriched Gene Ontology terms in the potential target messenger RNAs of mi

Update of the BIG 1-98 Trial: where do we stand?

Science.gov (United States)

Joerger, Markus; Thürlimann, Beat

2009-10-01

There is accumulating data on the clinical benefit of aromatase inhibitors in the adjuvant treatment of early-stage breast cancer in postmenopausal women. The Breast International Group (BIG) 1-98 study is a randomized, phase 3, double-blind trial comparing four adjuvant endocrine treatments of 5 years duration in postmenopausal women with hormone-receptor-positive breast cancer: letrozole or tamoxifen monotherapy, sequential treatment with tamoxifen followed by letrozole, or vice versa. This article summarizes data presented at the 2009 St. Gallen early breast cancer conference: an update on the monotherapy arms of the BIG 1-98 study, and results from the sequential treatment arms. Implications for daily practice from BIG 1-98 and from other adjuvant trials will be discussed. Despite cross-over from tamoxifen to letrozole by 25% of the patients after unblinding of the tamoxifen monotherapy arm, the improvement of disease-free survival (HR 0.88, 0.78-0.99, p = 0.03) and time to distant recurrence (HR 0.85, 0.72-1.00, p = 0.05) for letrozole monotherapy as compared to tamoxifen monotherapy remained significant in the intention-to-treat (ITT) analysis. A trend for an overall survival advantage for letrozole was seen in the ITT analysis (HR 0.87, 0.75-1.02, p = 0.08). No statistically significant differences were found for the sequential treatment arms versus letrozole monotherapy, with respect to disease-free survival, time to distant recurrence or overall survival. Cumulative incidence analysis of breast cancer recurrence favors the initiation of adjuvant endocrine treatment with letrozole instead of tamoxifen, especially in patients at higher risk for early recurrence. Similarly, data suggest that patients commenced on letrozole can be switched to tamoxifen after 2 years, if required. The BIG 1-98 study update with median follow up of 76 months confirms a significant reduction in the risk of breast cancer recurrence and a trend towards improved overall survival

Clinical value of miR-198-5p in lung squamous cell carcinoma assessed using microarray and RT-qPCR.

Science.gov (United States)

Liang, Yue-Ya; Huang, Jia-Cheng; Tang, Rui-Xue; Chen, Wen-Jie; Chen, Peng; Cen, Wei-Luan; Shi, Ke; Gao, Li; Gao, Xiang; Liu, An-Gui; Peng, Xiao-Tong; Chen, Gang; Huang, Su-Ning; Fang, Ye-Ying; Gu, Yong-Yao

2018-02-02

To examine the clinical value of miR-198-5p in lung squamous cell carcinoma (LUSC). Gene Expression Omnibus (GEO) microarray datasets were used to explore the miR-198-5p expression and its diagnostic value in LUSC. Real-time reverse transcription quantitative polymerase chain reaction was used to evaluate the expression of miR-198-5p in 23 formalin-fixed, paraffin-embedded (FFPE) LUSC tissues and corresponding non-cancerous tissues. The correlation between miR-198-5p expression and clinic pathological features was assessed. Meanwhile, putative target messenger RNAs of miR-198-5p were identified based on the analysis of differentially expressed genes in the Cancer Genome Atlas (TCGA) and 12 miRNA prediction tools. Subsequently, the putative target genes were sent to Gene Ontology and Kyoto Encyclopedia of Genes and Genomes pathway analyses. MiR-198-5p was low expressed in LUSC tissues. The combined standard mean difference (SMD) values of miR-198-5p expression based on GEO datasets were - 0.30 (95% confidence interval (CI) - 0.54, - 0.06) and - 0.39 (95% CI - 0.83, 0.05) using fixed effect model and random effect model, respectively. The sensitivity and specificity were not sufficiently high, as the area under the curve (AUC) was 0.7749 (Q* = 0.7143) based on summarized receiver operating characteristic (SROC) curves constructed using GEO datasets. Based on the in-house RT-qPCR, miR-198-5p expression was 4.3826 ± 1.7660 in LUSC tissues and 4.4522 ± 1.8263 in adjacent normal tissues (P = 0.885). The expression of miR-198-5p was significantly higher in patients with early TNM stages (I-II) than that in cases with advanced TNM stages (III-IV) (5.4400 ± 1.5277 vs 3.5690 ± 1.5228, P = 0.008). Continuous variable-based meta-analysis of GEO and PCR data displayed the SMD values of - 0.26 (95% CI - 0.48, - 0.04) and - 0.34 (95% CI - 0.71, 0.04) based on fixed and random effect models, respectively. As for the diagnostic

Lung clearance of polydispersed colloidal 198Au particles

International Nuclear Information System (INIS)

D'Addabbo, A.; Fanfani, G.

1975-01-01

Lung clearance was studied on a group of subjects over 65 years old and on subjects aged between 30 and 40. A slowing down of material deposited in the bronchial tubes (polydispersed colloidal 198 Au particles) was observed in the senile subjects. This phenomenon is apparently related not only to a reduced activity of the vibratile ciliae, in connection with the frequent metaplasia of the bronchial cylindrical epithelium, but also to a quantitative and qualitative change in the mucopolysaccharides forming the mucus secretion [fr

Novel anti-diabetic effect of SCM-198 via inhibiting the hepatic NF-κB pathway in db/db mice.

Science.gov (United States)

Huang, Hui; Xin, Hong; Liu, Xinhua; Xu, Yajun; Wen, Danyi; Zhang, Yahua; Zhu, Yi Zhun

2012-04-01

There are reports of early evidence that suggest the involvement of chronic low-grade inflammation in the pathogenesis of Type 2 diabetes. Thus, substances that have effects in reducing inflammation could be potential drugs for Type 2 diabetes. Leonurine (4-guanidino-n-butyl syringate; SCM-198) is an alkaloid in HL (Herba leonuri), which was reported to possess anti-inflammatory properties. We hypothesize that SCM-198 may have beneficial effects on Type 2 diabetes. In the present study, we attempted to test this hypothesis by evaluating the anti-diabetic effect of SCM-198 and the possible underlying mechanisms of its effects in db/db mice. SCM-198 (50, 100 and 200 mg/kg of body weight), pioglitazone (50 mg/kg of body weight, as a positive control) or 1% CMC-Na (sodium carboxymethylcellulose) were administered to the db/db or db/m mice once daily for 3 weeks. After 3 weeks, SCM-198 (200 mg/kg of body weight) treatment significantly reduced the fasting blood glucose level and increased the plasma insulin concentration in the db/db mice, meanwhile it significantly lowered the plasma TAG (triacylglycerol) concentration and increased the HDL (high-density lipoprotein)-cholesterol concentration. Moreover, the dysregulated transcription of the hepatic glucose metabolic enzymes, including GK (glucokinase), G6Pase (glucose-6-phosphatase) and PEPCK (phosphoenolpyruvate carboxykinase), was recovered by an Akt-dependent pathway. The pro-inflammatory mediators {such as TNFα (tumour necrosis factor α), IL (interleukin)-6, IL-1β, degradation of IκB [inhibitor of NF-κB (nuclear factor-κB)] α and thereafter activation of NF-κB} were reversed by SCM-198 treatment in the db/db mice. The present study provides first evidence that SCM-198 exhibits anti-inflammatory activity and has an ameliorating effect on diabetic symptoms via inhibiting of NF-κB/IKK (IκB kinase) pathway. Consequently, we suggest that SCM-198 may be a prospective agent for prevention and

Comparison of liver scintigraphy with sup(99m)Tc-phytate and 198Au-colloid in diffuse hepatic disorders

International Nuclear Information System (INIS)

Kamoi, Itsuma; Watanabe, Katsushi; Kawahira, Kenjiro; Nakayama, Chikashi; Higashi, Yoshitaka

1975-01-01

sup(99m)Tc-phytate was evaluated as a liver scintigraphic radiopharmaceutical, and the results were compared with those of 198 Au-colloid. Both radionuclides were used on the same day in 55 cases of diffuse hepatic disorders. In 52 of the 55 cases, excellent liver images were obtained with sup(99m)Tc-phytate. Compared with 198 Au-colloid, sup(99m)Tc-phytate was more highly concentrated in the spleen and bone marrow and with higher background radioactivity, although their distributions generally coincided. The known diagnostic criteria for liver scintigraphy with 198 Au-colloid in diffuse hepatic disorders were proven applicable to sup(99m)Tc-phytate. (auth.)

Pulmonary uptake of 198Au during liver scanning in two patients with amyloidosis

International Nuclear Information System (INIS)

Goebel, R.

1976-01-01

Lung uptake of 198 Au-colloid, injected for a liver scan, is demonstrated in two patients with systemic amyloidosis. The incidence, importance and mechanism of this phenomenon is discussed. (orig.) [de

Scanning with Au198 in experimental hepatic trauma

International Nuclear Information System (INIS)

Faifer, J.G.; Macedo, A.R. de; Vicentini, M.L.M.; Hossne, W.S.

1977-01-01

Scintiscanning of the liver with Au 198 was performed in 30 mongrel dogs, with the purpose of evaluating the importance of this method in the diagnostic of liver traumatisms. In 18 animals the scanning was performed after 3 differents types of hepatic trauma: intraparenchymal hematoma, stab wound and lasceration of liver. In 12 dogs without hepatic trauma the scanning was performed with the purpose of establishing the pattern of the normal liver scan in the dog. Results indicate that scintiscanning of the liver is a good propaedeutic method in the evaluation of the presence and localization of traumatic hepatic lesion [pt

Characterization of the SUMO-binding activity of the myeloproliferative and mental retardation (MYM-type zinc fingers in ZNF261 and ZNF198.

Directory of Open Access Journals (Sweden)

Catherine M Guzzo

Full Text Available SUMO-binding proteins interact with SUMO modified proteins to mediate a wide range of functional consequences. Here, we report the identification of a new SUMO-binding protein, ZNF261. Four human proteins including ZNF261, ZNF198, ZNF262, and ZNF258 contain a stretch of tandem zinc fingers called myeloproliferative and mental retardation (MYM-type zinc fingers. We demonstrated that MYM-type zinc fingers from ZNF261 and ZNF198 are necessary and sufficient for SUMO-binding and that individual MYM-type zinc fingers function as SUMO-interacting motifs (SIMs. Our binding studies revealed that the MYM-type zinc fingers from ZNF261 and ZNF198 interact with the same surface on SUMO-2 recognized by the archetypal consensus SIM. We also present evidence that MYM-type zinc fingers in ZNF261 contain zinc, but that zinc is not required for SUMO-binding. Immunofluorescence microscopy studies using truncated fragments of ZNF198 revealed that MYM-type zinc fingers of ZNF198 are necessary for localization to PML-nuclear bodies (PML-NBs. In summary, our studies have identified and characterized the SUMO-binding activity of the MYM-type zinc fingers in ZNF261 and ZNF198.

Influence of Corynebacterium parvum on the phagocytosis of 198Au colloids in rats

International Nuclear Information System (INIS)

Bergoc, R.M.; Bianchin, A.M.; Caro, R.A.; Ihlo, J.E.; Rivera, E.S.

1982-01-01

The kinetics of the phagocytosis of gelatin-protected 198 Au colloids in Wistar rats treated with Corynebacterium Parvum (CBP), was studied in order to explain its mechanism of immunomodulation. A previously developed extracorporeal blood circulation technique was used. The changes in the rate of phagocytosis, v, after the administration of CBP, for a dose of the 198 Au colloid smaller or higher than the substratum constant, were studied. In the first case, no significant changes of v were observed; in the second case, significant increases of v were determined, which reached a maximum 6 days after the CBP administration. The kinetic analysis of the obtained data indicates that the action of CBP is exerted on the stage of the entrance of the colloidal particle into the reticuloendothelial cell. (author) [es

198Au grain implantation for early tongue cancer in patients of advanced age or poor performance status

International Nuclear Information System (INIS)

Ryu, Yoshiharu; Shibuya, Hitoshi; Hayashi, Keiji

2013-01-01

Brachytherapy using 198 Au grains is minimally invasive and the only curative treatment for early tongue cancer in patients of advanced age or poor performance status available in our institution. From March 1993 to February 2008, 198 Au grains were used to treat a group of 96 Stage I–II tongue cancer patients who could not undergo surgery or brachytherapy using 192 Ir pins because of an advanced age (≥75 years) or poor performance status (≥2). The patients were followed for 3.9 ± 3.3 years, and the cause-specific survival and local control rates were determined. Survival analyses were performed using the Kaplan-Meier method, and univariate and multivariate analyses were performed using the Cox proportional hazard model. The results were compared with those for a group of 193 early tongue-cancer patients who underwent treatment using iridium pins. The 5-year cause-specific survival and local control rates of the 198 Au grains group were 71% and 68%, respectively, both of which were 16% lower than the corresponding rates for the 192 Ir pins group. Our study demonstrated that as the last curative treatment available, 198 Au grain implantation could be used to achieve moderate treatment results for early tongue cancer in patients of advanced age or poor performance status

SCM-198 inhibits microglial overactivation and attenuates Aβ(1-40)-induced cognitive impairments in rats via JNK and NF-кB pathways.

Science.gov (United States)

Hong, Zhen-Yi; Shi, Xue-Ru; Zhu, Kai; Wu, Ting-Ting; Zhu, Yi-Zhun

2014-08-19

Neuroinflammation mediated by overactivated microglia plays a key role in many neurodegenerative diseases, including Alzheimer's disease (AD). In this study, we investigated for the first time the anti-neuroinflammatory effects and possible mechanisms of SCM-198 (an alkaloid extracted from Herbaleonuri), which was previously found highly cardioprotective, both in vitro and in vivo. For in vitro experiments, lipopolysaccharide (LPS) or β-amyloid(1-40) (Aβ(1-40)) was applied to induce microglial overactivation. Proinflammatory mediators were measured and activations of NF-κB and mitogen-activated protein kinases' (MAPKs) pathways were investigated. Further protective effect of SCM-198 was evaluated in microglia-neuron co-culture assay and Sprague-Dawley (SD) rats intrahippocampally-injected with Aβ(1-40). SCM-198 reduced expressions of nitric oxide (NO), TNF-α, IL-1β and IL-6 possibly via, at least partially, inhibiting c-Jun N-terminal kinase (JNK) and NF-κB signaling pathways in microglia. Co-culture assay showed that activated microglia pretreated with SCM-198 led to less neuron loss and decreased phosphorylation of tau and extracellular signal-regulated kinase (ERK) in neurons. Besides, SCM-198 also directly protected against Aβ(1-40)-induced neuronal death and lactate dehydrogenase (LDH) release in primary cortical neurons. For in vivo studies, SCM-198 significantly enhanced cognitive performances of rats 12 days after intrahippocampal injections of aged Aβ(1-40) peptides in the Morris water maze (MWM), accompanied by less hippocampal microglial activation, decreased synaptophysin loss and phosphorylation of ERK and tau. Co-administration of donepezil and SCM-198 resulted in a slight cognitive improvement in SD rats 50 days after intrahippocampal injections of aged Aβ(1-40) peptides as compared to only donepezil or SCM-198 treated group. Our findings are the first to report that SCM-198 has considerable anti-neuroinflammatory effects on inhibiting

ramR Mutations Affecting Fluoroquinolone Susceptibility in Epidemic Multidrug-Resistant Salmonella enterica Serovar Kentucky ST198

Directory of Open Access Journals (Sweden)

Axel eCloeckaert

2013-07-01

Full Text Available A screening for non-target mutations affecting fluoroquinolone susceptibility was conducted in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198. Among a panel of representative isolates (n=30, covering the epidemic, only three showed distinct mutations in ramR resulting in enhanced expression of genes encoding the AcrAB-TolC efflux system and low increase in ciprofloxacin MIC. No mutations were detected in other regulatory regions of this efflux system. Ciprofloxacin resistance in serovar Kentucky ST198 is thus currently mainly due to multiple target gene mutations.

Synoviorthesis with sup 198 Au colloid gold in haemophilia patients. A preliminary report

Energy Technology Data Exchange (ETDEWEB)

Ortonowski, G.; Ziemski, J.M.; Kucharski, W.; Woy-Wojciechowski, J. (Institute of Haematology, Warsaw (Poland). Dept. of Surgery Institute of Clinical Medicine, Warsaw (Poland). Dept. of Nuclear Medicine)

1990-01-01

In 1988-1989 fifteen patients with severe haemophilia A and recurrent bleedings into the knee joint, aged from 19 to 44 years were treated by an intraarticular injection of {sup 198}Au colloid gold. So far 10 of them were assessed after 6 months follow-up. In 6 cases cessation and in 2 cases reduction in number and volume of bleeding were observed. Only in 2 patients the frequency of haemarthroses remained unchanged. No significant difference in tracer uptake was observed between pretreatment {sup 99m}Tc-pertrechnate gamma scans of the knee joints and controls completed 6 months after the radiogold injections. It is worthy to stress the lower costs of the {sup 198}Au synoviorthesis as compared with surgical synovectomy of the knee joint. The radioisotope method is also much less traumatic to the patient than the surgical one. (orig.).

Comparison of liver scintigraphy with /sup 99m/Tc-phytate and /sup 198/Au-colloid in diffuse hepatic disorders

Energy Technology Data Exchange (ETDEWEB)

Kamoi, I; Watanabe, K; Kawahira, K; Nakayama, C; Higashi, Y [Kyushu Univ., Fukuoka (Japan). Faculty of Medicine

1975-07-01

sup(99m)Tc-phytate was evaluated as a liver scintigraphic radiopharmaceutical, and the results were compared with those of /sup 198/Au-colloid. Both radionuclides were used on the same day in 55 cases of diffuse hepatic disorders. In 52 of the 55 cases, excellent liver images were obtained with sup(99m)Tc-phytate. Compared with /sup 198/Au-colloid, sup(99m)Tc-phytate was more highly concentrated in the spleen and bone marrow and with higher background radioactivity, although their distributions generally coincided. The known diagnostic criteria for liver scintigraphy with /sup 198/Au-colloid in diffuse hepatic disorders were proven applicable to sup(99m)Tc-phytate.

Tritium stripping in a nitrogen glove box using palladium/zeolite and SAES St 198 trademark

International Nuclear Information System (INIS)

Klien, J.E.; Wermer, J.R.

1995-01-01

Glove box clean-up experiments were conducted in a nitrogen glove box using palladium deposited on zeolite (Pd/z) and a SAES St 198 trademark getter as tritium stripping materials. Protium/deuterium samples spiked with tritium were released into a 620 liter glove box to simulate tritium releases in a 10,500 liter glove box. The Pd/z and the SAES St 198 trademark stripper beds produced a reduction in tritium activity of approximately two to three orders of magnitude and glove box clean-up was limited by a persistent background tritium activity level. Attempts to significantly reduce the glove box activity to lower levels without purging were unsuccessful

Determination of the distribution of urea in baled straw using 198Au

International Nuclear Information System (INIS)

Marten, F.; Walljahn, M.

1983-01-01

A measuring method for the qualitative determination of urea in big compacts of straw with high density using 198 Au are described. The method allows at low cost and expenditure of time to draw conclusions concerning the productive quality of application facilities and to make necessary corrections of adjusting parameters

Dosimetry considerations in the replacement of Radon-222 sources by gold-198 sources for the treatment of patients

International Nuclear Information System (INIS)

Swindon, T.N.

1978-10-01

Radon-222 sources have been used in Australia for the treatment of patients since 1929 and the calculation of absorbed doses from such sources is well established. An alternative to radon-222 is gold-198 which, in suitable form, may be used for permanent implantations and for surface, interstitial or intra-cavitary applications. Because radon-222 and gold-198 have different characteristics, the data to be used in calculating the absorbed dose to a point in a treatment volume will depend on the particular source used. The data are related to the energies and abundances of the beta and gamma rays emitted from the nuclei and on their half-lives (Tsub(1/2)). The energies of the beta and gamma rays emitted by radon-222 (in equilibrium with its decay products) and by gold-198 are given

Influence of Corynebacterium parvum on the phagocytosis of /sup 198/Au colloids in rats

Energy Technology Data Exchange (ETDEWEB)

Bergoc, R.M.; Bianchin, A.M.; Caro, R.A.; Ihlo, J.E.; Rivera, E.S. (Buenos Aires Univ. Nacional (Argentina). Facultad de Farmacia y Bioquimica)

1982-07-01

The kinetics of the phagocytosis of gelatin-protected /sup 198/Au colloids in Wistar rats treated with Corynebacterium Parvum (CBP), was studied in order to explain its mechanism of immunomodulation. A previously developed extracorporeal blood circulation technique was used. The changes in the rate of phagocytosis, v, after the administration of CBP, for a dose of the /sup 198/Au colloid smaller or higher than the substratum constant, were studied. In the first case, no significant changes of v were observed; in the second case, significant increases of v were determined, which reached a maximum 6 days after the CBP administration. The kinetic analysis of the obtained data indicates that the action of CBP is exerted on the stage of the entrance of the colloidal particle into the reticuloendothelial cell.

Three-dimensional viewing and dosimetric calculations of Au-198 implants of the prostate

International Nuclear Information System (INIS)

Avizonis, V.N.; Anderson, K.M.; Jani, S.K.; Hussey, D.H.

1991-01-01

Dose gradients for brachytherapy vary considerably in three dimensions, which complicates conventional two-dimensional dosimetry. Recent developments in computer graphics technology have enabled visualization of anatomy and radiation doses in three dimensions. The objective of this paper is to develop a three-dimensional viewing and dosimetry program for brachytherapy and to test this system in phantoms and in patients undergoing Au-198 implants in the prostate. Three-dimensional computer algorithms for the author's Silicon Graphics supercomputing workstation were developed, tested, and modified on the basis of studies in phantoms and patients. Studies were performed on phantoms of known dimensions and gold seeds in known locations to assess the accuracy of volume reconstruction, seed placement, and isodose distribution. Isodose curves generated with the three-dimensional system were compared with those generated by a Theratronics Treatment Planning Computer using conventional methods. Twenty patients with permanent Au-198 interstitial implants in the prostate were similarly studied

Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

Directory of Open Access Journals (Sweden)

Behera B.R.

2015-01-01

Full Text Available In this talk results of the evaporation residue (ER cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr and 16,18O+198Pt (forming compound nuclei 214,216Rn systems measured at Hybrid Recoil mass Analyzer (HYRA spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC, New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer’s fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

Science.gov (United States)

Behera, B. R.

2015-01-01

In this talk results of the evaporation residue (ER) cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr) and 16,18O+198Pt (forming compound nuclei 214,216Rn) systems measured at Hybrid Recoil mass Analyzer (HYRA) spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC), New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer's fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

Comparing the Methodologies in ASTM G198 Using Combined Hygrothermal-Corrosion Modeling

Science.gov (United States)

Samuel L. Zelinka

2013-01-01

ASTM G198, “Standard test method for determining the relative corrosion performance of driven fasteners in contact with treated wood,” was accepted by consensus and published in 2011. The method has two different exposure conditions for determining fastener corrosion performance in treated wood. The first method places the wood and embedded fasteners in a...

Dental size reduction in Indonesian Homo erectus: Implications for the PU-198 premolar and the appearance of Homo sapiens on Java.

Science.gov (United States)

Polanski, Joshua M; Marsh, Hannah E; Maddux, Scott D

2016-01-01

The recent recovery of a hominin maxillary third premolar, PU-198, within the faunal collections from Punung Cave (East Java) has led to assertions that Homo sapiens appeared on Java between 143,000 and 115,000 years ago. The taxonomic assignment of PU-198 to H. sapiens was based predominantly on the small size of the specimen, following an analysis which found little to no overlap in premolar size between Homo erectus and terminal Pleistocene/Holocene H. sapiens. Here, we re-evaluate the use of size in the taxonomic assignment of PU-198 in light of 1) new buccolingual and mesiodistal measurements taken on the fossil, 2) comparisons to a larger sample of H. erectus and H. sapiens maxillary third premolars, and 3) evidence of a diachronic trend in post-canine dental size reduction among Javan H. erectus. Our results demonstrate PU-198 to be slightly larger than previously suggested, reveal substantial overlap in premolar size between H. erectus and H. sapiens, and indicate a statistically significant reduction in premolar size between early and late Javan H. erectus. Our findings cast doubt on the assignment of PU-198 to H. sapiens, and accordingly, question the appearance of H. sapiens on Java between 143,000 and 115,000 years ago. Copyright © 2015 Elsevier Ltd. All rights reserved.

Negative Ion Source Development and Photodetachment Studies at ISOLDE

CERN Document Server

AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

Comparing the Methodologies in ASTM G198: Is There an Easy Way Out?

Science.gov (United States)

Samuel L. Zelinka

2013-01-01

ASTM(1) G198, Standard test method for determining the relative corrosion performance of driven fasteners in contact with treated wood, was accepted by consensus and published in 2011. The method has two different exposure conditions for determining fastener corrosion performance in treated wood. The first method places the wood and embedded...

Disruption of the Putative Vascular Leak Peptide Sequence in the Stabilized Ricin Vaccine Candidate RTA1-33/44-198

Directory of Open Access Journals (Sweden)

Charles B. Millard

2013-01-01

Full Text Available Vitetta and colleagues identified and characterized a putative vascular leak peptide (VLP consensus sequence in recombinant ricin toxin A-chain (RTA that contributed to dose-limiting human toxicity when RTA was administered intravenously in large quantities during chemotherapy. We disrupted this potentially toxic site within the more stable RTA1-33/44-198 vaccine immunogen and determined the impact of these mutations on protein stability, structure and protective immunogenicity using an experimental intranasal ricin challenge model in BALB/c mice to determine if the mutations were compatible. Single amino acid substitutions at the positions corresponding with RTA D75 (to A, or N and V76 (to I, or M had minor effects on the apparent protein melting temperature of RTA1-33/44-198 but all four variants retained greater apparent stability than the parent RTA. Moreover, each VLP(− variant tested provided protection comparable with that of RTA1-33/44-198 against supralethal intranasal ricin challenge as judged by animal survival and several biomarkers. To understand better how VLP substitutions and mutations near the VLP site impact epitope structure, we introduced a previously described thermal stabilizing disulfide bond (R48C/T77C along with the D75N or V76I substitutions in RTA1-33/44-198. The D75N mutation was compatible with the adjacent stabilizing R48C/T77C disulfide bond and the Tm was unaffected, whereas the V76I mutation was less compatible with the adjacent disulfide bond involving C77. A crystal structure of the RTA1-33/44-198 R48C/T77C/D75N variant showed that the structural integrity of the immunogen was largely conserved and that a stable immunogen could be produced from E. coli. We conclude that it is feasible to disrupt the VLP site in RTA1-33/44-198 with little or no impact on apparent protein stability or protective efficacy in mice and such variants can be stabilized further by introduction of a disulfide bond.

Lifetimes of excited states in 196, 198Pt; Application of interacting boson approximation model to even Pt isotopes systematics

Science.gov (United States)

Bolotin, H. H.; Stuchbery, A. E.; Morrison, I.; Kennedy, D. L.; Ryan, C. G.; Sie, S. H.

1981-11-01

The lifetimes and lifetime limits of the low-lying excited states up to and including the 6 1+ levels in 196, 198Pt were determined by the recoil-distance method (RDM). Gamma-ray angular distributions in 198Pt were also measured. These states were populated by multiple Coulomb excitation using 220 MeV 58Ni ion beams and the measurements were carried out in coincidence with back-scattered projectiles. The measured mean lives of the states and B(E2) values inferred for the transitions between levels are presented. These specific findings, and the observed structure systematics obtained from the combination of the present results and those of prior workers for the even 194-198Pt isotopes, are critically compared with our structure calculations employing the interacting boson approximation (IBA) model incorporating a symmetry-breaking quadrupole force; evaluative comparisons are also made with boson expansion theory (BET) calculations.

Lifetimes of excited states in 196,198Pt; application of interacting boson approximation model to even Pt isotopes systematics

International Nuclear Information System (INIS)

Bolotin, H.H.; Stuchbery, A.E.; Morrison, I.; Kennedy, D.L.; Ryan, C.G.; Sie, S.H.

1981-01-01

The lifetimes and lifetime limits of the low-lying excited states up to and including the 6 + 1 levels in sup(196, 198)Pt were determined by the recoil-distance method (RDM). Gamma-ray angular distributions in 198 Pt were also measured. These states were populated by multiple Coulomb excitation using 220 MeV 58 Ni ion beams and the measurements were carried out in coincidence with backscattering projectiles. The measured mean lives of the states and B(E2) values inferred for the transitions between levels are presented. These specific findings, and the observed structure systematics obtained from the combination of the present results and those of prior workers for the even sup(194-198)Pt isotopes, are critically compared with our structure calculations employing the interacting boson approximation (IBA) model incorporating a symmetry-breaking quadrupole force; evaluative comparisons are also made with boson expansion theory (BET) calculations. (orig.)

Development and therapeutic application of internally emitting radiopharmaceuticals

International Nuclear Information System (INIS)

Adelstein, S.J.; Bloomer, W.D.

1980-01-01

This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

Synthetic localization of a second toxin-binding region within residues α182-198 of Torpedo acetylcholine receptor

International Nuclear Information System (INIS)

Mulac-Jericevic, B.; Atassi, M.Z.

1986-01-01

A peptide, corresponding to the region 182-198 (peptide αT182-198) of the α chain of Torpedo californica acetylcholine (AChR) was synthesized, purified and characterized. The binding activities of this peptide to α-bungarotoxin and to cobratoxin were studied and compared to the activities of the previously reported synthetic peptide αT125-147 of Torpedo α chain. Binding studies were performed by quantitative radiometric titrations by studying the binding of 125 I-labelled peptides to toxin adsorbents and the binding of 125 I labelled toxins to peptide adsorbents. The specificity of the binding was confirmed by appropriate inhibition experiments. The results showed unequivocally that the α chain of AChR contains a second toxin binding region which resides within, but may not comprise all of, the residues 182-198. The binding of toxins to one synthetic region is inhibited by the other. Thus, the α chain of AChR contains at least two toxin binding regions which may either be two faces of a larger single binding site or, alternatively, two binding sites that are spatially very close and thus the binding of one synthetic region to the toxin site could sterically obstruct the binding of the second synthetic region

SCM-198 Ameliorates Cognitive Deficits, Promotes Neuronal Survival and Enhances CREB/BDNF/TrkB Signaling without Affecting Aβ Burden in AβPP/PS1 Mice.

Science.gov (United States)

Hong, Zhen-Yi; Yu, Shuang-Shuang; Wang, Zhi-Jun; Zhu, Yi-Zhun

2015-08-07

SCM-198 is an alkaloid found only in Herba leonuri and it has been reported to possess considerable neuroprotective effects in animal models of ischemic stroke, Parkinson's disease and Alzheimer's disease (AD). In this study, we demonstrated for the first time that 3-month oral SCM-198 treatment could significantly improve both recognition and spatial memory, inhibit microgliosis and promote neuronal survival in amyloid-β protein precursor and presenilin-1(AβPP/PS1) double-transgenic mice without affecting amyloid-β (Aβ) burden. In addition, decreases in cAMP-response element-binding protein (CREB) phosphorylation, brain-derived neurotrophic factor (BDNF) and tropomyosin-related kinase B (TrkB) phosphorylation were attenuated by SCM-198 both in vivo and in primary cortical neurons, which could be blocked by protein kinase A (PKA) inhibitors, suggesting the involvement of upstream PKA in enhancing the BDNF/TrkB/CREB signaling by SCM-198. Our results indicate that SCM-198, a drug that could promote neuronal survival and enhance BDNF/TrkB/CREB signaling, has beneficial effects on behavioral and biochemical alterations without affecting Aβ burden in AβPP/PS1 mice and might become a potential drug candidate for AD treatment in the future.

Outcomes of special histotypes of breast cancer after adjuvant endocrine therapy with letrozole or tamoxifen in the monotherapy cohort of the BIG 1-98 trial

DEFF Research Database (Denmark)

Munzone, E; Giobbie-Hurder, A; Gusterson, B A

2015-01-01

BACKGROUND: We investigated the outcomes of postmenopausal women with hormone receptor-positive, early breast cancer with special histotypes (mucinous, tubular, or cribriform) enrolled in the monotherapy cohort of the BIG 1-98 trial. PATIENTS AND METHODS: The intention-to-treat BIG 1-98 monothera...

SCM-198 Ameliorates Cognitive Deficits, Promotes Neuronal Survival and Enhances CREB/BDNF/TrkB Signaling without Affecting Aβ Burden in AβPP/PS1 Mice

Directory of Open Access Journals (Sweden)

Zhen-Yi Hong

2015-08-01

Full Text Available SCM-198 is an alkaloid found only in Herba leonuri and it has been reported to possess considerable neuroprotective effects in animal models of ischemic stroke, Parkinson’s disease and Alzheimer’s disease (AD. In this study, we demonstrated for the first time that 3-month oral SCM-198 treatment could significantly improve both recognition and spatial memory, inhibit microgliosis and promote neuronal survival in amyloid-β protein precursor and presenilin-1(AβPP/PS1 double-transgenic mice without affecting amyloid-β (Aβ burden. In addition, decreases in cAMP-response element-binding protein (CREB phosphorylation, brain-derived neurotrophic factor (BDNF and tropomyosin-related kinase B (TrkB phosphorylation were attenuated by SCM-198 both in vivo and in primary cortical neurons, which could be blocked by protein kinase A (PKA inhibitors, suggesting the involvement of upstream PKA in enhancing the BDNF/TrkB/CREB signaling by SCM-198. Our results indicate that SCM-198, a drug that could promote neuronal survival and enhance BDNF/TrkB/CREB signaling, has beneficial effects on behavioral and biochemical alterations without affecting Aβ burden in AβPP/PS1 mice and might become a potential drug candidate for AD treatment in the future.

COMBINED TREATMENT OF 198 CASES OF INSOMNIA WITH ACUPUNCTURE OF BODY ACUPOINTS PLUS PELLET PRESSING OF OTOPOINTS

Institute of Scientific and Technical Information of China (English)

李兰敏; 张立夫; 王丹

2001-01-01

Objective: To observe the therapeutic effect of acupuncture of body acupoints plus otopoint pelletpressing for treatment of insomnia. Methods: A total of 198 cases of insomnia patients were observed. Straight inserted the filiform needles into Shenmen (HT 7), Neiguan (PC 6), Zhaohai (KI 6) and Zusanli (ST 36) and manipulated the needles with uniform reinforcing-reducing method, then otopoints as Ershenmen (MA-TF 1 ), Shen (MA-SC), Gan (MA-SC 5), etc. were stimulated by pressing the stuck vaccaria seeds. Ten treatments were considered as a therapeutic course. Results: Of the 198 cases, 65 (32%) were cured, 76 (38%) had remarkable improvement, 53 (26%) had improvement and 4 (2%) had no effect, with the total effective rate being 97% Conclusion:Acupuncture of body acupoints plus otopoint pellet pressing works well in treatment of insomnia.

Application of 198Au colloid in the treatment of chronic knee synovial effusions

International Nuclear Information System (INIS)

Buril, J.; Zak, J.

1979-01-01

25 cases of chronic synovial exudates of the knee joint were treated with the use of 198 Au colloid (5mCi). Improvement was noted in two thirds of the patients after different numbers of applications (one to five). No improvement was seen in four cases of progressive polyarthritis or in two patients with gonarthrosis. This was to be expected though the number of the cases of the disease treated was very low. (author)

Experimental Observation of Anisotropic Adler-Bell-Jackiw Anomaly in Type-II Weyl Semimetal WTe1.98 Crystals at the Quasiclassical Regime

Science.gov (United States)

Lv, Yang-Yang; Li, Xiao; Zhang, Bin-Bin; Deng, W. Y.; Yao, Shu-Hua; Chen, Y. B.; Zhou, Jian; Zhang, Shan-Tao; Lu, Ming-Hui; Zhang, Lei; Tian, Mingliang; Sheng, L.; Chen, Yan-Feng

2017-03-01

The asymmetric electron dispersion in type-II Weyl semimetal theoretically hosts anisotropic transport properties. Here, we observe the significant anisotropic Adler-Bell-Jackiw (ABJ) anomaly in the Fermi-level delicately adjusted WTe1.98 crystals. Quantitatively, CW , a coefficient representing the intensity of the ABJ anomaly along the a and b axis of WTe1.98 are 0.030 and 0.051 T-2 at 2 K, respectively. We found that the temperature-sensitive ABJ anomaly is attributed to a topological phase transition from a type-II Weyl semimetal to a trivial semimetal, which is verified by a first-principles calculation using experimentally determined lattice parameters at different temperatures. Theoretical electrical transport study reveals that the observation of an anisotropic ABJ along both the a and b axes in WTe1.98 is attributed to electrical transport in the quasiclassical regime. Our work may suggest that electron-doped WTe2 is an ideal playground to explore the novel properties in type-II Weyl semimetals.

42 CFR 84.198 - Half-mask facepieces, full facepieces, mouthpieces, hoods, and helmets; fit; minimum requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Half-mask facepieces, full facepieces, mouthpieces... APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Chemical Cartridge Respirators § 84.198 Half-mask facepieces, full facepieces, mouthpieces, hoods, and helmets; fit; minimum requirements. (a) Half-mask facepieces...

Self-charging of 198Au-labeled monodisperse gold aerosols studied with a miniature electrical mobility spectrometer

International Nuclear Information System (INIS)

Yeh, H.C.; Newton, G.J.; Raabe, O.G.; Boor, D.R.

1976-01-01

Knowledge of the electrostatic character of an aerosol may be essential in assessing its potential inhalation hazard. In inhalation studies with radioactive aerosols, the aerosol charge state may change in the course of transport due to the emission of α, β or γ radiations. This paper describes an experimental study of the self-charging of 198 Au-labeled aerosols of monodisperse gold spheres by β emission. A miniature aerosol electrical mobility spectrometer, suitable for use in inhalation studies with radioactive aerosols, was developed and used in this study. This device is relatively inexpensive, easy to manufacture and its contamination by radioactive material has been minimized. Using polystyrene latex spheres, ranging in diameter from 0.176 to 1.18 μm, the spectrometer was calibrated with flow rates ranging from 400 to 4800 ml/min. Experiments with two sizes of 198 Au-labeled monodisperse gold aerosols were performed. Results indicate that the radioactivity of an aerosol can cause self-charging and affect the charge distribution. (author)

Lifetimes near the bandhead of a shears band in 198Pb

International Nuclear Information System (INIS)

Kruecken, R.; Kruecken, R.; Clark, R.M.; Deleplanque, M.A.; Diamond, R.M.; Fallon, P.; Lee, I.Y.; Macchiavelli, A.O.; Schmid, G.J.; Stephens, F.S.; Vetter, K.; Dewald, A.; Peusquens, R.; Brentano, P. von; Hauschild, K.

1998-01-01

Subpicosecond lifetimes of states near the bandhead of an M1 band in 198 Pb have been measured with the recoil-distance Doppler-shift technique using the Gammasphere array and the Cologne plunger. The deduced B(M1) values are in agreement with the predictions of the tilted axis cranking (TAC) model. Their spin dependence continues the trend set by recently published B(M1) values for the high spin states in this band. The emerging picture gives strong support to the concept of open-quotes magnetic rotation,close quotes an alternative mode for the generation of rotational spectra in nuclei. copyright 1998 The American Physical Society

Discovery of the 198 s X-Ray Pulsar GRO J2058+42

Science.gov (United States)

Wilson, Colleen A.; Finger, Mark H.; Harmon, B. Alan; Chakrabarty, Deepto; Strohmayer, Tod

1997-01-01

GRO J2058+42, a transient 198 second x-ray pulsar, was discovered by the Burst and Transient Source Experiment (BATSE) on the Compton Gamma-Ray Observatory (CGRO), during a "giant" outburst in 1995 September-October. The total flux peaked at about 300 mCrab (20-50 keV) as measured by Earth occultation. The pulse period decreased from 198 s to 196 s during the 46-day outburst. The pulse shape evolved over the course of the outburst and exhibited energy dependent variations. BATSE observed five additional weak outbursts from GRO J2058+427 each with two week duration and peak pulsed flux of about 15 mcrab (20-50 keV), that were spaced by about 110 days. An observation of the 1996 November outburst by the Rossi X-ray Timing Explorer (RXTE) Proportional Counter Array (PCA) localized the source to within a 4' radius error circle (90% confidence) centered on R.A. = 20 h 59 m.0, Decl. = 41 deg 43 min (J2000). Additional shorter outbursts with peak pulsed fluxes of about 8 mCrab were detected by BATSE halfway between the first four 15 mCrab outbursts. The RXTE All-Sky Monitor detected 8 weak outbursts with approximately equal durations and intensities. GRO J2058+42 is most likely a Be/X-ray binary that appears to outburst at periastron and apastron. No optical counterpart has been identified to date and no x-ray source was present in the error circle in archival ROSAT observations.

Discovery of the 198 Second X-Ray Pulsar GRO J2058+42

Science.gov (United States)

Wilson, Colleen A.; Finger, Mark H.; Harmon, B. Alan; Chakrabarty, Deepto; Strohmayer, Tod

1998-01-01

GRO J2058+42, a transient 198 s X-ray pulsar, was discovered by the Burst and Transient Source Experiment (BATSE) on the Compton Gamma Ray Observatory (CGRO) during a "giant" outburst in 1995 September-October. The total flux peaked at about 300 mcrab (20-50 keV) as measured by Earth occultation. The pulse period decreased from 198 to 196 s during the 46 day outburst. The pulse shape evolved over the course of the outburst and exhibited energy-dependent variations. BATSE observed five additional weak outbursts from GRO J2058 + 42, each with a 2 week duration and a peak-pulsed flux of about 15 mcrab (20-50 keV), that were spaced by about 110 days. An observation of the 1996 November outburst by the Rossi X-Ray Timing Explorer (RXTE) proportional counter array (PCA) localized the source to within a 4 s radius error circle (90% confidence) centered on R.A. = 20h 59m.0, decl. = 41 deg 43 s (J2000). Additional shorter outbursts with peak-pulsed fluxes of about 8 mcrab were detected by BATSE halfway between the first four 15 mcrab outbursts. The RXTE All-Sky Monitor detected all eight weak outbursts with approximately equal durations and intensities. GRO J2058 + 42 is most likely a Be/X-ray binary that appears to outburst at periastron and apastron, No optical counterpart has been identified to date, and no X-ray source was present in the error circle in archival ROSAT observations.

Percutaneous transperineal placement of gold 198 seeds for treatment of carcinoma of the prostate

Energy Technology Data Exchange (ETDEWEB)

Crusinberry, R.A.; Kramolowsky, E.V.; Loening, S.A.

1987-01-01

Thirty-one patients have been treated for carcinoma of the prostate with /sup 198/Au seeds placed transperineally using transrectal ultrasonic guidance. Twenty patients have been followed postoperatively for periods ranging from 3 to 31 months, with an average follow-up time of 12 months. Cumulative dose of radiation to the prostate calculated by dosimetry was either 9000 rads or 15,000 rads. Serial transrectal ultrasound examinations performed on these patients showed a decrease in prostate size in all patients within 6 months of treatment, with a statistically significant decrease observed between the third and sixth months. No significant difference in amount or rate of tumor regression was noted when tumor stage and grade were correlated to volume decrease after treatment. Patients who received the larger doses of radiation (15,000 rads) showed a significantly greater rate of decline in prostatic volume than those who received 9000 rads. Seven patients underwent prostate biopsy between 12 and 18 months after treatment; six biopsies showed residual tumor. Complications after treatment included urinary retention because of prostatic edema (three), radiation urethritis (three), and rectal ulceration (one). Transperineal placement of /sup 198/Au is well tolerated and offers an alternative to external beam radiation for treatment of carcinoma of the prostate.

Intrathecal application of /sup 198/Au colloid in acute leukemia and non-Hodgkin's lymphoma in chilhood. 2. Metaphylaxis of meningosis neoplastica

Energy Technology Data Exchange (ETDEWEB)

Metz, O; Unverricht, A; Stoll, W [Friedrich-Schiller-Universitaet, Jena (German Democratic Republic)

1979-08-01

7 children suffering from acute lymphatic leukemia (ALL) and non-Hodgkin's lymphoma, resp., were injected intrathecally with /sup 198/Au colloid for metaphylaxis. The children had been cured of 8 relapses of miningosis and received irregularly intrathecal injections of methotrexate for cerebral maintenance therapy. The median cerebral period of remission was 52 weeks. 1 child suffering from ALL had been free from meningosis relapses for 128 weeks. Continuous cytostatic therapy is necessary for methaphylaxis. However, despite of the good results presented, /sup 198/Au colloid can not be recommended for long-term therapy because radiation injuries are to be expected.

Study of solid phase kinetics during cyanidation using the 198 Au radioactive tracer

International Nuclear Information System (INIS)

Barbus, A.; Pop, I.I.; Gaspar, E.

1995-01-01

During cyanidation, the various gold bearing pyrite sorts exhibit different behaviour, that sometimes cause increased cyanidation times influencing the reagent and power consumption, in the same time generating fluctuations in the recovery efficiencies. The introduction of the 198 Au radioactive tracer into the cyanidation circuit enabled us to follow several parameters of the cyanidation kinetics: the average residence time of the gold bearing pyrite in the technological equipment, information about the homogenization process, dispersion of solids and gold dissolution efficiency on each technological stage. (author)

Letrozole compared with tamoxifen for elderly patients with endocrine-responsive early breast cancer: the BIG 1-98 trial

DEFF Research Database (Denmark)

Crivellari, D.; Sun, Z.; Coates, A.S.

2008-01-01

PURPOSE: To explore potential differences in efficacy, treatment completion, and adverse events (AEs) in elderly women receiving adjuvant tamoxifen or letrozole for five years in the Breast International Group (BIG) 1-98 trial. METHODS: This report includes the 4,922 patients allocated to 5 years...... of letrozole or tamoxifen in the BIG 1-98 trial. The median follow-up was 40.4 months. Subpopulation Treatment Effect Pattern Plot (STEPP) analysis was used to examine the patterns of differences in disease-free survival and incidences of AEs according to age. In addition, three categoric age groups were...... had superior efficacy (DFS) compared with tamoxifen in all age groups. On the basis of a small number of patients older than 75 years (6%), age per se should not unduly affect the choice of adjuvant endocrine therapy Udgivelsesdato: 2008/4/20...

T1 and T2 squamous cell carcinomas of the floor of the mouth: results of brachytherapy mainly using 198Au grains

International Nuclear Information System (INIS)

Matsumoto, Satoru; Takeda, Masamune; Shibuya, Hitoshi; Suzuki, Soji

1996-01-01

Purpose: To investigate the effectiveness of brachytherapy provided by this institution over a 25-year period, and to specifically verify the efficacy of 198 Au grain therapy, this study evaluated the outcomes in patients given brachytherapy for T1 and T2 squamous cell carcinomas (SCCs) of the floor of the mouth. Methods and Materials: A retrospective analysis of data from 90 patients with T1 and T2 SCCs of the floor of the mouth who underwent brachytherapy between 1965 and 1989. Therapy mainly consisted of 198 Au grain implants with or without external irradiation. As for the brachytherapeutic source, 15 patients were treated with radon seeds, 60 with 198 Au grains, 10 with radium needles, 3 with cobalt needles, and 2 with iridium hairpins. Based on the 1987 International Union Against Cancer (UICC) classification, the SCC stagings and number of cases per staging follow: Stage I (T1N0), 21 cases; Stage II (T2N0), 55 cases; and Stage III-IV (T1-2N1-2), 14 cases. The minimum follow-up time was 3 years. Results: The local control rates of these SCCs, based on tumor size, were 89% for T1 lesions, 76% for T2a (≤ 3 cm) lesions, and 56% for T2b (> 3 cm) lesions, and 82% for T1-2 lesions without a gingival involvement, in contrast to 55% for lesions with a gingival involvement (p 198 Au grain brachytherapy, local control was achieved in 93% of the T1 lesions, 79% of the T2a lesions, and in 56% of the T2b lesions. Further, the incidence of severe complications requiring surgery was low (5%). Conclusion: For T1N0 and T2aN0 SCCs of the floor of the mouth, excluding lesions with a gingival involvement, 198 Au grain brachytherapy alone or in combination with external radiotherapy was found to be efficacious

Preparation of magnetic composite based on zinc oxide nanoparticles and chitosan as a photocatalyst for removal of reactive blue 198

International Nuclear Information System (INIS)

Nguyen, Van Cuong; Nguyen, Ngoc Lam Giang; Hue Pho, Quoc

2015-01-01

In this study a novel magnetic composite used as a photocatalyst with combination of zinc oxide nanoparticles and chitosan (ZnO/Fe 3 O 4 /CS) was synthesized by a simple co-precipitation method. The role of the prepared magnetic nanocomposite is to improve the removal efficiency of textile dye due to the photocatalytic activity of zinc oxide nanoparticles and reusable capacity of Fe 3 O 4 magnetic nanoparticles. Constituents and structure properties of ZnO/Fe 3 O 4 /CS were investigated by scanning electron microscopy (SEM), x-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and thermogravimetric analysis (TGA). Magnetic property of the prepared composite was determined by vibrating sample magnetometer (VSM). The results demonstrated that ZnO/Fe 3 O 4 /CS nanocomposite dramatically improved the removal efficiency of reactive blue 198 dye (RB198) with high photocatalytic activity and easy separation by a permanent magnet. In addition, the photocatalytic activity of the prepared composite was also performed under different parameters such as contact time, initial pH, the amount of composite and initial concentration of RB198. Interestingly, ZnO/Fe 3 O 4 /CS nanocomposite still showed high removal efficiency after recycling three times and performed in a real textile dyeing wastewater. (paper)

Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

Energy Technology Data Exchange (ETDEWEB)

Claesson, Kristina

2011-05-15

In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

Evaluation of the liver scintigraphy with /sup 99m/Tc-Sn-colloid. II. C Clinical studies by comparison with /sup 198/Au-colloid

Energy Technology Data Exchange (ETDEWEB)

Kimura, K; Nishimura, T; Takeda, H; Furukawa, T [Osaka Univ. (Japan). Faculty of Medicine; Kajiya, Fumihiko

1975-08-01

Clinical significance of the liver scintigraphy with sup(99m)Tc-Sn-colloid was evaluated in comparison with those with /sup 198/Au-colloid. The liver scintigrams with sup(99m)Tc-Sn-colloid and /sup 198/Au-colloid were done in 36 cases of various hepatic diseases and RI accumulation curves in the liver and the spleen, and the blood disapearance curves were also obtained. The conclusions were as follows. The liver scintigrams with sup(99m)Tc-Sn-colloid proved to be more sensitive in the detection of tumors, especially, in the lower margin, left lobe and superficial layers of the liver than those with /sup 198/Au-colloid. In all cases, including normal and cirrhotic subjects, visualizations of the spleen were seen on the scintigrams with sup(99m)Tc-Sn-colloid. In diffuse hepatic diseases, comparing both radiopharmaceuticals, the splenic accumulations were studied qualitatively and quantitatively. As a result, the ratio (spleen/liver) was thought to be useful for the differentiation of diffuse hepatic diseases concerned with splenic function and/or size. It was also shown that sup(99m)Tc-Sn-colloid was useful as a spleen scanning agent. The Tl/2 in the liver accumulation curves with sup(99m)Tc-Sn-colloid were not as clearly differentiated in the various hepatic diseases as those with /sup 198/Au-colloid where those indexes were useful in the evaluation of liver functions.

Study of various processes for marking sediments with gold-198; Etude de divers procedes de marquages de sediments par l'or 198

Energy Technology Data Exchange (ETDEWEB)

Jeanneau, B [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-12-15

The use of radioactive isotopes for the study of sediment deposits is based mainly on two methods: marking in the mass - a glass of an element which can be activated replaces the sediment; surface marking - a physico-chemical process is used to deposit a radio-element at the surface of the sediment. The second process is used in particular for sands when it is advantageous to have a large number of particles for statistical analysis. The aim of this work was to develop a rapid and simple method of marking which could be applied on the actual site of the experiment where equipment, may be limited. The method recommended for marking sand with gold-198 is a combination of the Petersen (treatment with tin chloride) and Campbell (treatment with silver) methods combined with prior treatments with nitric acid and caustic soda. Using this method it is possible to deposit 125 mg of gold per kilo of sediment with a yield of 95 per cent (i.e. 10 Ci/kg) using a hydrochloric acid solution containing gold. The problem of the solidity of the deposits, of their value and of their reproducibility is discussed from the point of view of the mineral constitution of the sand. (author) [French] L'utilisation d'isotopes radioactifs pour l'etude des deplacements sedimentaires fait, principalement appel a deux methodes: le marquage massique - un verre contenant un element activable remplace le sediment; le marquage superficiel - un traitement physico-chimique permet de deposer un radioelement a la surface du sediment. Le second procede est surtout employe pour les sables lorsqu'il est utile de disposer d'un grand nombre de grains pour des raisons statistiques. Le but de ce travail etait de mettre au point une methode simple et rapide de marquage pouvant etre appliquee sur le site meme de l'experience pour les utilisateurs disposant d'un equipement limite. Le procede preconise pour le marquage des sables par l'or 198 est une combinaison des methodes Petersen (traitement au chlorure d

Gyromagnetic ratios of excited states in 198Pt; measurements and interacting boson approximation model calculations

Science.gov (United States)

Stuchbery, A. E.; Ryan, C. G.; Bolotin, H. H.; Morrison, I.; Sie, S. H.

1981-07-01

The enhanced transient hyperfine field manifest at the nuclei of swiftly recoiling ions traversing magnetized ferromagnetic materials was utilized to measure the gyromagnetic ratios of the 2 +1, 2 +2 and 4 +1 states in 198Pt by the thin-foil technique. The states of interest were populated by Coulomb excitation using a beam of 220 MeV 58Ni ions. The results obtained were: g(2 +1) = 0.324 ± 0.026; g(2 +2) = 0.34 ± 0.06; g(4 +1) = 0.34 ± 0.06. In addition, these measurements served to discriminate between the otherwise essentially equally probable values previously reported for the E2/M1 ratio of the 2 +2 → 2 +1 transition in 198Pt. We also performed interacting boson approximation (IBA) model-based calculations in the O(6) limit symmetry, with and without inclusion of a small degree of symmetry breaking, and employed the M1 operator in both first- and second-order to obtain M1 selection rules and to calculate gyromagnetic ratios of levels. When O(6) symmetry is broken, there is a predicted departure from constancy of the g-factors which provides a good test of the nuclear wave function. Evaluative comparisons are made between these experimental and predicted g-factors.

Comparison by quantitative scanning of the distribution in the body of yttrium-90 and gold-198 after intra-articular injection

International Nuclear Information System (INIS)

Williams, E.D.; Caughey, D.E.; John, M.B.; Hurley, P.J.

1975-01-01

A new radiopharmaceutical, yttrium-90 ferric hydroxide colloid, has been used to treat knee effusion in patients with rheumatoid arthritis. With a view to assessing absorbed radiation dose, a study was initiated to compare its body distribution with that of gold-198, which has also been used for this purpose. The treated knee was in each case scanned immediately after injection using a dual 5-inch detector scanner, and again two, four and seven days later, when the regional lymph nodes and liver were also scanned. Using calibration factors obtained by scanning water phantoms, data from the scans were used to calculate the percentage of the injected radioactivity in each site. Radioactivity in blood and urine was also measured. Ten knees have been treated, each with five mCi yttrium-90, and twelve with 10 mCi gold-198. The treated knee was immobilized, and the patient rested in bed for four days, to minimize loss of radioactivity from the knee. With this procedure, both radionuclides were found to be equally well retained in the knee. However, the lymph node uptake of yttrium was lower than for gold. Yttrium-90 emits only beta radiation, so the gonadal radiation done in patients treated with yttrium-90 is estimated to be much less than in those treated with gold-198. (author)

Molecular risk assessment of BIG 1-98 participants by expression profiling using RNA from archival tissue

International Nuclear Information System (INIS)

Antonov, Janine; Altermatt, Hans Jörg; Aebi, Stefan; Jaggi, Rolf; Popovici, Vlad; Delorenzi, Mauro; Wirapati, Pratyaksha; Baltzer, Anna; Oberli, Andrea; Thürlimann, Beat; Giobbie-Hurder, Anita; Viale, Giuseppe

2010-01-01

The purpose of the work reported here is to test reliable molecular profiles using routinely processed formalin-fixed paraffin-embedded (FFPE) tissues from participants of the clinical trial BIG 1-98 with a median follow-up of 60 months. RNA from fresh frozen (FF) and FFPE tumor samples of 82 patients were used for quality control, and independent FFPE tissues of 342 postmenopausal participants of BIG 1-98 with ER-positive cancer were analyzed by measuring prospectively selected genes and computing scores representing the functions of the estrogen receptor (eight genes, ER-8), the progesterone receptor (five genes, PGR-5), Her2 (two genes, HER2-2), and proliferation (ten genes, PRO-10) by quantitative reverse transcription PCR (qRT-PCR) on TaqMan Low Density Arrays. Molecular scores were computed for each category and ER-8, PGR-5, HER2-2, and PRO-10 scores were combined into a RISK-25 score. Pearson correlation coefficients between FF- and FFPE-derived scores were at least 0.94 and high concordance was observed between molecular scores and immunohistochemical data. The HER2-2, PGR-5, PRO-10 and RISK-25 scores were significant predictors of disease free-survival (DFS) in univariate Cox proportional hazard regression. PRO-10 and RISK-25 scores predicted DFS in patients with histological grade II breast cancer and in lymph node positive disease. The PRO-10 and PGR-5 scores were independent predictors of DFS in multivariate Cox regression models incorporating clinical risk indicators; PRO-10 outperformed Ki-67 labeling index in multivariate Cox proportional hazard analyses. Scores representing the endocrine responsiveness and proliferation status of breast cancers were developed from gene expression analyses based on RNA derived from FFPE tissues. The validation of the molecular scores with tumor samples of participants of the BIG 1-98 trial demonstrates that such scores can serve as independent prognostic factors to estimate disease free survival (DFS) in

Diagnostic Significance of the Blood Disappearance Rate of 131I-Rose Bengal and of 198Au colloid in Hepatobiliary Diseases

International Nuclear Information System (INIS)

Chun, Young Kyoon; Hahn, Shim Suk; Koh, Chang Soon

1971-01-01

The liver function test was performed by means of two radioisotope tracer techniques in 20 normal subjects and in 63 patients with hepatobiliary diseases. The blood disappearance rates of 131 I-rose bengal and of 198 Au colloid were determined by external counting method. The hepatocellular function and the hepatic blood flow were estimated from the observed data and the results were compared with those of the conventional liver function tests. The results obtained were as follows: 1. The mean blood disappearance half time of 131 I-rose bengal was 6.6±0.63 minutes in normal control, 17.7±6.93 in cirrhosis of the liver, 16.6±4. 80 in acute hepatitis, and 14 7±3.46 in obstructive jaundice. It was markedly prolonged in the hepatobiliary diseases as compared with the normal control, but there was no significant difference among the hepatobiliary diseases. 2.The mean blood disappearance half time of 198 Au colloid was 4. 0±0. 66 minutes in normal control, 9.8±3.42 in cirrhosis of the liver, 4.4±0.82 in acute hepatitis, and 5.0±1.42 in obstructive jaundice. The difference between cirrhosis of the liver and normal control was statistically significant. However, there was no definite difference among acute hepatitis, obstructive jaundice, and normal control. The mean blood disappearance rate constant (K value) was 0.177±0.028/minute in normal control, In cirrhosis of the liver, it was markedly decreased which was suggestive of the reduced hepatic blood flow. 3. The ratio of 131 I-rose bengal blood disappearance half time to 198 Au colloid disappearance half time was 1.68±0.20 in normal control, 1.82±0.31 in cirrhosis of the liver, 3.80±0.82 in acute hepatitis, and 3.01±0.54 in obstructive jaundice. The ratios in acute hepatitis and obstructive jaundice were remarkably higher than those in normal control and cirrhosis of the liver. 4. There was a significant correlation between the blood disappearance half time of 131 I-rose bengal and that of 198 Au colloid in

GPX1 Pro(198)Leu polymorphism, erythrocyte GPX activity, interaction with alcohol consumption and smoking, and risk of colorectal cancer

DEFF Research Database (Denmark)

Hansen, Rikke Dalgaard; Krath, Britta N.; Frederiksen, Kirsten

2009-01-01

polymorphism and several lifestyle factors predict GPX activity in erythrocytes. The present study was nested within the prospective “Diet, Cancer and Health” study of 57,053 Danes including 375 colorectal cancer cases and a comparison group of 779 individuals matched on gender. Biomaterial was sampled...... and information on lifestyle factors was obtained from questionnaires filled in at enrolment in 1993–1997. GPX1 Pro198Leu, hOGG1 Ser326Cys and erythrocyte GPX enzyme activity were not associated with risk of colorectal cancer. We observed a higher risk associated with alcohol consumption and smoking among......198Leu genotype, gender, smoking intensity, and intake of fruits and vegetables. Our results indicate that lifestyle-related oxidative stress may be a risk factor for colorectal cancer among subjects with a lowered defence....

Total internal conversion coefficient of the 260. 9 keV (7/sup +/->3/sup -/) transition in sup(198m)Tl

Energy Technology Data Exchange (ETDEWEB)

Venkateswara Rao, N.; Suryanarayana, C.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satynarayana, G.; Sastry, D.L.; Chintalapudi, S.N.

1986-02-21

The 1.87 hours 543.7 keV (7/sup +/) isomeric state in /sup 198/Tl is produced via /sup 197/Au(..cap alpha.., 3n)sup(198m)Tl (Esub(..cap alpha..) = 35 MeV) reaction. The total conversion coefficient of 260.9 keV (7/sup +/ -> 3/sup -/) is determined for the first time by the intensity balance method. The value of ..cap alpha..sub(T)(260.9 keV) is found to be 40.1 +- 8.6 which is in good agreement with the theoretical value of Hager and Seltzer for pure M4 transition. The gamma transition probability of the 260.9 keV (M4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate.

Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

International Nuclear Information System (INIS)

Koziorowski, J.

1998-01-01

Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

Coulomb excitation of the 4+1 states of 194Pt, 196Pt and 198Pt

International Nuclear Information System (INIS)

Fewell, M.P.; Gyapong, G.J.; Spear, R.H.

1987-09-01

Probabilities for the Coulomb excitation of the 4 1 + states of 194 Pt, 196 Pt, 198 Pt by the backscattering of 4 He, 12 C and 16 O ions are reported. Model-independent values of the matrix elements 1 + ; M(E4), 4 1 + > and 1 + , M(E2), 4 1 + > are extracted. Agreement with previous measurements of these matrix elements is good. Values of β 2 and β 4 are determined for 194 Pt and compared with calculations of these quantities

Gyromagnetic ratios of low-lying excited states in the even 192-198Pt isotopes; experimental measurements and theoretical predictions

International Nuclear Information System (INIS)

Stuchbery, A.E.; Ryan, C.G.; Morrison, I.; Bolotin, H.H.

1981-01-01

The gyromagnetic ratios of the 2 2 + and 4 1 + states in 196 Pt were measured relative to that of its 2 1 + level. The thin-foil IMPAC technique was employed utilizing the enhanced transient hyperfine magnetic field present at the nuclei of swiftly recoiling ions traversing magnetized ferromagetic materials. The states of interest were populated by Coulomb excitation using beams of 220-MeV 58 Ni ions. For g(2 1 + ) taken as 0.326+-0.014, the present measurements yielded g(2 2 + ) = 0.30+-0.06 and g(4 1 + ) 0.30+-0.05. These results and those reported by prior workers for the g-factors of corresponding levels in 192 Pt, 194 Pt, 198 Pt are used to trace the systematics of the magnetic moments of these low-lying levels in the even 192 - 198 Pt isotopes. Interacting Boson Approximation model-based calculations of the g-factors of these states were also carried out. The experimental theoretical results are compared

STDとしての男子尿道炎・子宮頸管炎の疫学的・治療学的研究 - NY-198(Lomefloxacin)による検討 -

OpenAIRE

熊本, 悦明; 広瀬, 崇興; 林, 謙治; 郷路, 勉; 児玉, 直彦; 宮岸, 武弘; 上野, 了; 毛利, 和弘; 阿部, 清孝

1990-01-01

Urethritis in males and cervicitis in females, which were sexually transmitted diseases, were treated with NY-198, a new quinolone antibiotic, and its efficacy was studied. Seventeen male patients with gonorrheal urethritis were administered a single 300 mg dose of NY-198. The efficacy rate on the 3rd day after administration was 100%, but it was 85.7% on the 7th day due to recurrence in 1 patient. The results of treatment of non-gonorrheal infections were as follow. In this treatment, NY-198...

Dynamic and scintigraphic studies of diffuse hepatic diseases using /sup 99m/Tc-Sn-phytate. Comparative analyses with /sup 198/Au-colloid

Energy Technology Data Exchange (ETDEWEB)

Akisada, M [Mitsui Memorial Hospital, Tokyo (Japan); Miyamae, T

1975-09-01

From March 1974 to May 1974, liver scintigraphies were performed at Mitsui Memorial Hospital. Three groups of patients were composed of: 24 of liver cirrhosis, 29 of chronic hepatitis and 30 of a normal control group. The mixture of 1.5 mCi of sup(99m)Tc-phytate and 30 ..mu..Ci of /sup 198/Au-colloid were injected rapidly. Ksub(L) value of sup(99m)Tc-phytate in the liver cirrhosis group was lower than the chronic hepatitis group, which was lower than the normal group. The correlation between Tsub(1/2) (L) and Tsub(1/2)(P): In the normal group, the coefficient correlation between Tsub(1/2)(L) and Tsub(1/2)(P) was fairly good both in sup(99m)Tc-phytate and in /sup 198/Au-colloid, whereas the correlation was low in the chronic hepatitis group and liver cirrhosis group. The how correlation between the Ksub(L) values of sup(99m)Tc-phytate and /sup 198/Au-colloid: The correlation of the Ksub(L) value was low in all three groups. Ksub(L) values in sup(99m)Tc-phytate were higher than they were in /sup 198/Au-colloid in all three groups. When each probe was placed on the temporal and thigh region simultaneously for obtaining the peripheral blood clearance, the Tsub(1/2)(P) value (temporal) was always smaller than the Tsub(1/2)(P) value (thigh). Grade of kidney visualization in liver scintigraphy using sup(99m)Tc-phytate: Kidney activities were seen in 72.9% of 83 patients and there was no grade difference between the normal,chronic hepatitis and liver cirrhosis group. An additional attempt to determine the nature and size of ''sup(99m)Tc-phytate in vivo colloid'', Ca ion was added to sup(99m)Tc-phytate solution prior to the injection. Lung, spleen, and liver were simultaneously visualized using this ''in vitro sup(99m)Tc-phytate minicolloid''.

Diagnostic Significance of the Blood Disappearance Rate of {sup 131}I-Rose Bengal and of {sup 198}Au colloid in Hepatobiliary Diseases

Energy Technology Data Exchange (ETDEWEB)

Chun, Young Kyoon; Hahn, Shim Suk; Koh, Chang Soon [Seoul National University College of Medicine, Seoul (Korea, Republic of)

1971-09-15

The liver function test was performed by means of two radioisotope tracer techniques in 20 normal subjects and in 63 patients with hepatobiliary diseases. The blood disappearance rates of {sup 131}I-rose bengal and of {sup 198}Au colloid were determined by external counting method. The hepatocellular function and the hepatic blood flow were estimated from the observed data and the results were compared with those of the conventional liver function tests. The results obtained were as follows: 1. The mean blood disappearance half time of {sup 131}I-rose bengal was 6.6+-0.63 minutes in normal control, 17.7+-6.93 in cirrhosis of the liver, 16.6+-4. 80 in acute hepatitis, and 14 7+-3.46 in obstructive jaundice. It was markedly prolonged in the hepatobiliary diseases as compared with the normal control, but there was no significant difference among the hepatobiliary diseases. 2.The mean blood disappearance half time of {sup 198}Au colloid was 4. 0+-0. 66 minutes in normal control, 9.8+-3.42 in cirrhosis of the liver, 4.4+-0.82 in acute hepatitis, and 5.0+-1.42 in obstructive jaundice. The difference between cirrhosis of the liver and normal control was statistically significant. However, there was no definite difference among acute hepatitis, obstructive jaundice, and normal control. The mean blood disappearance rate constant (K value) was 0.177+-0.028/minute in normal control, In cirrhosis of the liver, it was markedly decreased which was suggestive of the reduced hepatic blood flow. 3. The ratio of {sup 131}I-rose bengal blood disappearance half time to {sup 198}Au colloid disappearance half time was 1.68+-0.20 in normal control, 1.82+-0.31 in cirrhosis of the liver, 3.80+-0.82 in acute hepatitis, and 3.01+-0.54 in obstructive jaundice. The ratios in acute hepatitis and obstructive jaundice were remarkably higher than those in normal control and cirrhosis of the liver. 4. There was a significant correlation between the blood disappearance half time of {sup 131}I

Preparation and characterization of monodisperse microcapsules with alginate and bentonite via external gelation technique encapsulating Pseudomonas putida Rs-198.

Science.gov (United States)

Li, Xuan; Wu, Zhansheng; He, Yanhui; Ye, Bang-Ce; Wang, Jun

2017-10-01

This paper evaluated the external gelation technique for preparing microcapsules. The microcapsules were consisted of Pseudomonas putida Rs-198 (Rs-198) core and sodium alginate (NaAlg)-bentonite (Bent) shell. Different emulsification rotation speeds and core/shell ratios were used to prepare the microcapsules of each formulation. The near-spherical microcapsules were monodisperse with a mean diameter of 25-100 μm and wrinkled surfaces. Fourier transform infrared spectrophotometry (FTIR) and thermogravimetric analysis (TGA) revealed the physical mixture of the wall material and the superior thermal stability of the microcapsules. Percentage yield, water content, and encapsulation efficiency were evaluated and correlated with the changes in emulsification rotation speed and core/shell ratio. In vitro release experiments demonstrated that 60% of the bacteria were released from the NaAlg-Bent microcapsules within three days. Considerably better survival was observed for encapsulated cells compared to free cells, especially in pH 4.0 and 10.0. In summary, the desired properties of microcapsules can be obtained by external gelation technique and the microcapsules on the bacteria had a good protective effect.

Test of time reversal invariance in p-p elastic scattering at 198.5 MeV

International Nuclear Information System (INIS)

Davis, C.A.; Greeniaus, L.G.; Moss, G.A.

1986-01-01

A precise measurement of the polarization-analyzing power difference in p-p elastic scattering has been made at 198.5 MeV to improve the experimental limits on time reversal violation in proton-proton scattering in this energy region. The experiment was performed in a kinematic regime where sensitivities to time reversal violating amplitudes should be high. Experimental methods which eliminated the need to refer to absolute values of the beam polarization or to the analyzing power of a polarimeter were used. The result is (P-A) = 0.0047 with a statistical uncertainty of +- 0.0025 and a systematic uncertainty of +- 0.0015

Cholesterol, Cholesterol-Lowering Medication Use, and Breast Cancer Outcome in the BIG 1-98 Study

DEFF Research Database (Denmark)

Borgquist, Signe; Giobbie-Hurder, Anita; Ahern, Thomas P

2017-01-01

on cholesterol levels and hypercholesterolemia per se may counteract the intended effect of aromatase inhibitors. Patients and Methods The Breast International Group (BIG) conducted a randomized, phase III, double-blind trial, BIG 1-98, which enrolled 8,010 postmenopausal women with early-stage, hormone receptor......-positive invasive breast cancer from 1998 to 2003. Systemic levels of total cholesterol and use of CLM were measured at study entry and every 6 months up to 5.5 years. Cumulative incidence functions were used to describe the initiation of CLM in the presence of competing risks. Marginal structural Cox proportional...

Use of special radioactive molds of gold-198 foils for brachytherapy in skin tumors

International Nuclear Information System (INIS)

Fernandes, Marco Antonio Rodrigues

2000-01-01

This work presents a methodology for manufacturing molds of radioactive gold-198 foils for treatment of skin tumors. The metallic purity of the gold foils produced by the Brazilian market is analyzed and compared to the characteristics of imported materials. Techniques for analyses of the activation homogeneity and dose profile in the plane of the mold are presented. The MicroShield, Version 4 System is used in the theoretical determination of the dose rate along the radioactive molds with different geometries and a comparison with experimental values obtained by optic density readings from special films used in quality control of radiotherapy equipment, dosimetry for thimble ionization chamber and thermoluminescent dosimeters is performed. The dosimeter calibration curve (dose-answer) obtained for the gold-198 energy, is compared with that obtained by a high dose rate iridium-192 small source, commonly used in the brachytherapy procedures. The studies show that the best homogeneity of dose distribution is obtained distributing the radioactive material in the form of concentric rings, with different activities, in number and dimensions dependent on the area to be treated. The method of the radiation dose calculation of the molds presented in this work, is compared with the traditional method used by brachytherapy services for low dose rate. Twenty lesions were treated with the proposed molds. The effectiveness of this methodology is further supported by the cosmetic-therapeutic results of the clinical applications, as well as cost analysis of the procedures. Also, it is analyzed the homogeneity of the dose rate distribution for an irradiated disk with attenuation by two silver coin, objectifying to eliminate loss of mass and consequently uncertainties in the activation when the sections of the disks are made in concentric rings. (author)

The extraction of low-concentrations of gold(I) with 198Au as a radiotracer

International Nuclear Information System (INIS)

Jianzhun Jiang; Chunli Liu; Weijin Zhou; Hongcheng Gao

2002-01-01

The solvent extraction of gold from alkaline cyanide solution was studied by using 198 Au as a radiotracer. The influence of several variables on the gold extraction, including the concentration of gold, the molar ratio of extractants to gold(I), the volume percentage of cosolvent and the pH value of the aqueous phase, was investigated. The results indicated that the radioactive tracer technique is a quick, accurate, and convenient tool to investigate the extraction behavior of an element existing in low concentrations. The experimental results indicated that the studied amines, tetradecyldimethylbenzylammonium chloride, N1923 and tri-n-octylamine, could be used as extractants for the recovery of gold from aqueous alkaline cyanide solutions. (author)

Application of gold-198 in investigation of technological processes in cellulose and paper industry and in production of combined forage

International Nuclear Information System (INIS)

Petkov, P.M.; Kralev, Kh.I.

1979-01-01

To label cellulose fibers and sawdust in investigation of acting installations for production of cellulose and semicellulose, gold-198 was used. The aim of investigation was to determine time of material's transfer in the cellulose production shop from the boiler to the outlet from washer and in the semicellulose production shop from the feeding bunker to refiners. Stable labelling of the cellulose fibers and sawdust has been gained, which permitted successfully to perform investigations of two installations in spite of high temperature and pressure and aggressive medium. Gold-198 is also a good indicator in investigations of technological lines of feed mills. After labelling of one of the main components of fodder mixture, it is introduced into mixer in the proportion used in the production for mixing. It is possible to trace process of mixing either by means of continious registering of by means of sampling. As a result of investigations, optimal time of mixing, segregation processes influence of the factory transport and intershop idle stand on the homogenity of product for factories with different equipment, can be determined [ru

The global establishment of a highly-fluoroquinolone resistant Salmonella enterica serotype Kentucky ST198 strain

Directory of Open Access Journals (Sweden)

Simon eLe Hello

2013-12-01

Full Text Available While the spread of Salmonella enterica serotype Kentucky resistant to ciprofloxacin across Africa and the Middle-East has been described recently, the presence of this strain in humans, food, various animal species (livestock, pets, and wildlife and in environment is suspected in other countries of different continents. Here, we report results of an in-depth molecular epidemiological study on a global human and non-human collection of S. Kentucky (n=70.We performed XbaI-pulsed field gel electrophoresis and multilocus sequence typing, assessed mutations in the quinolone resistance-determining regions, detected β-lactam resistance mechanisms, and screened the presence of the Salmonella genomic island 1 (SGI1. In this study, we highlight the rapid and extensive worldwide dissemination of the ciprofloxacin-resistant S. Kentucky ST198-X1-SGI1 strain since the mid-2000s in an increasingly large number of contaminated sources, including the environment. This strain has accumulated an increasing number of chromosomal and plasmid resistance determinants and has been identified in the Indian subcontinent, Southeast Asia and Europe since 2010. The second substitution at position 87 in GyrA (replacing the amino acid Asp appeared helpful for epidemiological studies to track the origin of contamination.This global study provides evidence leading to the conclusion that high-level resistance to ciprofloxacin in S. Kentucky is a simple microbiological trait that facilitates the identification of the epidemic clone of interest, ST198-X1-SGI1. Taking this into account is essential in order to detect and monitor it easily and to take rapid measures in livestock to ensure control of this infection.

Development of a tetra-primer ARMS-PCR for detecting the E198A SNP in the isotype-1 β-tubulin gene of Haemonchus contortus populations in China.

Science.gov (United States)

Zongze, Zhang; Xin, Yang; Awais, Ali Ahmad; Weiqiang, Lei; Chunqun, Wang; Di, Wenda; Yanqin, Zhou; Junlong, Zhao; Rui, Fang; Min, Hu

2018-03-15

The tetra-primer ARMS-PCR is a rapid, simple and low cost method for single nucleotide polymorphism (SNP) genotyping and has been used to detect SNPs associated with diseases and drug resistance. E198A in the isotype-1 β-tubulin gene is one of the three SNPs associated with benzimidazole resistance in parasitic nematode Haemonchus contortus. However, up to now, only PCR-RFLP method was used to test E198A in H. contortus. In the present study, we developed a tetra-primer ARMS-PCR to detect E198A in H. contortus and the accuracy of the results was compared with that of PCR-coupled sequencing. The results showed that optimization of PCR reaction system, especially the proportion of the amount of inner and outer primers, could achieve desirable amplification effect. Three different profiles displaying three distinct genotypes could be identified clearly and intuitively on the agarose gel where the samples with amplified PCR products containing two bands of 433 bp and 200 bp in size indicated susceptible homozygous (SS), those with PCR products containing two bands of 433 bp and 284 bp in length indicated resistant homozygous (RR) and the samples with amplified PCR products containing three bands of 433 bp, 284 bp and 200 bp in size indicated heterozygous (RS). The results showed that the established method can be successfully applied to the detection of E198A in H. contortus, which has high accuracy and is easy to perform. Copyright © 2018 Elsevier B.V. All rights reserved.

Hepatic blood flow with colloidal 198Au in the diagnosis of chronic hepatitis in children

International Nuclear Information System (INIS)

Marian, L.; Szantay, V.

1975-01-01

Tracer quantities of colloidal 198 Au were used to estimate the hepatic blood flow in normal children and in children with active or progressive chronic hepatitis and also to obtain scintigrams of the liver. In active chronic hepatitis a significant decrease in HBF values was observed, suggesting that the method may be used as a diagnostic criterion which is superior to hepatic scintigraphy. In progressive chronic hepatitis HBF values even lower than those in active hepatitis were observed. Together with more characteristic clinical findings and abnormal results of biochemical function tests, they underline the value of the method in estimating the severity and the evolution of the disease. (orig.) [de

Test of Magnetic Rotation near the band head in ^197,198Pb

Science.gov (United States)

Krücken, R.; Clark, R. M.; Deleplanque, M. A.; Diamond, R. M.; Fallon, P.; Macchiavelli, A. O.; Lee, I. Y.; Schmid, G. J.; Stephens, F. S.; Vetter, K.; Dewald, A.; Peusquens, R.; von Brentano, P.; Baldsiefen, G.; Chmel, S.; Hübel, H.; Becker, J. A.; Bernstein, L. A.; Hauschild, K.

1998-04-01

The concept of magnetic rotation is tested near the band head of shears-bands in ^197,198Pb by means of a lifetime experiment with the recoil distance method (RDM). The experiment was performed using the Gammasphere array in conjunction with the Cologne Plunger. The B(M1) values extracted from the measured lifetimes can prove the applicability of the concept of magnetic rotation for the states near the band head of these shears bands. The RDM results are compared with tilted axis cranking and shell model calculations. Furthermore the results will be used to test earlier DSAM lifetime measurements for states at higher spins. Preliminary results of this topic will be presented. This work is supported by DOE grant numbers DE-AC03-76SF00098 (LBNL), DE-FG02-91ER40609 (Yale), W-7405-ENG-48 (LLNL) and by the German BMBF for Cologne (No. 06 OK 668) and Bonn.

Measurement of {sup 197}Au(n,γ){sup 198g}Au reaction cross-section at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV

Energy Technology Data Exchange (ETDEWEB)

Vansola, Vibha [M.S. Univ., Baroda (India). Dept. of Physics; Ghosh, Reetuparna; Badwar, Sylvia [North Eastern Hill Univ., Meghalaya (India). Dept. of Physics; and others

2015-07-01

The {sup 197}Au(n,γ){sup 198}Au reaction cross-sections at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV were determined by using activation and off-line γ-ray spectrometric technique. The mono-energetic neutron energies of 1.12-4.12 MeV were generated from the {sup 7}Li(p,n) reaction by using the proton energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at BARC as well as 5 and 6 MeV from the Pelletron facility at TIFR, Mumbai. The {sup 115}In(n,γ){sup 116m}In reaction cross-section was used as the neutron flux monitor. The {sup 197}Au(n,γ){sup 198}Au reaction cross-section at the neutron energies of 3.12 and 4.12 MeV are reported for the first time. The {sup 197}Au(n,γ){sup 198}Au reaction cross-sections at 1.12 and 2.12 MeV are close to the literature data of in between neutron energies. The {sup 197}Au(n,γ){sup 198}Au cross-section was also calculated theoretically by using the computer code TALYS 1.6 and found to be higher than the experimental data of present work and literature data within the neutron energies of 0.8 to 4 MeV.

Astatine-211 labeling. A study towards automatic production of astatinated antibodies

International Nuclear Information System (INIS)

Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

2015-01-01

Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

Use of 198 Au, with surface labelling, in the study of solid transport by bed load in large natural channels

International Nuclear Information System (INIS)

Nakahira, S.

1987-01-01

The present study aims to present a method of measuring the bed load transport using a radioisotope technique in large natural channels. This study describes the basic principles of radioisotope application in this field, emphasizing the use of 198 Au for surface labelling of a natural sediment. Moreover, it presents the theoretical aspects, critical analysis, recommendations and comments on the methodology proposed. (author)

The Blood Disappearance Rate of 198Au-Colloid and Changes of Hepatic Blood Flow During Position Change in Normal Persons and in Patients with Various Hepatic Diseases

International Nuclear Information System (INIS)

Cho, Bo Yeon; Hong, Kee Suk; Koh, Chang Soon; Lee, Mun Ho

1977-01-01

To evaluate the diagnostic significance of the blood disappearance rate of 198 Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of 198 Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1) In normal control, the mean blood disappearance half time of 198 Au-colloid in supine position was 2.7±0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2) In acute hepatitis, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0±0.45, 3.5±0.74, 7.2±3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3) In the normal control and acute hepatitis, the decreases of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively.

Associations between GPX1 Pro198Leu polymorphism, erythrocyte GPX activity, alcohol consumption and breast cancer risk in a prospective cohort study

DEFF Research Database (Denmark)

Ravn-Haren, Gitte; Olsen, A.; Tjonneland, A.

2006-01-01

Breast cancer may be related to oxidative stress. Breast cancer patients have been reported to have lower antioxidant enzyme activity than healthy controls and the polymorphism GPX1 Pro198Leu has been associated with risk of lung and breast cancer. The purpose of the present nested case...

Treatment of periocular tumours of horses using radioactive gold198 grains

International Nuclear Information System (INIS)

Wyn-Jones, G.

1979-01-01

The literature is briefly reviewed concerning the clinical features of equine cutaneous tumours. The data from 19 horses with periocular skin tumours are reported together with the results of their treatment by implantation with radioactive gold 198 . The principles governing the implantation of radioactive sources are explained and a method for computing the initial activity of the sources is outlined. Five histologically different tumours were treated in this series of 19 horses, 2 horses were bilaterally affected. The techniques of implantation using a simple needle/stilette combination and a purpose built gold grain implantation gun are described and the post-operative course of the animals is traced. The treatment was successful in ablating the tumour mass and preventing regrowth in 19 of 21 periocular tumour groups. The cosmetic effects of the treatment were found to be satisfactory. Emphasis is laid on the care needed in handling the radioactive material and on the need for a thorough understanding of the principles involved in radiotherapy. Doses received by the operator during an implantation procedure are quoted which show that the technique is safe as well as being effective. (author)

Study of the potentiometric properties of spinel-type manganese oxide doped with gallium and anions Ga0.02Mn1.98O3.98X0.02 (X = S2− and F−) as selective sensor for lithium ion

International Nuclear Information System (INIS)

David-Parra, Diego N.; Bocchi, Nerilso; Teixeira, Marcos F.S.

2015-01-01

Highlights: • Investigated the influence of doping agents on the potentiometric response • Reduction of the unit cell size affected directly in the potentiometric performance of the electrode • Sensor performance increased in the order: Ga 0.02 Mn 1.98 O 4 > Ga 0.02 Mn 1.98 O 3.98 S 0.02 > Ga 0.02 Mn 1.98 O 3.98 F 0.02 . - Abstract: This paper describes the development of a selective lithium ion sensor based on spinel-type manganese oxide doped with gallium and anions (Ga 0.02 Mn 1.98 O 3.98 X 0.02 , where X = S 2− and F − ). Investigation was made of the influence of cationic and/or anionic doping agents on the potentiometric response of the sensor. Experimental parameters evaluated included the effect of the lithium concentration on activation of the sensor by cyclic voltammetry, the pH of the electrolyte solution, and the selectivity towards Li + compared to other alkali and alkaline-earth metal ions. There was an important influence of the unit cell size of the material on the linear range, detection limit, and selectivity of the sensor. Reduction in the size of the tunnel for insertion of the lithium in the porous structure of the oxide directly affected the potentiometric performance of the electrode. Sensor performance increased in the order: Ga 0.02 Mn 1.98 O 4 > Ga 0.02 Mn 1.98 O 3.98 S 0.02 > Ga 0.02 Mn 1.98 O 3.98 F 0.02 . The observed super-Nernstian response could be explained by a mixed potential arising from two equilibria (redox and ion exchange) in the spinel-type manganese oxide. Sensitivity and the influence of pH on the electrode response were directly related to the doping agents present in the oxide structure

Fission excitation function for 19F + 194,196,198Pt at near and above barrier energies

Directory of Open Access Journals (Sweden)

Singh Varinderjit

2015-01-01

Full Text Available Fission excitation functions for 19F + 194,196,198Pt reactions populating 213,215,217Fr compound nuclei are reported. Out of these three compound nuclei, 213Fr is a shell closed (N=126 compound nucleus and the other two are away from the shell closure. From a comparison of the experimental fission cross-sections with the statistical model predictions, it is observed that the fission cross-sections are underestimated by the statistical model predictions using shell corrected finite range rotating liquid drop model (FRLDM fission barriers. Further the FRLDM fission barriers are reduced to fit the fission cross-sections over the entire measured energy range.

Obesity and risk of recurrence or death after adjuvant endocrine therapy with letrozole or tamoxifen in the breast international group 1-98 trial

DEFF Research Database (Denmark)

Ewertz, Marianne; Gray, Kathryn P; Regan, Meredith M

2012-01-01

To examine the association of baseline body mass index (BMI) with the risk of recurrence or death in postmenopausal women with early-stage breast cancer receiving adjuvant tamoxifen or letrozole in the Breast International Group (BIG) 1-98 trial at 8.7 years of median follow-up....

$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

CERN Multimedia

We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

Gold-198 and rose bengal marked with iodine-131 in the diagnostic of hepatic vesicular affections; L'or{sup 198} et le rose bengale marque a l'iode{sup 131} dans le diagnostic des affections hepatovesiculaires

Energy Technology Data Exchange (ETDEWEB)

Manambelona Razafimalaza, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1961-06-15

Colloidal gold-198 makes it possible to obtain clear images of hepatic parenchyma; the examination can be repeated from different angles thus demonstrating the presence of pathologically inert regions, whether they be hydatic cysts, abscesses or neoplasia. The study of the disappearance curve for the colloid, together with a measurement of the blood volume, makes it possible also to calculate the hepatic flow. Using Rose Bengal marked with iodine-131, it is possible to obtain images of the liver and of the bile ducts, and to follow the elimination of the dye in the intestines. The simultaneous recording of the disappearance curves for the blood and of the appearance of the dye in the intestines constitutes an useful working test which is particularly sensible for evaluating the permeability of the bile ducts and, to a certain degree, the site of an obstruction. (author) [French] L'or colloidal-198 permet d'obtenir avec nettete des images du parenchyme hepatique; l'examen peut etre repete sous plusieurs incidences mettant ainsi en evidence les zones muettes pathologiques, qu'il s'agisse de kystes hydatiques, d'abces ou de neoplasies. L'etude de la courbe d'epuration du colloide completee par une mesure du volume sanguin offre en outre la possibilite de calculer le debit hepatique. A l'aide du rose bengale marque a l'iode-131, il est possible d'obtenir des images du foie et de la vesicule biliaire, et de suivre l'elimination intestinale du colorant. L'enregistrement simultane des courbes d'epuration sanguine et d'apparition intestinale constitue une epreuve fonctionnelle particulierement sensible pour apprecier la permeabilite des voies biliaires et dans une certaine mesure le site d'une obstruction. (auteur)

Bone fractures among postmenopausal patients with endocrine-responsive early breast cancer treated with 5 years of letrozole or tamoxifen in the BIG 1-98 trial

DEFF Research Database (Denmark)

Rabaglio, M; Sun, Z; Price, K N

2009-01-01

of letrozole or tamoxifen in the BIG 1-98 trial who received at least some study medication (median follow-up 60.3 months). Bone fracture information (grade, cause, site) was collected every 6 months during trial treatment. RESULTS: The incidence of bone fractures was higher among patients treated......BACKGROUND: To compare the incidence and timing of bone fractures in postmenopausal women treated with 5 years of adjuvant tamoxifen or letrozole for endocrine-responsive early breast cancer in the Breast International Group (BIG) 1-98 trial. METHODS: We evaluated 4895 patients allocated to 5 years...... with letrozole [228 of 2448 women (9.3%)] versus tamoxifen [160 of 2447 women (6.5%)]. The wrist was the most common site of fracture in both treatment groups. Statistically significant risk factors for bone fractures during treatment included age, smoking history, osteoporosis at baseline, previous bone...

Relative Effectiveness of Letrozole Compared With Tamoxifen for Patients With Lobular Carcinoma in the BIG 1-98 Trial

DEFF Research Database (Denmark)

Metzger Filho, Otto; Giobbie-Hurder, Anita; Mallon, Elizabeth

2015-01-01

assigned onto the Breast International Group (BIG) 1-98 trial and who had centrally reviewed pathology data were included (N = 2,923). HER2-negative IDC and ILC were additionally classified as hormone receptor-positive with high (luminal B [LB] -like) or low (luminal A [LA] -like) proliferative activity......PURPOSE: To evaluate the relative effectiveness of letrozole compared with tamoxifen for patients with invasive ductal or lobular carcinoma. PATIENTS AND METHODS: Patients diagnosed with early-stage invasive ductal carcinoma (IDC) or classic invasive lobular carcinoma (ILC) who were randomly...

Treatment Adherence and Its Impact on Disease-Free Survival in the Breast International Group 1-98 Trial of Tamoxifen and Letrozole, Alone and in Sequence

DEFF Research Database (Denmark)

Chirgwin, Jacquie H; Giobbie-Hurder, Anita; Coates, Alan S

2016-01-01

PURPOSE: To investigate adherence to endocrine treatment and its relationship with disease-free survival (DFS) in the Breast International Group (BIG) 1-98 clinical trial. METHODS: The BIG 1-98 trial is a double-blind trial that randomly assigned 6,193 postmenopausal women with hormone receptor......-positive early breast cancer in the four-arm option to 5 years of tamoxifen (Tam), letrozole (Let), or the agents in sequence (Let-Tam, Tam-Let). This analysis included 6,144 women who received at least one dose of study treatment. Conditional landmark analyses and marginal structural Cox proportional hazards......). Sequential treatments were associated with higher rates of nonpersistence (Tam-Let, 20.8%; Let-Tam, 20.3%; Tam 16.9%; Let 17.6%). Adverse events were the reason for most trial treatment early discontinuations (82.7%). Apart from sequential treatment assignment, reduced adherence was associated with older age...

Role of rotational energy component in the dynamics of 16O+198Pt reaction

Directory of Open Access Journals (Sweden)

Sharma Manoj K.

2017-01-01

Full Text Available The role of rotational energy is investigated in reference to the dynamics of 16O+198Pt →214Rn∗ reaction using the sticking (IS and the non-sticking (INS limits of moment of inertia within the framework of dynamical cluster decay model. The decay barrier height and barrier position get significantly modified for the use of sticking or non-sticking choice, which in turn reproduce the evaporation residue and the fusion-fission cross-sections nicely by the IS approach, while the INS approach provides feasible addressal of data only for evaporation residue channel. Moreover, the fragmentation path of decaying fragments of 214Rn∗ compound nucleus gets influenced for different choices of moment of inertia. Beside this, the role of nuclear deformations i.e. static, dynamic quadurpole (β2 and higher order static deformation up to β4 are duly investigated for both choices of the moment of inertia.

The kinetics of phagocytosis of 198Au colloids ''in vitro''

International Nuclear Information System (INIS)

Astorri, N.L.; Bergoc, R.M.; Bianchin, A.M.; Caro, R.A.; Ihlo, J.E.; Rivera, E.S.

1982-01-01

The kinetics of the phagocytosis of 198-Au colloids by macrophages ''in vitro'' was studied by incubating during 5 hours phagocytic cells from the liver and the spleen of Wistar rats with colloidal radiogold particles, in the presence of an adequate culture medium (TC-199 with 10 per cent of Bovine Fetal Serum). In each experiment, the number of colloidal gold particles offered to each phatocytic cell, (Au) 0 and the mean rate of phagocytosis v, were calculated. The latter value was determined by measuring the radioactivity incorporated into the phagocytic cells during the incubation; it was expressed as the number of phagocytized colloidal gold particles per cell per minute. The values of log v = f [log (Au) 0 ] were plotted. The Lineweaver-Burk analysis of the results demonstrates that the kinetics of the phagocytosis of colloidal radiogold particles ''in vitro'' follows a model similar to Michaelis-Menten equations for enzyme reactions. The values of the substratum constant Ks and maximun velocity Vm were obtained by the regression analysis of the 1/v vs. 1/(Au) 0 graph. Vm was equal to 9.44 x 10 and 1.63 x 10 phagocytized colloidal gold particles per cell per minute for liver and spleen macrophages, respectively. Ks was equal to 6.01 x 10 9 and 8.02 x 10 8 colloidal gold particles per cell for liver and spleen macrophages, respectively. The significance of these differences is discussed and attributed mainly to a change of the specific engulfment rate constant. (author) [es

Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} luminescence whisker based on vapor-phase deposition: Facile synthesis, uniform morphology and enhanced luminescence properties

Energy Technology Data Exchange (ETDEWEB)

Xu, Jian, E-mail: xujian@stu.xmu.edu.cn [Department of Materials Science and Engineering, Xiamen University, Xiamen 361005 (China); Hassan, Dhia A. [Department of Materials Science and Engineering, Xiamen University, Xiamen 361005 (China); Department of Chemistry, College of Education for Pure Science, University of Basrah, 61004 (Iraq); Zeng, Renjie; Peng, Dongliang [Department of Materials Science and Engineering, Xiamen University, Xiamen 361005 (China); Fujian Key Lab of Advanced Special Material, Xiamen University, Xiamen 361005 (China); Key Laboratory of High Performance Ceramic Fibers, Ministry of Education, Xiamen 361005 (China)

2015-11-15

Highlights: • For the first time, it is possible to obtain Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} whisker. • The whiskers are smooth and uniform with L/D ratio over 50. • Durability and thermal stability of the whisker are enhanced. - Abstract: A high performance strontium silicate phosphor has been successfully synthesized though a facile vapor-phase deposition method. The product consists of single crystal whiskers which are smooth and uniform, and with a sectional equivalent diameter of around 5 μm; the aspect ratio is over 50 and no agglomeration can be observed. X-ray diffraction result confirmed that the crystal structure of the whisker was α’-Sr{sub 2}SiO{sub 4}. The exact chemical composition was Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} which was analyzed by energy dispersive spectrometer and inductively coupled plasma-mass spectrometer. The whisker shows broad green emission with peak at 523 nm ranging from 470 to 600 nm (excited at 370 nm). Compared with traditional Sr{sub 2}SiO{sub 4}:Eu phosphor, durability (at 85% humidity and 85 °C) and thermal stability of the whisker are obviously improved. Moreover, growth mechanism of the Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} whiskers is Vapor–Liquid–Solid. On a macro-scale, the product is still powder which makes it suitable for the current packaging process of WLEDs.

Adjuvant letrozole versus tamoxifen according to centrally-assessed ERBB2 status for postmenopausal women with endocrine-responsive early breast cancer: supplementary results from the BIG 1-98 randomised trial

DEFF Research Database (Denmark)

Regan, M.M.; Lykkesfeldt, A.E.; Dell'Orto, P.

2008-01-01

Background The Breast International Group (BIG) 1-98 trial (a randomised double-blind phase III trial) has shown that letrozole significantly improves disease-free survival (DFS) compared with tamoxifen in postmenopausal women with endocrine-responsive early breast cancer. Our aim was to establish...... whether the benefit of letrozole versus tamoxifen differs according to the ERBB2 status of tumours. Methods The BIG 1-98 trial consists of four treatment groups that compare 5 years of monotherapy with letrozole or tamoxifen, and sequential administration of one drug for 2 years followed by the other drug...... for 3 years. Our study includes data from the 4922 patients randomly assigned to the two monotherapy treatment groups (letrozole or tamoxifen for 5 years; 51 months median follow-up [range

Variations of nuclear charge radii in mercury isotopes with A = 198, 199, 200, 201, 202, and 204 from x-ray isotope shifts

International Nuclear Information System (INIS)

Lee, P.L.; Boehm, F.; Hahn, A.A.

1978-01-01

The isotope shifts of atomic K x rays were measured for pairs of the six mercury isotopes with A = 198, 199, 200, 201, 202, and 204, using a curved crystal spectrometer. The changes of the nuclear charge radii were derived in terms of delta 2 > and deltaR/sub k/ and compared with optical an muonic isotope shift data. From our results, a renormalization of the optical data was obtained

How does the development of the financial industry advance renewable energy? A panel regression study of 198 countries over three decades

OpenAIRE

Scholtens, Bert; Veldhuis, Rineke

2015-01-01

Abstract We investigate how the development of the financial industry connects with renewable energy. We analyze 198 countries over three decades in various model settings (fixed effects, random effects, dynamic panel). We use a wide range of proxies for the development of the financial industry and establish that in general this development has a positive impact on renewable energy capacity. Especially, the relative size of the commercial banking industry as well as of private credit and the...

Prevalência de manifestações oculares em 198 pacientes com artrite reumatóide: um estudo retrospectivo Prevalence of ocular manifestation in 198 patients with rheumatoid arthritis: a restrospective study

Directory of Open Access Journals (Sweden)

Raphael Guimarães Bettero

2008-06-01

Full Text Available OBJETIVO: Estimar a prevalência de manifestações oculares na população local de artrite reumatóide (AR. Estimar se a presença de auto-anticorpos como fator reumatóide (FR e fator antinuclear (FAN influi no aparecimento destas manifestações e se existe associação entre o aparecimento de manifestações oculares e índice funcional do paciente, idade ao diagnóstico e tempo de doença. MÉTODOS: Foram estudados retrospectivamente 198 prontuários de pacientes com AR, acompanhados durante o período de 2003 a 2006. Avaliou-se a prevalência das manifestações oftalmológicas, perfil de auto-anticorpos, dados demográficos e índice funcional de Steinbrock destes pacientes. RESULTADOS: Síndrome de Sjögren secundária apareceu em 12,1% dos pacientes sendo mais comum em mulheres (p=0,049 e em pacientes com maior dano articular (p=0,016. Ceratite ulcerativa e esclerite incidiram em torno de 2% dos pacientes. Fator reumatóide (FR e fator antinuclear (FAN assim como tempo de doença e idade do paciente ao diagnóstico não influíram no aparecimento das manifestações estudadas. CONCLUSÃO: A síndrome de Sjögren secundária é a manifestação ocular mais prevalente em pacientes com AR, sendo mais comum em mulheres e em pacientes com mais disfunção articular.PURPOSE: To study the prevalence of eye manifestations in the local rheumatoid arthritis (RA population, as well as to know if the presence of rheumatoid factor (RF and antinuclear antibodies (ANA affect this profile. To study if there is association between eye manifestations and patient's articular functional index, age at diagnosis and illness duration. METHODS: We reviewed 198 charts of rheumatoid arthritis patients followed-up from 2003 to 2006. They were studied for: prevalence of ophthalmologic manifestations, autoantibody profile, demographic data and Steinbrock's functional index. RESULTS: Secondary Sjögren's syndrome was seen in 12.1% of the patients being more common

Evaporation residue excitation function measurement for 19F + 194,198Pt reactions

International Nuclear Information System (INIS)

Singh, Varinderjit; Behera, B.R.; Kaur, Maninder

2012-01-01

Nuclear dissipation is one of the active fields in the present day nuclear physics research. Experimental signatures for dissipation are observed through large excess in pre-fission neutrons, γ-ray multiplicities from the compound nucleus, giant dipole resonance (GDR) γ-rays, light charged particles and evaporation residues in comparison to standard statistical model, for the heavy-ion induced fusion-fission or fusion-evaporation reactions (ERs). From the analysis of a large set of experimental data, it is well established that there exists a large dissipation at nuclear temperature above 1 MeV. But most of these probes are not sensitive to the dissipation within saddle. The ER cross-section is a probe which is sensitive to dissipation within the saddle point. Hence, the study of ER cross-section can be helpful in estimating the dissipation effects inside the saddle point. Also the other motivation for these measurements is to see the effect of shell closure on dissipation. With this motivation the evaporation cross-sections for 19 F + 194,198 Pt are measured at beam energy of 101 to 137.3 MeV. Of the above systems 19 F + 194 Pt populates 213 Fr (N = 126) shell closed compound nucleus (CN) whereas, other system populate 217 Fr (N = 130) non-shell closed CN

Studies on hemodynamics in liver diseases by the use of colloidal gold198 uptakes by liver and spleen

International Nuclear Information System (INIS)

Matsunaga, Atsushi

1983-01-01

In this study, hepatic blood flow was observed using colloidal gold 198 uptakes by the liver and spleen in the pathogenic conditions in which the uptake was increased in the area of extra hepatic reticuloendothelial systems (especially in splenic RES). The change in the uptake ability of the liver and the contribution to it of intra and extra hepatic shunts were examined. In addition, study was made on the mechanism of how splenic visualization occurred in the colloidal gold 198 scintigram in liver diseases. Out of 84 subjects, 35, 11, 24, and 8 had hepatic cirrhosis and precirrhosis and chronic and acute hepatitis, respectively, and 6 were normal. The results obtained in this study were as follows: (1) The mean value of splenic clearance (splenic blood flow component) in hepatic cirrhosis was 88+-67.5 ml/min. This accounts for approximately 14.6+-11.9 % of the total RES clearance (Classic Effective Hepatic Blood Flow). (2) In hepatic cirrhosis, Classic Hepatic Blood Flow which had been measured up to date was considered to be overestimation by about 19.9+-20.4 % over the mean value of hepatic clearance (hepatic blood flow component) obtained in this study, (3) The hepatic clearance was better indicator of liver disease than the total RES clearance, (4) The ratio between hepatic clearance and cardiac output was considered to be a useful index in assessing the amount of intra and extra hepatic shunts, which had an inverse relationship to the ability of colloid uptake by the liver. (5) Splenic visualization in hepatic cirrhosis was shown to have resulted from the increase in splenic extraction of the colloid, followed by the increase in total splenic blood flow. (author)

Contribution to the study of {beta} disintegration and of nuclear structure using experiments on certain {beta}-{gamma} cascades: 198{sub Au}, 86{sub Rb}, 170{sub Tm}; Contribution a l'etude de la desintegration beta et a l'etude de la structure nucleaire a l'aide d'experiences sur certaines cascades beta-gamma: 198{sub Au}, 86{sub Rb}, 170{sub Tm}

Energy Technology Data Exchange (ETDEWEB)

Lachkar, J [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes; Paris-11 Univ., fabulte des Sciences 91 - Orsay (France)

1969-07-01

{beta}{gamma} directional angular correlations and shapes of inner beta spectra leading to the first excited level of the final nucleus enable one to determine the nuclear matrix elements typical of the {beta} transition. In the three observed first forbidden cases: {sup 170}Tm, {sup 86}Rb, {sup 198}Au, these matrix elements do not confirm the independent shell model theory. Other hypotheses are then suggested and discussed. (author) [French] Les experiences de correlation angulaire {beta}{gamma} et l'etude du spectre {beta} conduisant au premier niveau excite du noyau final permettent de determiner les elements de matrices nucleaires caracteristiques de cette transition. Dans les trois cas etudies (transitions une fois interdites): {sup 170}Tm, {sup 86}Rb, {sup 198}Au, ces elements de matrices ne peuvent etre retrouves a l'aide du modele en couches et a particules independantes. D'autres hypotheses sont alors emises et discutees. (auteur)

Genetic variation in codons 167, 198 and 200 of the beta-tubulin gene in whipworms (Trichuris spp.) from a range of domestic animals and wildlife

DEFF Research Database (Denmark)

Hansen, Tina Vicky Alstrup; Nejsum, Peter; Olsen, Annette

2013-01-01

A recurrent problem in the control of whipworm (Trichuris spp.) infections in many animal species and man is the relatively low efficacy of treatment with a single application of benzimidazoles (BZs). The presence of single nucleotide polymorphisms (SNPs) in codons 167, 198 and 200 in the beta...

An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

Science.gov (United States)

1991-12-01

d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

Oil flow rate measurements using 198Au and total count technique

International Nuclear Information System (INIS)

Goncalves, Eduardo R.; Crispim, Verginia R.

2013-01-01

In industrial plants, oil and oil compounds are usually transported by closed pipelines with circular cross-section. The use of radiotracers in oil transport and processing industrial facilities allows calibrating flowmeters, measuring mean residence time in cracking columns, locate points of obstruction or leak in underground ducts, as well as investigating flow behavior or industrial processes such as in distillation towers. Inspection techniques using radiotracers are non-destructive, simple, economic and highly accurate. Among them, Total Count, which uses a small amount of radiotracer with known activity, is acknowledged as an absolute technique for flow rate measurement. A viscous fluid transport system, composed by four PVC pipelines with 13m length (12m horizontal and 1m vertical) and 1/2, 3/4, 1 and 2-inch gauges, respectively, interconnected by maneuvering valves was designed and assembled in order to conduct the research. This system was used to simulate different flow conditions of petroleum compounds and for experimental studies of flow profile in the horizontal and upward directions. As 198 Au presents a single photopeak (411,8 keV), it was the radioisotope chosen for oil labeling, in small amounts (6 ml) or around 200 kBq activity, and it was injected in the oil transport lines. A NaI scintillation detector 2'x 2', with well-defined geometry, was used to measure total activity, determine the calibration factor F and, positioned after a homogenization distance and interconnected to a standardized electronic set of nuclear instrumentation modules (NIM), to detect the radioactive cloud. (author)

Gold nanoparticles production using reactor and cyclotron based methods in assessment of {sup 196,198}Au production yields by {sup 197}Au neutron absorption for therapeutic purposes

Energy Technology Data Exchange (ETDEWEB)

Khorshidi, Abdollah, E-mail: abkhorshidi@yahoo.com

2016-11-01

Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of {sup 197}Au(n,γ){sup 196,198}Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. {sup 197}Au nano-solution, including 20 nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E + 13 n/cm{sup 2}/s for {sup 196,198}Au activity and production yield estimations. Meanwhile, the yield was examined using 30 MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF{sub 2} reflector enclosed the moderator region. Transmutation in {sup 197}Au nano-solution samples were explored at 15 and 25 cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. - Graphical abstract: This figure describes gold nanoparticles production via cyclotron based method. The aim of investigating is to estimate activity and saturation yield of {sup 197}Au(n,γ){sup 198}Au and {sup 197}Au(n,2n){sup 196}Au reactions using Karaj cyclotron available in Iran. The feasibility of a cyclotron-driven production of βeta-emitting radioisotopes was investigated for therapeutic applications via a new neutron activator design. - Highlights: • Nano-gold radioisotope production

Gold-198 and rose bengal marked with iodine-131 in the diagnostic of hepatic vesicular affections

International Nuclear Information System (INIS)

Manambelona Razafimalaza, J.

1961-06-01

Colloidal gold-198 makes it possible to obtain clear images of hepatic parenchyma; the examination can be repeated from different angles thus demonstrating the presence of pathologically inert regions, whether they be hydatic cysts, abscesses or neoplasia. The study of the disappearance curve for the colloid, together with a measurement of the blood volume, makes it possible also to calculate the hepatic flow. Using Rose Bengal marked with iodine-131, it is possible to obtain images of the liver and of the bile ducts, and to follow the elimination of the dye in the intestines. The simultaneous recording of the disappearance curves for the blood and of the appearance of the dye in the intestines constitutes an useful working test which is particularly sensible for evaluating the permeability of the bile ducts and, to a certain degree, the site of an obstruction. (author) [fr

Evidence for {open_quotes}magnetic rotation{close_quotes} in nuclei: New results on the M1-bands of {sup 198,199}Pb

Energy Technology Data Exchange (ETDEWEB)

Clark, R.M. [Lawrence Berkeley National Lab., CA (United States)

1996-12-31

Lifetimes of states in four of the M1-bands in {sup 198,199}Pb have been determined through a Doppler Shift Attenuation Method measurement performed using the Gammasphere array. The deduced B(M1) values, which are a sensitive probe of the underlying mechanism for generating these sequences, show remarkable agreement with Tilted Axis Cranking (TAC) calculations. Evidence is also presented for the possible termination of the bands. The results represent clear evidence for a new concept in nuclear excitations: {open_quote}magnetic rotation{close_quote}.

Removal of Reactive Red 198 by Nanoparticle Zero Valent Iron in the Presence of Hydrogen Peroxide

Directory of Open Access Journals (Sweden)

Siroos Shojaei

2017-04-01

Full Text Available Although dyes are widely used in textile industries, they are carcinogenic, teratogenic and mutagenic. Industries discharge their wastewater containing a variety of colors into water resources and make harmful effect on the environment. The present study aims to Evaluate removal of reactive red 198 by nanoparticle zero valent iron (NZVI in the presence of hydrogen peroxide from aqueous solution. The effective parameters on the removal of dye such as the hydrogen peroxide concentration of NZVI, contact time, pH and dye concentration were investigated and optimized. According to the results, the combination of NZVI with hydrogen peroxide is more effective than single hydrogen peroxide. At pH = 4, contact time= 40 min, 200 M of hydrogen peroxide, dye concentration= 75 mg/L and concentration of NZVI 2g/L, color removal was achieved 91% approximately. Based on the results of experiments, using hydrogen peroxide- NZVI has high efficiency in removal of azo dye type.

Effect of N/Z in pre-scission neutron multiplicity for 16,18O+198Pt systems

International Nuclear Information System (INIS)

Sandal, R.; Behera, B.R.; Singh, V.; Kaur, M.; Kumar, A.; Singh, G.; Singh, K.P.; Sugathan, P.; Jhingan, A.; Golda, K.S.; Chatterjee, M.B.; Bhowmik, R.K.; Kalkal, S.; Siwal, D.; Goyel, S.; Mandal, S.; Prasad, E.; Sadhukhan, J.; Pal, S.; Mahta, K.; Saxena, A.

2014-01-01

This paper reports the summary of the experimental results of pre-scission neutron multiplicities from four compound nuclei, namely 210,212,214,216 Rn, and statistical model analysis of the corresponding data. The compound nuclei 210,212,214,216 Rn having N/Z values as 1.441, 1.465, 1.488, 1.511 respectively are populated through the 16,18 O+ 194,198 Pt reactions at excitation energies of 50, 61, 71.7 and 79 MeV. The measured neutron multiplicities are further analyzed with the statistical model of nuclear decay where fission hindrance due to nuclear dissipation is considered. The N/Z dependence of the dissipation strength at lowest excitation energy of the compound nuclei suggests shell closure effects. However, such effects are not observed at higher excitations where the variation of the dissipation strength with N/Z does not show any specific trend. The variation of N/Z in fission time scale is also shown. (authors)

Transient field measurements of g-factors in 194,196,198Pt; g(21+) systematics in transitional W, Os, Pt nuclei

International Nuclear Information System (INIS)

Stuchbery, A.E.; Lampard, G.J.; Bolotin, H.H.

1991-01-01

Transient field processions were measured simultaneously for levels in the nuclei 182,184,186 W and 194,196,198 Pt as their ions traversed polarized Gd hosts. These results allow a critical evaluation of conflicting g-factor values reported previously for the even Pt isotopes. Mass variations of g(2 1 + ) in the even W, Os, Pt nuclei are examined using the proton-neutron interacting boson model (IBM-2). The measured g-factors depart from the simplest IBM-2 description perhaps due to subshell effects and/or small contributions from non-collective configurations which cause the neutron-boson g-factor to vary with mass. 46 refs., 5 tabs., 7 figs

Features of the structural and magnetic properties of Pb(TixZr1–xO3-NiFe1.98Co0.02O4 in the polarized state

Directory of Open Access Journals (Sweden)

Baev Vadim

2017-06-01

Full Text Available Composites with a 90%Pb(TixZr1-xO3-10%NiFe1.98Co0.02O4 composition have been synthesized. It has been established that the polarization of samples resulting from exposure to an electric field for 1 hour of 4 kV/mm in strength at a temperature of 400 K leads to crystal structure deformation. The compression of elementary crystal cells in some areas during polarization of the sample creates conditions suitable for the enhancement of magnetic exchange interactions. It has been found that the polarization process of such compositions leads to increases in specific magnetization and magnetic susceptibility. The analysis of Mössbauer spectra has shown that the polarization of the 90%Pb(TixZr1-xO3-10%NiFe1.98Co0.02O4 composite leads to significant changes in the effective magnetic fields of iron subspectra in various positions.

Charge radii and electromagnetic moments of At-211195

Science.gov (United States)

Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

2018-05-01

Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

Contribution to the study of {beta} disintegration and of nuclear structure using experiments on certain {beta}-{gamma} cascades: 198{sub Au}, 86{sub Rb}, 170{sub Tm}; Contribution a l'etude de la desintegration beta et a l'etude de la structure nucleaire a l'aide d'experiences sur certaines cascades beta-gamma: 198{sub Au}, 86{sub Rb}, 170{sub Tm}

Energy Technology Data Exchange (ETDEWEB)

Lachkar, J. [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes; Paris-11 Univ., fabulte des Sciences 91 - Orsay (France)

1969-07-01

{beta}{gamma} directional angular correlations and shapes of inner beta spectra leading to the first excited level of the final nucleus enable one to determine the nuclear matrix elements typical of the {beta} transition. In the three observed first forbidden cases: {sup 170}Tm, {sup 86}Rb, {sup 198}Au, these matrix elements do not confirm the independent shell model theory. Other hypotheses are then suggested and discussed. (author) [French] Les experiences de correlation angulaire {beta}{gamma} et l'etude du spectre {beta} conduisant au premier niveau excite du noyau final permettent de determiner les elements de matrices nucleaires caracteristiques de cette transition. Dans les trois cas etudies (transitions une fois interdites): {sup 170}Tm, {sup 86}Rb, {sup 198}Au, ces elements de matrices ne peuvent etre retrouves a l'aide du modele en couches et a particules independantes. D'autres hypotheses sont alors emises et discutees. (auteur)

Blood disappearance rate of /sup 198/Au-colloid and changes of hepatic blood flow during position change in normal persons and in patients with various hepatic diseases

Energy Technology Data Exchange (ETDEWEB)

Cho, B Y [Capital Armed Forces General Hospital, Seoul (Republic of Korea); Hong, K S; Koh, C S; Lee, M [Seoul National Univ., Seoul (Republic of Korea). Coll. of Medicine

1977-01-01

To evaluate the diagnostic significance of the blood disappearance rate of /sup 198/Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of 7,1/sup 98/Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1. In normal control, the mean blood disappearance half time of /sup 198/Au-colloid in supine position was 2.7+-0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2. In acute hepatitits, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0+-0.45, 3.5+-0.74, 7.2+-3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3. In the normal control and acute hepatitis, the decreaces of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively.

The blood disappearance rate of 198Au-colloid and changes of hepatic blood flow during position change in normal persons and in patients with various hepatic diseases

International Nuclear Information System (INIS)

Cho, B.Y.; Hong, K.S.; Koh, C.S.; Lee, M.

1977-01-01

To evaluate the diagnostic significance of the blood disappearance rate of 198 Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of 7,1 98 Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1. In normal control, the mean blood disappearance half time of 198 Au-colloid in supine position was 2.7+-0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2. In acute hepatitits, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0+-0.45, 3.5+-0.74, 7.2+-3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3. In the normal control and acute hepatitis, the decreaces of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively. (author)

Retention studies in rats exposed to monodisperse aerosols of /sup 198/Au labeled carnauba wax particles

Energy Technology Data Exchange (ETDEWEB)

Tarroni, G.; Bassi, P.; Belvisi, M.B.; Bianco, A.

1981-01-01

Rats were exposed to monodisperse carnauba wax aerosols labeled with colloidal /sup 198/Au and the retained activity was followed both in vivo and in the lungs of serially sacrified animals. In vitro and in vivo tests have shown low leaching rates of the label. The deposited activity could then be followed without correction for particle solubility. The activity in vivo shows a three-exponential decay, characterized by half-times of a few hours, one day, and one month corresponding to the clearance of the material deposited respectively in the extrathoracic airways, in the tracheo-bronchial, and in the alveolar regions. A correlation was found between long term cleared activity and particle size but no correlation was found between particle size and clearance half times in the size range investigated. Statistical evaluation of the activity vs time in vivo and in excised lungs has shown that the long term retained activity pertains to the alveolar region and, if a large number of animals is not used, more accurate data of pulmonary clearance can be obtained by in vivo measurements than by serial sacrifices.

Results of infusion of pleural and peritoneal calcinoses with colloidal radiogold Au-198

International Nuclear Information System (INIS)

Grundmann, J.; Schnabel, U.

1980-01-01

This study begins with a general part, containing a description of the usual techniques, a summary of the side effects and complications and also a survey over the indications and contra-indications. This chapter is followed by the evaluation of the histologies taken of 572 patients with 744 applications. These patients received infusions of Au-198 intrapleurally and/or intraperitoneally between Januray 1st, 1960 and December 31st, 1970, in the Rudolf-Virchow Hospital, Berlin. The consideration of the overall patient population is followed by a classification of the individual primary tumours according to various aspects. In order to judge about the effectiveness of the applied radiogold therapy, we calculated the average survival times of the individual patient groups and additionally we assessed the influence due to effusion. For the 155 patients who received radiogold intrapleurally once, a rate of success of 56.1% resulted; this rate was 58.8% for the 58 patients suffering from carcinoma of the breast, and for the 59 patients with bronchial carcinoma this rate was 56.1%. Correspondingly we calculated a rate of success of 40.4% for 94 patients with intraperitoneal radiogold infusion and ascites. In the 57 patients suffering from ovarian tumours and ascites, we found a rate of success of 57.9%. Ten patients, who received radiogold not only intrapleurally, but also intraperitoneally, showed a mean survival rate of 16 months. (orig./MG) [de

Workshop on selected aspects of radiochemistry

International Nuclear Information System (INIS)

1991-11-01

The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

Prognostic and predictive role of ESR1 status for postmenopausal patients with endocrine-responsive early breast cancer in the Danish cohort of the BIG 1-98 trial

DEFF Research Database (Denmark)

Ejlertsen, B; Aldridge, J; Nielsen, K V

2012-01-01

postmenopausal Danish women with early breast cancer randomly assigned to receive 5 years of letrozole, tamoxifen or a sequence of these agents in the Breast International Group 1-98 trial and who had ER ≥1% after central review. RESULTS: By FISH, 13.6% of patients had an ESR1-to-Centromere-6 (CEN-6) ratio ≥2...... (amplified), and 4.2% had ESR1-to-CEN-6 ratio...

SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

Energy Technology Data Exchange (ETDEWEB)

Jaszczak, R.J.

1995-12-01

Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

International Nuclear Information System (INIS)

Jaszczak, R.J.

1995-12-01

Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

Accidental Radiogold ({sup 198}Au) Liver Scan Overdose with Fatal Outcome

Energy Technology Data Exchange (ETDEWEB)

Baron, J. M.; Yachnin, S.; Polcyn, R.; Fitch, F. W.; Sturner, W. Q. [Pritzker School of Medicine of the University of Chicago and Argonne Cancer Research Hospital (operated by the University of Chicago for the United States Atomic Energy Commission), Chicago, IL (United States)

1969-10-15

The first reported instance of accidental overdosage with intravenously administered radioactive colloidal gold ({sup 198}Au) given for liver scanning is described. A 73-year-old female with erythremic myelosis accompanied by hepatosplenomegaly received 200 millicuries instead of the intended dose of 200 microcuties. She was transferred to the Argonne Cancer Research Hospital at the University of Chicago the following day. External monitoring on the second day showed 35 mR/h at 1 metre. Total body scanning of the patient without administration of additional isotope revealed high activity and an abnormally extensive reticuloendothelial uptake. Blood activity at that time was 0.04 microcuries per millilitre of whole blood. Estimated radiation dosage to be received by the bone marrow was 400-500 Rand by the liver was 7000-8000 R. There were no symptoms of acute radiation exposure. The patient was placed in strict isolation on the fifth day, and surgical scrub precautions were continued until day 63. Supportive care included buffy . coat and platelet packs, prophylactic sterilization of the gastrointestinal tract, and, later, androgen and corticosteroids. The expected decrease in peripheral blood lymphocytes, granulocytes, and platelets occurred in the order mentioned. Liver size decreased, but function tests did not deteriorate. There was no difficulty with clinical infection during the granulocytopenic phase. Lymphocytes and, later, granulocytes showed recovery to subnormal levels, but platelets failed to rise above 8000/mm{sup 3} after the 21st day. The patient developed haematuria and purpura, and suffered a terminal spontaneous intracerebral haemorrhage on the 69th day. At post mortem there was evidence for patchy areas of granulocytic and erythroid marrow regeneration, and some extramedullary sites contained isolated clones of young red cell precursors. There were no specific changes in the liver. The lack of effective methods to mobilize or metabolize colloidal

Symptoms of endocrine treatment and outcome in the BIG 1-98 study.

Science.gov (United States)

Huober, J; Cole, B F; Rabaglio, M; Giobbie-Hurder, A; Wu, J; Ejlertsen, B; Bonnefoi, H; Forbes, J F; Neven, P; Láng, I; Smith, I; Wardley, A; Price, K N; Goldhirsch, A; Coates, A S; Colleoni, M; Gelber, R D; Thürlimann, B

2014-01-01

There may be a relationship between the incidence of vasomotor and arthralgia/myalgia symptoms and treatment outcomes for postmenopausal breast cancer patients with endocrine-responsive disease who received adjuvant letrozole or tamoxifen. Data on patients randomized into the monotherapy arms of the BIG 1-98 clinical trial who did not have either vasomotor or arthralgia/myalgia/carpal tunnel (AMC) symptoms reported at baseline, started protocol treatment and were alive and disease-free at the 3-month landmark (n = 4,798) and at the 12-month landmark (n = 4,682) were used for this report. Cohorts of patients with vasomotor symptoms, AMC symptoms, neither, or both were defined at both 3 and 12 months from randomization. Landmark analyses were performed for disease-free survival (DFS) and for breast cancer free interval (BCFI), using regression analysis to estimate hazard ratios (HR) and 95 % confidence intervals (CI). Median follow-up was 7.0 years. Reporting of AMC symptoms was associated with better outcome for both the 3- and 12-month landmark analyses [e.g., 12-month landmark, HR (95 % CI) for DFS = 0.65 (0.49-0.87), and for BCFI = 0.70 (0.49-0.99)]. By contrast, reporting of vasomotor symptoms was less clearly associated with DFS [12-month DFS HR (95 % CI) = 0.82 (0.70-0.96)] and BCFI (12-month DFS HR (95 % CI) = 0.97 (0.80-1.18). Interaction tests indicated no effect of treatment group on associations between symptoms and outcomes. While reporting of AMC symptoms was clearly associated with better DFS and BCFI, the association between vasomotor symptoms and outcome was less clear, especially with respect to breast cancer-related events.

Cross-sections of 197Au(n,α)198Au and 63Cu(n,α)64Cu induced by 252Cf neutrons

International Nuclear Information System (INIS)

Mandal, Ranjita; Sengupta, D.; Roy, Malobika; Naik, Mamta; Bhoraskar, V.N.

2014-01-01

Analytical work, employing nuclear techniques, is normally carried out through (n,α) reaction because of the availability of neutrons either from reactors or laboratory sources such as Sb-Be, Am-Be, Ra-Be, Po-Be, 252 Cf, etc. The laboratory neutron sources are though portable and adaptable to a particular experimental arrangement, suffer from the disadvantage of slow neutron yield (except 252 Cf). In this set up since the neutrons available are monoenergetic, it was thought appropriate to initiate a program to measure cross-sections of a few nuclear reactions which have practical applications. Earlier studies on cross-section measurement of the reaction 197 Au(n,α) 198 Au and 63 Cu(n,α) 64 Cu has been carried out using different sources, monitors and techniques

Structure of 19O from measurement and R-matrix analysis of sigma(theta) for 18O(n,n)18O and 18O(n,n')18Osup(*) (1.98 MeV)

International Nuclear Information System (INIS)

Koehler, P.E.; Knox, H.D.; Resler, D.A.; Lane, R.O.

1986-01-01

Differential cross sections for neutrons elastically scattered from 18 O and inelastically scattered to the first excited state 18 Osup(*) (1.98 MeV) have been measured at forty-two incident energies for 5.0 19 O of 8.7 to 11.1 MeV. The cross sections were measured at eleven laboratory angles per energy from 20 0 to 160 0 and show considerable resonance structure. These new elastic and inelastic 1.98 MeV level data have been analyzed together with previously published cross sections for 0 19 O. The new assignments are compared to previous work where possible. Several previous assignments for resonances in the 0 19 F for the newly assigned levels in 19 O. On the basis of spin, parity, excitation energy and a comparison of reduced neutron widths in 19 O with reduced proton widths in 19 F, six previously-identified T=3/2 analogs were verified and eight new T=3/2 analogs were tentatively assigned. Comparisons with existing theoretical work are discussed. (orig.)

Measurement of Gamow-Teller and spin dipole strength in the 45Sc(n,p)45Ca reaction at 198 MeV

International Nuclear Information System (INIS)

Alford, W.P.; Celler, A.; Brown, B.A.; Long, S.; Raywood, K.

1990-11-01

The reaction 45 Sc(n,p) 45 Ca has been studied at an energy of 198 MeV with energy resolution of about 1 MeV. Measurements were carried out at nominal angles 0, 3, 6, 9, 12, 15, and 18 degrees and spectra obtained up to ∼40 MeV excitation energy in 45 Ca. Significant Gamow-Teller strength is observed at an excitation energy of about 7 MeV, somewhat higher than predicted by shell model calculations. The strength observed is in agreement with calculations using g A /g V ≅ 1. The spin dipole giant resonance is seen with centroid at about 15 MeV excitation and total cross section of 25 mb/sr at an angle of 6 degrees. (Author) (22 refs., 9 figs.)

Field displacement during external radiotherapy in prostatic adenocarcinoma treated with radioactive 198Au implants and external irradiation

International Nuclear Information System (INIS)

Lennernaes, B.; Letocha, H.; Rikner, G.; Magnusson, A.; Nilsson, S.

1995-01-01

The purpose of this work was to study displacement error and internal movements of the prostate during external beam radiotherapy. Verification films in the frontal (n=194) and lateral (n=64) portals were investigated in 14 patients treated with radioactive 198 Au implants. Displacement errors of two implants were investigated. In seven patients, filling of the rectum and the bladder with contrast medium or isotonic saline was performed during CT investigation for planning purposes to detect movements of the prostate. Most (95%) of the displacement errors were less than 10 mm in the frontal portal and less than 15 mm in the lateral portals. No correlation to the patient's weight was found. The displacement errors were randomly distributed. The spatial relations between the implants were not altered during the treatments. Small movements of the prostate were observed. To conclude, the positioning system employed at present (laser) can be sufficient for the margins used (2 cm). In lateral portals, however, the system did not have the ability to detect a possible systematic displacement error from simulator to accelerator. The intention is to decrease the margins to 1 cm, which will necessitate a better positioning system. (orig.)

Determination of the solid consumption in the transport of sands in sea beds with gold 198; Determinacion del gasto solido en el transporte de arenas en lechos marinos con oro 198

Energy Technology Data Exchange (ETDEWEB)

Rodriguez A, G

1983-07-01

The study of the movement of sediments in sea beds, is necessary when one plans to build a port. Among the techniques used for this studies, it is the radiotracer balance that gives an useful estimation of the quantity of sediment that it moves per day and by meter (perpendicular to the displacement). The main objectives of this work are: to) to present the characteristics of the obtaining of the used radiotracer, describing details those used safety measures, b) to describe the handling of the radiotracer and it radiological safety, during the transport and injection in the sea bottom, c) description of the detection way and the used equipment, d) to describe the information processing obtained in the field and finally, e) the estimate of the solid consumption and the determination of the direction and speed of displacement of those sediments in the sea bottom, in front of the Tabasco coast, to be used jointly with the information obtained by means of other techniques so that one can make a good planning of the operations of dredging during the construction and later on the maintenance of the Dos Bocas marine terminal. The first step is to obtain the radiotracer that in this case was sand of uniform grain metric, marked superficially with Gold-198. The second step is to transport the sand to the place of interest, to place it in the injection equipment and to deposit it in the sea bottom. The third step is to detect the radiotracer in the sea bed, from a craft that drags a sled, which takes mounted a scintillation detector of sodium iodide activated with thallium NaI(Tl) (probe). The fourth step is to process the field information and to obtain the corresponding results. (Author)

The Installation Restoration Program Toxicology Guide. Volume 2

Science.gov (United States)

1987-05-01

Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

Validation of absolute axial neutron flux distribution calculations with MCNP with 197Au(n,γ)198Au reaction rate distribution measurements at the JSI TRIGA Mark II reactor.

Science.gov (United States)

Radulović, Vladimir; Štancar, Žiga; Snoj, Luka; Trkov, Andrej

2014-02-01

The calculation of axial neutron flux distributions with the MCNP code at the JSI TRIGA Mark II reactor has been validated with experimental measurements of the (197)Au(n,γ)(198)Au reaction rate. The calculated absolute reaction rate values, scaled according to the reactor power and corrected for the flux redistribution effect, are in good agreement with the experimental results. The effect of different cross-section libraries on the calculations has been investigated and shown to be minor. Copyright © 2013 Elsevier Ltd. All rights reserved.

Usefulness of 198Au grain implants in the treatment of oral and oropharyngeal cancer

International Nuclear Information System (INIS)

Horiuchi, Junichi; Shibuya, Hitoshi; Matsumoto, Satoru; Hoshina, Masao; Suzuki, Soji; Takeda, Masamune

1991-01-01

A series of 177 patients with squamous cell carcinoma of the oral cavity and oropharynx were treated with 198 Au grain (gold grain) implants. Sites of the lesion included the tongue, mouth floor, buccal mucosa and oropharynx, especially the soft palate and faucial arch. Three-fourths of the patients were treated in combination with prior external beam irradiation. A permanent implant dose (total decay) of 80-90 Gy was given in the form of gold grains alone and in combination with an external dose of no more than 30 Gy, and 60-70 Gy, total decay, was given after an external dose greater than 30 Gy. The 2-year recurrence-free rate was 86.2 percent in the case of T 1 N 0 , 72.6 percent in T 2 N 0 and 72.2 percent in T 3 N 0 . The difference in the results of implant therapy alone and combined therapy was not significant. Late complications were minimal after grain implantation alone, and when used in combination, less than 70 mCi of grain activity after a 40 Gy external dose did not seem to be a serious hazard with respect to bone damage except in the case of cancer of the mouth floor. Gold grain implants were useful and easily applied under local anesthesia to early or super-ficial lesions at sites where a rigid linear source could not be used. Exposure of the radiology staff was only 5-10 mrad in the case of the usual 10-15 (50-75 mCi) implant grains. (author). 12 refs.; 3 figs. ; 5 tabs

Comment on “Mathematical modeling of unicellular microalgae and cyanobacteria metabolism for biofuel production” by Baroukh et al. [Curr Opin Biotechnol. 2015, 33:198–205

Energy Technology Data Exchange (ETDEWEB)

Song, Hyun-Seob; Ramkrishna, Doraiswami

2016-04-01

This letter concerns an article recently published in Current Opinion in Biotechnology by Baroukh et al. entitled "Mathematical modeling of unicellular microalgae and cyanobacteria metabolism for biofuel production" (2015 Mar 26; 33:198-205). The issue we wish to bring to light is the authors’ claim that dynamic metabolic models including Hybrid Cybernetic Model (HCM) (Kim et al., 2008; Song et al., 2009) and Lumped HCM (L-HCM) (Song and Ramkrishna, 2010; 2011) are based on the balanced growth hypothesis so that they are unable to simulate the accumulation of intracellular metabolites. This is a misrepresentation of these models due to the following reasons.

Thermal neutron calibration of a tritium extraction facility using the 6Li(n,t)4He/197Au(n,γ)198Au cross section ratio for standardization

International Nuclear Information System (INIS)

Bretscher, M.M.; Smith, D.L.

1980-08-01

Absolute tritium activities in a neutron-activated metallic lithium samples have been measured by liquid scintillation methods to provide data needed for the determination of capture-to-fission ratios in fast breeder reactor spectra and for recent measurements of the 7 Li(n,n't) 4 He cross section. The tritium extraction facility used for all these experiments has now been calibrated by measuring the 6 Li(n,t) 4 He/ 197 Au/n,γ) 198 Au activity ratio for thermal neutrons and comparing the result with the well-known cross sections. The calculated-to-measured activity ratio was found to be 1.033 +- 0.018. 2 figures, 20 tables

A simple method for labelling proteins with 211At via diazotized aromatic diamine

International Nuclear Information System (INIS)

Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

1987-01-01

A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

The advantage of letrozole over tamoxifen in the BIG 1-98 trial is consistent in younger postmenopausal women and in those with chemotherapy-induced menopause

DEFF Research Database (Denmark)

Chirgwin, Jacquie; Sun, Zhuoxin; Smith, Ian

2012-01-01

subclinical ovarian estrogen production), and those with chemotherapy-induced menopause who may experience return of ovarian function. In these situations tamoxifen may be preferable to an aromatase inhibitor. Among 4,922 patients allocated to the monotherapy arms (5 years of letrozole or tamoxifen......) in the BIG 1-98 trial we identified two relevant subpopulations: patients with potential residual ovarian function, defined as having natural menopause, treated without adjuvant or neoadjuvant chemotherapy and age ≤ 55 years (n = 641); and those with chemotherapy-induced menopause (n = 105). Neither...... of the subpopulations examined showed treatment effects differing from the trial population as a whole (interaction P values are 0.23 and 0.62, respectively). Indeed, both among the 641 patients aged ≤ 55 years with natural menopause and no chemotherapy (HR 0.77 [0.51, 1.16]) and among the 105 patients...

Desorption of Reactive Red 198 from activated carbon prepared from walnut shells: effects of temperature, sodium carbonate concentration and organic solvent dose

Directory of Open Access Journals (Sweden)

Zohreh Alimohamadi

2017-04-01

Full Text Available This study investigated the effect of temperature, different concentrations of sodium carbonate,and the dose of organic solvent on the desorption of Reactive Red 198 dye from dye-saturated activated carbon using batch and continuous systems. The results of the batch desorption test showed 60% acetone in water as the optimum amount. However, when the concentration of sodium carbonate was raised, the dye desorption percentage increased from 26% to 42% due to economic considerations; 15 mg/L of sodium carbonate was selected to continue the processof desorption. Increasing the desorption temperature can improve the dye desorption efficiency.According to the column test results, dye desorption concentration decreased gradually with the passing of time. The column test results showed that desorption efficiency and the percentage of dye adsorbed decreased; however, it seemed to stabilize after three repeated adsorption/desorption cycles. The repeated adsorption–desorption column tests (3 cycles showed that the activated carbon which was prepared from walnut shell was a suitable and economical adsorbent for dye removal.

Determination of the solid consumption in the transport of sands in sea beds with gold 198

International Nuclear Information System (INIS)

Rodriguez A, G.

1983-01-01

The study of the movement of sediments in sea beds, is necessary when one plans to build a port. Among the techniques used for this studies, it is the radiotracer balance that gives an useful estimation of the quantity of sediment that it moves per day and by meter (perpendicular to the displacement). The main objectives of this work are: to) to present the characteristics of the obtaining of the used radiotracer, describing details those used safety measures, b) to describe the handling of the radiotracer and it radiological safety, during the transport and injection in the sea bottom, c) description of the detection way and the used equipment, d) to describe the information processing obtained in the field and finally, e) the estimate of the solid consumption and the determination of the direction and speed of displacement of those sediments in the sea bottom, in front of the Tabasco coast, to be used jointly with the information obtained by means of other techniques so that one can make a good planning of the operations of dredging during the construction and later on the maintenance of the Dos Bocas marine terminal. The first step is to obtain the radiotracer that in this case was sand of uniform grain metric, marked superficially with Gold-198. The second step is to transport the sand to the place of interest, to place it in the injection equipment and to deposit it in the sea bottom. The third step is to detect the radiotracer in the sea bed, from a craft that drags a sled, which takes mounted a scintillation detector of sodium iodide activated with thallium NaI(Tl) (probe). The fourth step is to process the field information and to obtain the corresponding results. (Author)

Basic residues in the 74-83 and 191-198 segments of protein kinase CK2 catalytic subunit are implicated in negative but not in positive regulation by the beta-subunit

DEFF Research Database (Denmark)

Sarno, S; Vaglio, P; Marin, O

1997-01-01

by the beta-subunit many fold more than that of alpha wild type, while extrastimulation by beta mutant D55L56E57A, observable with alpha wild type, is abolished with these mutants. These data support the conclusion that down regulation by the acidic residues clustered in the N-terminal moiety of beta...... is mediated by basic residues in the 74-83 and in the 191-198 sequences of the alpha-subunit. These are also implicated in substrate recognition consistent with the concept that the N-terminal acidic region of the beta subunit operates as a pseudosubstrate. In contrast, another CK2alpha mutant, V66A, is more...

Dynamic Study on the Hepatobiliary Diseases with Combination of 131I-Rose bengal and 198Au-Colloid Scintiphotography

International Nuclear Information System (INIS)

Rhee, Yong Kok

1971-01-01

The radioactive 131 I-Rose bengal serial scintiphotography was performed in 62 patients with the hepatobiliary diseases and in 20 normal subjects. This approach permitted visualization of the hepatic uptake of 131 I-Rose bengal from the circulation and its excretion into the biliary trees and the intestines. In some of these patients, gallbladder function was examined, using eggs as a gallbladder constrictor. The time of maximum hepatic uptake was well correlated to the conventional biochemical liver function tests. In addition to 131 I-Rose bengal scintiphotography, 198 Au-colloid scintiphotography was also performed to make comparison of these two tests. The results obtained were as follows: 1) In normal subjects, the maximum hepatic uptake of 131 I-Rose bengal occurred at 23±2.9 minutes, the initial hepatic excretion at 34±5.1 minutes, the visualization of the gallbladder at 29±5.7 minutes and the intestinal visualization at 54±25.8 minutes. The radioactivity in the gallbladder decreased to 10.7±5.0% one hour after the ingestion of eggs. 2) In the patients with cirrhosis of the liver, there was a delayed and decreased hepatic uptake. The maximum hepatic uptake occurred at 43±12.9 minutes. The differences in the results of uptake between the cirrhotic and the normal group were statistically significant. The initial hepatic excretion occurred at 60±18.5 minutes and had tendency of delaying compared with the normal controls. The gallbladder was visualized in 13 of 16 cases (81%) and its visualization occurred at 49±14.6 minutes with a tendency to be delayed compared with the normal controls. The intestinal visualization occurred at 63±15.8 minutes and its delaying tendency was somewhat more prominent. 3) In patients with hepatitis, the maximum hepatic uptake occurred at 59±21.4 minutes and was significantly delayed. The initial hepatic excretion occurred at 82±34.3 minutes and the results revealed a delaying tendency. The gallbladder was visualized in 15

A compact sup 3 H(p,gamma) sup 4 He 19.8 MeV gamma-ray source for energy calibration at the Sudbury Neutrino Observatory

CERN Document Server

Poon, A W P; Waltham, C E; Browne, M C; Robertson, R G H; Kherani, N P; Mak, H B

2000-01-01

The Sudbury Neutrino Observatory (SNO) is a new 1000-t D sub 2 O Cherenkov solar neutrino detector. A high-energy gamma-ray source is needed to calibrate SNO beyond the sup 8 B solar neutrino endpoint of 15 MeV. This paper describes the design and construction of a source that generates 19.8 MeV gamma rays using the sup 3 H(p,gamma) sup 4 He reaction (''pT''), and demonstrates that the source meets all the physical, operational and lifetime requirements for calibrating SNO. An ion source was built into this unit to generate and to accelerate protons up to 30 keV, and a high-purity scandium tritide target with a scandium-tritium atomic ratio of 1 : 2.0+-0.2 was included. This pT source is the first self-contained, compact, and portable high-energy gamma-ray source (E subgamma>10 MeV). (authors)

ORIGINAL ARTICLE 198

African Journals Online (AJOL)

boaz

Résumé. La qualité de l'eau du fleuve Sokoto a été évalué pour déterminer sa charge bactérienne et types. Les techniques .... Discrete isolates from heterotrophic plate agar, kept on ..... (2009) Rainfall simulation in greenhouse microcosms to ...

Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

Science.gov (United States)

Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

2011-01-01

Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

High-level fluoroquinolone resistant Salmonella enterica serovar Kentucky ST198 epidemic clone with IncA/C conjugative plasmid carrying bla(CTX-M-25) gene.

Science.gov (United States)

Wasyl, Dariusz; Kern-Zdanowicz, Izabela; Domańska-Blicharz, Katarzyna; Zając, Magdalena; Hoszowski, Andrzej

2015-01-30

Multidrug resistant Salmonella Kentucky strains have been isolated from turkeys in Poland since 2009. Multiple mutations within chromosomal genes gyrA and parC were responsible for high-level ciprofloxacin resistance. One of the isolates was extended spectrum β-lactamase- (ESBL) positive: the strain 1643/2010 carried a conjugative 167,779 bps plasmid of IncA/C family. The sequence analysis revealed that it carried a blaCTX-M-25 gene and an integron with another β-lactamase encoding gene-blaOXA-21. This is the first known report of a CTX-M-25 encoding gene both in Poland and in Salmonella Kentucky world-wide, as well as in the IncA/C plasmid. Analysis of the integron showed a novel arrangement of gene cassettes-aacA4, aacC-A1 and blaOXA-21 where the latter might result from an intergeneric gene transfer. The study confirmed Salmonella Kentucky population isolated in Poland belongs to global epidemics of high level fluoroquinolone resistant clone ST198 that can carry rare β-lactamase genes. Copyright © 2014 Elsevier B.V. All rights reserved.

Dynamic Study on the Hepatobiliary Diseases with Combination of {sup 131}I-Rose bengal and {sup 198}Au-Colloid Scintiphotography

Energy Technology Data Exchange (ETDEWEB)

Rhee, Yong Kok [Seoul National University College of Medicine, Seoul (Korea, Republic of)

1971-03-15

The radioactive {sup 131}I-Rose bengal serial scintiphotography was performed in 62 patients with the hepatobiliary diseases and in 20 normal subjects. This approach permitted visualization of the hepatic uptake of {sup 131}I-Rose bengal from the circulation and its excretion into the biliary trees and the intestines. In some of these patients, gallbladder function was examined, using eggs as a gallbladder constrictor. The time of maximum hepatic uptake was well correlated to the conventional biochemical liver function tests. In addition to {sup 131}I-Rose bengal scintiphotography, {sup 198}Au-colloid scintiphotography was also performed to make comparison of these two tests. The results obtained were as follows: 1) In normal subjects, the maximum hepatic uptake of {sup 131}I-Rose bengal occurred at 23+-2.9 minutes, the initial hepatic excretion at 34+-5.1 minutes, the visualization of the gallbladder at 29+-5.7 minutes and the intestinal visualization at 54+-25.8 minutes. The radioactivity in the gallbladder decreased to 10.7+-5.0% one hour after the ingestion of eggs. 2) In the patients with cirrhosis of the liver, there was a delayed and decreased hepatic uptake. The maximum hepatic uptake occurred at 43+-12.9 minutes. The differences in the results of uptake between the cirrhotic and the normal group were statistically significant. The initial hepatic excretion occurred at 60+-18.5 minutes and had tendency of delaying compared with the normal controls. The gallbladder was visualized in 13 of 16 cases (81%) and its visualization occurred at 49+-14.6 minutes with a tendency to be delayed compared with the normal controls. The intestinal visualization occurred at 63+-15.8 minutes and its delaying tendency was somewhat more prominent. 3) In patients with hepatitis, the maximum hepatic uptake occurred at 59+-21.4 minutes and was significantly delayed. The initial hepatic excretion occurred at 82+-34.3 minutes and the results revealed a delaying tendency. The

Astatine-211 labelled proteins and their stability in vivo

International Nuclear Information System (INIS)

Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

1989-01-01

211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

Sport, sex and age increase risk of illness at the Rio 2016 Summer Paralympic Games: a prospective cohort study of 51 198 athlete days.

Science.gov (United States)

Derman, Wayne; Schwellnus, Martin P; Jordaan, Esme; Runciman, Phoebe; Blauwet, Cheri; Webborn, Nick; Lexell, Jan; Van de Vliet, Peter; Tuakli-Wosornu, Yetsa; Kissick, James; Stomphorst, Jaap

2018-01-01

To describe the epidemiology of illness at the Rio 2016 Summer Paralympic Games. A total of 3657 athletes from 78 countries, representing 83.5% of all athletes at the Games, were monitored on the web-based injury and illness surveillance system (WEB-IISS) over 51 198 athlete days during the Rio 2016 Summer Paralympic Games. Illness data were obtained daily from teams with their own medical support through the WEB-IISS electronic data capturing systems. The total number of illnesses was 511, with an illness incidence rate (IR) of 10.0 per 1000 athlete days (12.4%). The highest IRs were reported for wheelchair fencing (14.9), para swimming (12.6) and wheelchair basketball (12.5) (pParalympic Games; (2) the sports with the highest risk were wheelchair fencing, para swimming and wheelchair basketball; (3) female and older athletes (35-75 years) were at increased risk of illness; and (4) the respiratory system, skin and subcutaneous system and digestive system were most affected by illness. These results allow for comparison at future Games. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

International Nuclear Information System (INIS)

1995-07-01

This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

Systematic continuum-discretized coupled-channels calculations of total fusion for 6Li with targets 28Si, 59Co, 96Zr, 198Pt, and 209Bi: Effect of resonance states

Science.gov (United States)

Gómez Camacho, A.; Wang, Bing; Zhang, H. Q.

2018-05-01

Continuum discretized coupled-channel (CDCC) calculations of total fusion cross sections for reactions induced by the weakly bound nucleus 6Li with targets 28Si, 59Co, 96Zr, 198Pt, and 209Bi at energies around the Coulomb barrier are presented. In the cluster structure frame of 6Li→α +d , short-range absorption potentials are considered for the interactions between the α and d fragments with the targets. The effect of resonance (l =2 , Jπ=3+,2+,1+ ) and nonresonance states of 6Li on fusion is studied by using two approaches: (1) by omitting the resonance states from the full discretized CDCC breakup space and (2) by considering only the resonance subspace. A systematic analysis of the effect on fusion from resonance breakup couplings is carried out from light to heavy mass targets. Among other things, it is found that resonance breakup states produce strong repulsive polarization potentials that lead to fusion suppression. Couplings from nonresonance states give place to weak repulsive potentials at high energies; however, these become attractive for the heavier targets at low energies.

Antiapoptotic effect of novel compound from Herba leonuri - leonurine (SCM-198): a mechanism through inhibition of mitochondria dysfunction in H9c2 cells.

Science.gov (United States)

Liu, Xin Hua; Pan, Li Long; Gong, Qi Hai; Zhu, Yi Zhun

2010-12-01

Apoptosis of cardiomyocytes induced by oxidative stress play a critical role in cardiac dysfunction associated with ventricular remodeling and heart failure. We recently reported that leonurine attenuated hypoxia-induced cardiomyocyte damage. In this study, we investigated the mechanism of leonurine (originally from Herba leonuri but we synthesized it chemically it as also called SCM-198) (H₂O₂)-induced rat embryonic heart-derived H9c2 cells from apoptosis. Exposing H9c2 cells to H₂O₂ significantly decreased cell viability, and this was attenuated by pretreatment with leonurine for 4 h in a concentration-dependent manner. Meanwhile, leonurine was found to reduce intracellular reactive oxygen species (ROS) generation in H₂O₂-stimulated cell. Moreover, H9c2 cells stimulated by H₂O₂ was accompanied with apparent apoptotic characteristics, including fragmentation of DNA, apoptotic body formation, release of cytochrome c, translocation of Bax to mitochondria, loss of mitochondrial membrane potential (ΔΨ(m)) and activation of caspase 3. Furthermore, H₂O₂ also induced rapid and significant phosphorylation of the c-Jun-N-terminal kinase 1/2 (JNK1/2), which was inhibited SP600125 (a JNK1/2 inhibitor). All of these events were attenuated by leonurine pretreatment. Taken together, these results demonstrated that leonurine could protect H9c2 cells from H₂O₂-induced apoptosis via modulation of mitochondrial dysfunction associated with blocking the activation of JNK1/2.

21 CFR 558.198 - Diclazuril.

Science.gov (United States)

2010-04-01

... health of birds challenged with E. maxima. Feed continuously. Not for use in hens producing eggs for... not feed to breeding turkeys. Not for use in hens producing eggs for human consumption. 016592 (ii) 0... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS...

Study and construction of a {beta}-spectrometer of uniform axial magnetic field fitted with a {beta}-{gamma} coincidence selector. Study of the {beta} spectra of {sup 32}P, {sup 203}Hg, {sup 198}Au. Measurement of the conversion coefficients of {sup 203}Ti and of {sup 198}Hg; Etude et realisation d'un spectrometre-{beta} a champ magnetique axial uniforme, muni d'un selecteur de coincidence {beta}-{gamma}. Etude des spectres {beta} du {sup 32}p, {sup 203}Hg, {sup 198}Au. Mesure des coefficients de conversion du {sup 203}Ti et du {sup 198}Hg

Energy Technology Data Exchange (ETDEWEB)

Parsignault, D [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-06-01

In the first part is given the principle of the beta spectrometer with uniform axial field using systematically the idea of caustics. The apparatus is described and its properties compared to those deduced from trajectory calculations. The {beta}-ray and {gamma}-ray detectors and the device for selecting coincidences with a 2 {tau} resolution of 5 nanoseconds are also presented. In the second part, the spectrometer is used for studying reference elements and the most accurate results are confirmed. The {beta} spectrum of {sup 60}Co has a statistical form with an accuracy of 1 per cent; the maximum energy E{sub 0} is 316.5 {+-} 1.5 keV. That of the 7/2 + {yields} 11/2 transition for {sup 137}Cs has a unique form, once forbidden. E{sub 0}= 522 {+-} 3 keV. Conversion coefficients {alpha}{sub k} = 96 {+-} 1 X 10{sup -3} {alpha}L + M + N = 20.9 {+-} 0.5 X 10{sup -3}. The two {beta} spectra of {sup 59}Fe, separated by coincidence with the gamma, have the statistical form E{sub 0} = 462 {+-} 2 keV (55.1 + 0,3 per cent) and E{sub 1} = 275 {+-} 4 keV (44.9 {+-} 0.3 per cent). It is then verified whether the l selection rule is apparent in the shape of the phosphorus 32 beta spectrum. It is found in fact that it is not of statistical shape and its shape coefficient is determined. For a theoretical interpretation it is necessary to have better approximations than those generally used and this interpretation will not be unique. This work has also made it possible to show that the source contains a small proportion of {sup 33}P. The study of the {sup 203}Hg {beta} spectrum followed by the 279 keV gamma spectrum is designed to determine the conversion coefficients. The interior spectrum of gold 198 is not of statistical shape either. The form coefficient is determined together with the conversion coefficients which are in slight disagreement with those calculated by Rose or Sliv. An interpretation of the spectrum is put forward which proposes an imperfect compensation for the

Study and construction of a {beta}-spectrometer of uniform axial magnetic field fitted with a {beta}-{gamma} coincidence selector. Study of the {beta} spectra of {sup 32}P, {sup 203}Hg, {sup 198}Au. Measurement of the conversion coefficients of {sup 203}Ti and of {sup 198}Hg; Etude et realisation d'un spectrometre-{beta} a champ magnetique axial uniforme, muni d'un selecteur de coincidence {beta}-{gamma}. Etude des spectres {beta} du {sup 32}p, {sup 203}Hg, {sup 198}Au. Mesure des coefficients de conversion du {sup 203}Ti et du {sup 198}Hg

Energy Technology Data Exchange (ETDEWEB)

Parsignault, D. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-06-01

In the first part is given the principle of the beta spectrometer with uniform axial field using systematically the idea of caustics. The apparatus is described and its properties compared to those deduced from trajectory calculations. The {beta}-ray and {gamma}-ray detectors and the device for selecting coincidences with a 2 {tau} resolution of 5 nanoseconds are also presented. In the second part, the spectrometer is used for studying reference elements and the most accurate results are confirmed. The {beta} spectrum of {sup 60}Co has a statistical form with an accuracy of 1 per cent; the maximum energy E{sub 0} is 316.5 {+-} 1.5 keV. That of the 7/2 + {yields} 11/2 transition for {sup 137}Cs has a unique form, once forbidden. E{sub 0}= 522 {+-} 3 keV. Conversion coefficients {alpha}{sub k} = 96 {+-} 1 X 10{sup -3} {alpha}L + M + N = 20.9 {+-} 0.5 X 10{sup -3}. The two {beta} spectra of {sup 59}Fe, separated by coincidence with the gamma, have the statistical form E{sub 0} = 462 {+-} 2 keV (55.1 + 0,3 per cent) and E{sub 1} = 275 {+-} 4 keV (44.9 {+-} 0.3 per cent). It is then verified whether the l selection rule is apparent in the shape of the phosphorus 32 beta spectrum. It is found in fact that it is not of statistical shape and its shape coefficient is determined. For a theoretical interpretation it is necessary to have better approximations than those generally used and this interpretation will not be unique. This work has also made it possible to show that the source contains a small proportion of {sup 33}P. The study of the {sup 203}Hg {beta} spectrum followed by the 279 keV gamma spectrum is designed to determine the conversion coefficients. The interior spectrum of gold 198 is not of statistical shape either. The form coefficient is determined together with the conversion coefficients which are in slight disagreement with those calculated by Rose or Sliv. An interpretation of the spectrum is put forward which proposes an imperfect compensation for the

Study of the potentiometric response of the doped spinel Li1.05Al0.02Mn1.98O4 for the optimization of a selective lithium ion sensor

International Nuclear Information System (INIS)

Freitas, Bruno H.; Amaral, Fabio A.; Bocchi, Nerilso; Teixeira, Marcos F.S.

2010-01-01

In this paper, we studied the development of a selective lithium ion sensor constituted of a carbon paste electrode modified (CPEM) with an aluminum-doped spinel-type manganese oxide (Li 1.05 Al 0.02 Mn 1.98 O 4 ) for investigating the influence of a doping ion in the sensor response. Experimental parameters, such as influence of the lithium concentration in the activation of the sensor by cyclic voltammetry, pH of the carrier solution and selectivity for Li + against other alkali and alkaline-earth ions were investigated. The sensor response to lithium ions was linear in the concentration range 5.62 x 10 -5 to 1.62 x 10 -3 mol L -1 with a slope 100.1 mV/decade over a wide pH 10 (Tris buffer) and detection limit of 2.75 x 10 -5 mol L -1 , without interference of other alkali and alkaline-earth metals, demonstrating that the Al 3+ doping increases the structure stability and improves the potentiometric response and sensitivity of the sensor. The super-Nernstian response of the sensor in pH 10 can be explained by mixed potential arising from two equilibria (redox and ion-exchange) in the spinel-type manganese oxide.

Microdosimetry of astatine-211 and comparison with that of iodine-125

International Nuclear Information System (INIS)

Unak, T.

2001-01-01

211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

Science.gov (United States)

Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

2017-05-31

211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex.

Science.gov (United States)

Papadimitriou, Konstantinos; Anastasiou, Rania; Mavrogonatou, Eleni; Blom, Jochen; Papandreou, Nikos C; Hamodrakas, Stavros J; Ferreira, Stéphanie; Renault, Pierre; Supply, Philip; Pot, Bruno; Tsakalidou, Effie

2014-04-08

Within the genus Streptococcus, only Streptococcus thermophilus is used as a starter culture in food fermentations. Streptococcus macedonicus though, which belongs to the Streptococcus bovis/Streptococcus equinus complex (SBSEC), is also frequently isolated from fermented foods mainly of dairy origin. Members of the SBSEC have been implicated in human endocarditis and colon cancer. Here we compare the genome sequence of the dairy isolate S. macedonicus ACA-DC 198 to the other SBSEC genomes in order to assess in silico its potential adaptation to milk and its pathogenicity status. Despite the fact that the SBSEC species were found tightly related based on whole genome phylogeny of streptococci, two distinct patterns of evolution were identified among them. Streptococcus macedonicus, Streptococcus infantarius CJ18 and Streptococcus pasteurianus ATCC 43144 seem to have undergone reductive evolution resulting in significantly diminished genome sizes and increased percentages of potential pseudogenes when compared to Streptococcus gallolyticus subsp. gallolyticus. In addition, the three species seem to have lost genes for catabolizing complex plant carbohydrates and for detoxifying toxic substances previously linked to the ability of S. gallolyticus to survive in the rumen. Analysis of the S. macedonicus genome revealed features that could support adaptation to milk, including an extra gene cluster for lactose and galactose metabolism, a proteolytic system for casein hydrolysis, auxotrophy for several vitamins, an increased ability to resist bacteriophages and horizontal gene transfer events with the dairy Lactococcus lactis and S. thermophilus as potential donors. In addition, S. macedonicus lacks several pathogenicity-related genes found in S. gallolyticus. For example, S. macedonicus has retained only one (i.e. the pil3) of the three pilus gene clusters which may mediate the binding of S. gallolyticus to the extracellular matrix. Unexpectedly, similar findings were

High precompetition injury rate dominates the injury profile at the Rio 2016 Summer Paralympic Games: a prospective cohort study of 51 198 athlete days.

Science.gov (United States)

Derman, Wayne; Runciman, Phoebe; Schwellnus, Martin; Jordaan, Esme; Blauwet, Cheri; Webborn, Nick; Lexell, Jan; van de Vliet, Peter; Tuakli-Wosornu, Yetsa; Kissick, James; Stomphorst, Jaap

2018-01-01

To describe the incidence of injury in the precompetition and competition periods of the Rio 2016 Summer Paralympic Games. A total of 3657 athletes from 78 countries, representing 83.4% of all athletes at the Games, were monitored on the web-based injury and illness surveillance system over 51 198 athlete days during the Rio 2016 Summer Paralympic Games. Injury data were obtained daily from teams with their own medical support. A total of 510 injuries were reported during the 14-day Games period, with an injury incidence rate (IR) of 10.0 injuries per 1000 athlete days (12.1% of all athletes surveyed). The highest IRs were reported for football 5-a-side (22.5), judo (15.5) and football 7-a-side (15.3) compared with other sports (pGames (IR of 5.5). The shoulder was the most common anatomical area affected by injury (IR of 1.8). The data from this study indicate that (1) IRs were lower than those reported for the London 2012 Summer Paralympic Games, (2) the sports of football 5-a-side, judo and football 7-a-side were independent risk factors for injury, (3) precompetition injuries had a higher IR than competition period injuries, (4) injuries to the shoulder were the most common. These results would allow for comparative data to be collected at future editions of the Games and can be used to inform injury prevention programmes. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Reference: 198 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available etion of either RIC4 or RIC3 causes tip growth defects that are rescued by overproduction or depletion...C4. RIC4 promotes F-actin assembly, whereas RIC3 activates Ca(2+) signaling that leads to F-actin disassembly. Overproduction or depl

Publications | Page 198 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Access to water, time allocation and income in rural India (restricted access). In this paper we show that investments to improve the supply and management of water reduce the time spent in fetching water by both men and women, which in turn will lead to a reallocation of the time saved to productive activities, and result in ...

Publications | Page 198 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Multi-faceted approach to promote knowledge translation platforms in eastern Mediterranean countries: climate for evidence-informed policy (open access). Objectives: Limited work has been done to promote knowledge translation (KT) in the Eastern Mediterranean Region (EMR). The objectives of this study are to: ...

Publications | Page 198 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Access to water, time allocation and income in rural India (restricted access) ... in fetching water by both men and women, which in turn will lead to a reallocation of the ... Exploring inequalities in access to and use of maternal health services in ...

42 CFR 81.23 - Guidelines for cancers for which primary site is unknown.

Science.gov (United States)

2010-10-01

...), 189 (M). Brain and spinal cord (198.3) 162, 172 (M), 174 (F). Other parts of nervous system (198.4) 162, 172 (M), 174 (F), 185 (M), 202. Bone and bone marrow (198.5) 162, 174 (F), 185 (M). Ovary (198.6...

Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

International Nuclear Information System (INIS)

Kolachkovski, A.; Khalkin, V.A.

1976-01-01

Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

International Nuclear Information System (INIS)

Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

1982-01-01

The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

International Nuclear Information System (INIS)

Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

2011-01-01

Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

Page | 198 POLICE CORRUPTION AND ADMINISTRATION OF ...

African Journals Online (AJOL)

Fr. Ikenga

2017-08-07

Aug 7, 2017 ... government to finance and embark on policies that will develop this .... sometimes acted upon instruction of the superior police officer or officers. .... to Chief Magistrate Court by the Police then require the advice of the Director ...

38 CFR 21.198 - “Discontinued” status.

Science.gov (United States)

2010-07-01

... discontinued status following assignment to interrupted status as provided in § 21.197 for reasons including... acceptable reason for his or her failure to do so following assignment to interrupted status, the veteran's... staff are unable to estimate an approximate date by which the veteran will be able to begin or return to...

Page | 198 POLICE CORRUPTION AND ADMINISTRATION OF ...

African Journals Online (AJOL)

Fr. Ikenga

2017-08-07

Aug 7, 2017 ... to be abused due to the influence of social evils such as corruption, favouritism, dishonesty, fraud, tribalism, ethnicity and even villagism. These social problems are not peculiar to the Nigeria Police alone. They are ..... At this stage, the suspect sometimes through his lawyer has to negotiate with the Police ...

Preparation of radioactive colloidal gold 198Au

International Nuclear Information System (INIS)

Cammarosano, S.A.

1979-01-01

The preparation with simple equipment of radioactive colloidal gold of particle size about approximately 300 A from seed colloid stabilized by gelatine is described. Some physico-chemical parameters which can affect the process of formation of these colloidal particles are analysed; particle size has been meassured with an electron microscope. The colloid stability has been studied as a function of dilution, age and pH. Nucleation and growth of radioactive colloidal gold have been studied using spectrophotometry. Absorption spectra of the two ones are presented and compared. Quality control of the production process is verified through measurement of parameters, such as radioactive and radiochemical purity and biological distribution in laboratorial animals. This distribution was evalusted for rats injected endovenously with the gold colloidal solution.(Author) [pt

Assessment of letrozole and tamoxifen alone and in sequence for postmenopausal women with steroid hormone receptor-positive breast cancer: the BIG 1-98 randomised clinical trial at 8·1 years median follow-up.

Science.gov (United States)

Regan, Meredith M; Neven, Patrick; Giobbie-Hurder, Anita; Goldhirsch, Aron; Ejlertsen, Bent; Mauriac, Louis; Forbes, John F; Smith, Ian; Láng, István; Wardley, Andrew; Rabaglio, Manuela; Price, Karen N; Gelber, Richard D; Coates, Alan S; Thürlimann, Beat

2011-11-01

Postmenopausal women with hormone receptor-positive early breast cancer have persistent, long-term risk of breast-cancer recurrence and death. Therefore, trials assessing endocrine therapies for this patient population need extended follow-up. We present an update of efficacy outcomes in the Breast International Group (BIG) 1-98 study at 8·1 years median follow-up. BIG 1-98 is a randomised, phase 3, double-blind trial of postmenopausal women with hormone receptor-positive early breast cancer that compares 5 years of tamoxifen or letrozole monotherapy, or sequential treatment with 2 years of one of these drugs followed by 3 years of the other. Randomisation was done with permuted blocks, and stratified according to the two-arm or four-arm randomisation option, participating institution, and chemotherapy use. Patients, investigators, data managers, and medical reviewers were masked. The primary efficacy endpoint was disease-free survival (events were invasive breast cancer relapse, second primaries [contralateral breast and non-breast], or death without previous cancer event). Secondary endpoints were overall survival, distant recurrence-free interval (DRFI), and breast cancer-free interval (BCFI). The monotherapy comparison included patients randomly assigned to tamoxifen or letrozole for 5 years. In 2005, after a significant disease-free survival benefit was reported for letrozole as compared with tamoxifen, a protocol amendment facilitated the crossover to letrozole of patients who were still receiving tamoxifen alone; Cox models and Kaplan-Meier estimates with inverse probability of censoring weighting (IPCW) are used to account for selective crossover to letrozole of patients (n=619) in the tamoxifen arm. Comparison of sequential treatments to letrozole monotherapy included patients enrolled and randomly assigned to letrozole for 5 years, letrozole for 2 years followed by tamoxifen for 3 years, or tamoxifen for 2 years followed by letrozole for 3 years

Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

DEFF Research Database (Denmark)

Back, T.; Haraldsson, B.; Hultborn, R

2009-01-01

of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

Boiling points of the superheavy elements 117 and 118

International Nuclear Information System (INIS)

Takahashi, N.

2001-01-01

It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

DEFF Research Database (Denmark)

Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

2014-01-01

Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

Epimedium koreanum Nakai Water Extract Exhibits Antiviral Activity against Porcine Epidermic Diarrhea Virus In Vitro and In Vivo

Directory of Open Access Journals (Sweden)

Won-Kyung Cho

2012-01-01

Full Text Available Porcine epidemic diarrhea virus (PEDV causes diarrhea of pigs age-independently and death of young piglets, resulting in economic loss of porcine industry. We have screened 333 natural oriental herbal medicines to search for new antiviral candidates against PEDV. We found that two herbal extracts, KIOM 198 and KIOM 124, contain significant anti-PED viral effect. KIOM 198 and KIOM 124 were identified as Epimedium koreanum Nakai and Lonicera japonica Thunberg, respectively. The further plaque and CPE inhibition assay in vitro showed that KIOM 198 has much stronger antiviral activity than KIOM 124. Additionally, KIOM 198 exhibited a similar extent of antiviral effect against other subtypes of Corona virus such as sm98 and TGE viruses. Cytotoxicity results showed that KIOM 198 is nontoxic on the cells and suggest that it can be delivered safely for therapy. Furthermore, when we orally administered KIOM 198 to piglets and then infected them with PEDV, the piglets did not show any disease symptoms like diarrhea and biopsy results showed clean intestine, whereas control pigs without KIOM 198 treatment exhibited PED-related severe symptoms. These results imply that KIOM 198 contains strong antiviral activity and has a potential to be developed as an antiviral phytomedicine to treat PEDV-related diseases in pigs.

Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

Energy Technology Data Exchange (ETDEWEB)

Wilbur, Daniel Scott

2012-12-12

Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

International Nuclear Information System (INIS)

Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

2008-01-01

We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

International Nuclear Information System (INIS)

Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

1998-01-01

We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

New developments of the in-source spectroscopy method at RILIS/ISOLDE

CERN Document Server

Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

2013-01-01

At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

Studies of Stable Octupole Deformations in the Radium Region

CERN Multimedia

2002-01-01

The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

International Nuclear Information System (INIS)

Hofer, K.G.

1980-06-01

Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application

Dietary carotenoid-rich oil supplementation improves exercise-induced anisocytosis in runners: influences of haptoglobin, MnSOD (Val9Ala), CAT (21A/T) and GPX1 (Pro198Leu) gene polymorphisms in dilutional pseudoanemia (sports anemia).

Science.gov (United States)

Miranda-Vilela, Ana L; Akimoto, Arthur K; Alves, Penha C Z; Pereira, Luiz C S; Klautau-Guimarães, Maria N; Grisolia, Cesar K

2010-04-01

Physical training induces beneficial adaptation, whereas exhaustive exercises increase reactive oxygen-species generation, thereby causing oxidative damage in plasma and erythrocytes, fractions susceptible to lipid peroxidation. Pequi (Caryocar brasiliense Camb.) is a Brazilian Cerrado fruit containing a carotenoid-rich oil. The aim was to investigate the effects of pequi-oil on exercise-induced oxidative damage in plasma and erythrocytes, after running in the same environment and undergoing weekly training under the same conditions as to type, intensity and length. Evaluations were accomplished after outdoor running on flat land before and after ingestion of 400 mg pequi-oil capsules for 14 days. Blood samples were taken after running and submitted to TBARS assay and erythrogram analysis. Haptoglobin, MnSOD (Val9Ala), CAT (21A/T) and GPX1 (Pro198Leu) gene polymorphisms were priorly investigated, so as to estimate genetic influence The reduction in erythrocytes, hemoglobin and hematocrit after pequi-oil treatment was notably associated with higher plasma expansion. Except for MCHC (mean corpuscular hemoglobin concentration) and RDW (red cell distribution width), the results were influenced by the polymorphisms studied. The best response to pequi-oil was presented by MnSOD Val/Val, CAT AA or AT genotypes and the GPX1 Pro allele. The significantly lower RDW and higher MHCH values were related to pequi-oil protective effects. Pequi oil, besides possessing other nutritional properties, showed protective blood effects.

30 CFR 250.198 - Documents incorporated by reference.

Science.gov (United States)

2010-07-01

... Gravity), or API Gravity of Crude Petroleum and Liquid Petroleum Products by Hydrometer Method, Second... Density or Relative Density of Light Hydrocarbons by Pressure Hydrometer, Second Edition, March 2003...

33_198 - 203 -Nas et al.,_PHYTOCHEMICAL SCREENING

African Journals Online (AJOL)

user pc

2017-12-02

Dec 2, 2017 ... alkaloids, tannins, saponins, phenolic compoun. (Cowan, 1999). ... actericidal Concentration (MBC) of the extracts ranges from 12.5 cts. ... l activity, Garcinia kola, Methicillin Resistant Staphylococcus aure lants lie in ..... antioxidant, antiviral, antidiabetic and anti-hepatotoxic activities ... beer brewing. World.

South Asia | Page 198 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

The stories presented in Success Stories in Asian Aquaculture reflect the unique nature of Asian aquaculture, providing first-time insight into how and why it has become so successful. Overall, the book demonstrates how the resiliency, adaptability, and innovation of small-scale aquaculture farmers have been crucial to this ...

Novel Therapeutic Effects of Leonurine On Ischemic Stroke: New Mechanisms of BBB Integrity

Directory of Open Access Journals (Sweden)

Qiu-Yan Zhang

2017-01-01

Full Text Available Stroke is a leading cause of morbidity and mortality globally. Leonurine (also named SCM-198, a compound extracted from Herba leonuri, was effective on the prevention of various cardiovascular and brain diseases. The purpose of this study was to explore the possible therapeutic potential of SCM-198 against ischemia reperfusion injury and underlying mechanisms. In the in vivo transient middle cerebral artery occlusion (tMCAO rat model, we found that treatment with SCM-198 could decrease infarct volume and improve neurological deficit by protecting against blood-brain barrier (BBB breakdown. In the in vitro model of cell oxygen-glucose deprivation and reoxygenation (OGD/R, consistent results were obtained with decreased reactive oxygen species (ROS production and maintained the BBB integrity. Further study demonstrated that SCM-198 increased the expression of histone deacetylase- (HDAC- 4 which could inhibit NADPH oxidase- (NOX- 4 and matrix metalloproteinase- (MMP- 9 expression, resulting in the elevation of tight junction proteins, including claudin-5, occludin, and zonula occluden- (ZO- 1. These results indicated SCM-198 protected BBB integrity by regulating the HDAC4/NOX4/MMP-9 tight junction pathway. Our findings provided novel insights into the protective effects and mechanisms of SCM-198 on ischemic stroke, indicating SCM-198 as a new class of potential drug against acute onset of ischemic stroke.

Production of Astatine-211 at the Duke University Medical Center for its regional distribution

Energy Technology Data Exchange (ETDEWEB)

Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

2016-01-01

Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as ²¹¹At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of ²¹¹At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve ²¹¹At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used ²¹¹At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a ²¹¹At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

Dietary carotenoid-rich oil supplementation improves exercise-induced anisocytosis in runners: influences of haptoglobin, MnSOD (Val9Ala, CAT (21A/T and GPX1 (Pro198Leu gene polymorphisms in dilutional pseudoanemia ("sports anemia"

Directory of Open Access Journals (Sweden)

Ana L. Miranda-Vilela

2010-01-01

Full Text Available Physical training induces beneficial adaptation, whereas exhaustive exercises increase reactive oxygen-species generation, thereby causing oxidative damage in plasma and erythrocytes, fractions susceptible to lipid peroxidation. Pequi (Caryocar brasiliense Camb. is a Brazilian Cerrado fruit containing a carotenoid-rich oil. The aim was to investigate the effects of pequi-oil on exercise-induced oxidative damage in plasma and erythrocytes, after running in the same environment and undergoing weekly training under the same conditions as to type, intensity and length. Evaluations were accomplished after outdoor running on flat land before and after ingestion of 400 mg pequi-oil capsules for 14 days. Blood samples were taken after running and submitted to TBARS assay and erythrogram analysis. Haptoglobin, MnSOD (Val9Ala, CAT (21A/T and GPX1 (Pro198Leu gene polymorphisms were priorly investigated, so as to estimate genetic influence The reduction in erythrocytes, hemoglobin and hematocrit after pequi-oil treatment was notably associated with higher plasma expansion. Except for MCHC (mean corpuscular hemoglobin concentration and RDW (red cell distribution width, the results were influenced by the polymorphisms studied. The best response to pequi-oil was presented by MnSOD Val/Val, CAT AA or AT genotypes and the GPX1 Pro allele. The significantly lower RDW and higher MHCH values were related to pequi-oil protective effects. Pequi oil, besides possessing other nutritional properties, showed protective blood effects.

HER2 status predicts for upfront AI benefit: A TRANS-AIOG meta-analysis of 12,129 patients from ATAC, BIG 1-98 and TEAM with centrally determined HER2.

Science.gov (United States)

Bartlett, John M S; Ahmed, Ikhlaaq; Regan, Meredith M; Sestak, Ivana; Mallon, Elizabeth A; Dell'Orto, Patrizia; Thürlimann, Beat; Seynaeve, Caroline; Putter, Hein; Van de Velde, Cornelis J H; Brookes, Cassandra L; Forbes, John F; Viale, Giuseppe; Cuzick, Jack; Dowsett, Mitchell; Rea, Daniel W

2017-07-01

A meta-analysis of the effects of HER2 status, specifically within the first 2-3 years of adjuvant endocrine therapy, has the potential to inform patient selection for upfront aromatase inhibitor (AI) therapy or switching strategy tamoxifen followed by AI. The pre-existing standardisation of methodology for HER2 (immunohistochemistry/fluorescence in situ hybridization) facilitates analysis of existing data for this key marker. Following a prospectively designed statistical analysis plan, patient data from 3 phase III trials Arimidex, Tamoxifen, Alone or in Combination Trial (ATAC), Breast International Group (BIG) 1-98 and Tamoxifen Exemestane Adjuvant Multicentre Trial (TEAM)] comparing an AI to tamoxifen during the first 2-3 years of adjuvant endocrine treatment were collected and a treatment-by-marker analysis of distant recurrence-free interval-censored at 2-3 years treatment - for HER2 status × AI versus tamoxifen treatment was performed to address the clinical question relating to efficacy of 'upfront' versus 'switch' strategies for AIs. A prospectively planned, patient-level data meta-analysis across 3 trials demonstrated a significant treatment (AI versus tamoxifen) by marker (HER2) interaction in a multivariate analysis; (interaction hazard ratio [HR] = 1.61, 95% CI 1.01-2.57; p data meta-analysis demonstrated a significant interaction between HER2 status and treatment with AI versus tamoxifen in the first 2-3 years of adjuvant endocrine therapy. Patients with HER2-ve cancers experienced improved outcomes (distant relapse) when treated with upfront AI rather than tamoxifen, whilst patients with HER2+ve cancers fared no better or slightly worse in the first 2-3 years. However, the small number of HER2+ve cancers/events may explain a large degree of heterogeneity in the HER2+ve groups across all 3 trials. Other causes, perhaps related to subtle differences between AIs, cannot be excluded and warrant further exploration. Copyright © 2017 Elsevier Ltd

Study on liver scintigram using sup(99m)Tc-Sn colloid

International Nuclear Information System (INIS)

Nagase, Katsuya; Maruo, Kuninobu

1975-01-01

First of all, the liver scintigram was taken using 198 Au-colloid in cases of liver diseases, especially cases which seemed to have morphological changes in the liver. Of these cases, in cases which were found to have lesions the liver scintigram was subsequently taken using sup(99m)Tc-Sn colloid. In addition, in order to compare the state of lesions in both liver scintigrams with 198 Au-colloid and sup(99m)Tc-Sn colloid, ultrasonic tomogram was taken at each time. The scintigram using sup(99m)Tc-Sn colloid seemed to more clearly reveal the state of lesions and their sizes in the thin liver regions, especially the right border, the lower border and the left lobe in the liver, compared with 198 Au-colloid scintigram. The lesions in the thick liver tissues, especially the central right lobe, sometimes became unclear using sup(99m)Tc-Sn colloid. Therefore, 198 Au-colloid seemed to be available in these lesions. The scintigram using sup(99m)Tc-Sn colloid was found more useful for the diagnosis of lesions of patients with liver, cirrhosis whom the uptake rate of 198 Au-colloid is poor, compared with 198 Au-colloid scintigram. (Namekawa, K.)

Nuclear and chemical data for life sciences

International Nuclear Information System (INIS)

Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand

2013-01-01

Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

CERN Document Server

De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer

International Nuclear Information System (INIS)

Wilbur, D. Scott

2011-01-01

This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.

Suppression of hepatic hematopoiesis with radioactive gold (198Au)

International Nuclear Information System (INIS)

Turner, A.R.; Gummerman, L.W.; Boggs, D.R.

1985-01-01

A patient with idiopathic myelofibrosis of some 20 yr duration developed esophageal varices and ascites. No explanation for increased portal pressure other than hepatic hematopoiesis was found. Consequently, a trial of cobalt irradiation to the liver was undertaken with definite but transient decrease in ascites. Subsequently, two courses of radioactive colloidal gold were given, again with definite but transient beneficial effects on the degree of ascites. This latter benefit occurred without suppression of marrow function

19 CFR 10.198 - Evidence of country of origin.

Science.gov (United States)

2010-04-01

... the growth, product, or manufacture of a beneficiary country—(i) Declaration. In a case involving an article covered by a formal entry which is not wholly the growth, product, or manufacture of a single... for good cause shown. Failure to submit the declaration in a timely fashion will result in a denial of...

Results of 198Au-colloid radiosynovectomy in rheumatoid arthritis

International Nuclear Information System (INIS)

Drozdovski, B.Ya.; Ikonnikov, A.I.

1989-01-01

260 patients with rheumatoid arthritis received injections of colloidal radiogold into their affected joints. The findings of radiosynoviorthesis were analysed in 210 patients. The therapeutic effect developed gradually. The best clinical results were found to occur after 12th month. At the end of the 2nd year 47% of the patients revealed a significant improvement, 38% an improvement and 15% of the patients involved showed no therapeutic effect. Good results were obtained with patients of the roentgenological stage I and II and the disease (70%). (author)

14 CFR 198.5 - Types of insurance coverage available.

Science.gov (United States)

2010-01-01

... transported, on the aircraft referred to in paragraph (a) of this section. (e) Statutory or contractual obligations, or any other liability, of the aircraft referred to in paragraph (a) of this section or of its...

All projects related to | Page 198 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Topic: LATIN AMERICA, POLICY MAKING, AFRICA SOUTH OF SAHARA, SOCIAL INEQUALITY, ASIA, Poverty alleviation. Region: North and Central America, South America, Chile. Program: Agriculture and Food Security. Total Funding: CA$ 5,065,900.00. RIMISP: Core Support for Rural Development Research Phase 2.

Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

Energy Technology Data Exchange (ETDEWEB)

Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

2016-08-15

Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

International Nuclear Information System (INIS)

Meyer, G.J.; Roessler, K.; Stoecklin, G.

1979-01-01

Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

International Nuclear Information System (INIS)

Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

2015-01-01

Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

Science.gov (United States)

Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

2015-11-01

Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

10 CFR Appendix L to Part 110 - Illustrative List of Byproduct Materials Under NRC Export/Import Licensing Authority a

Science.gov (United States)

2010-01-01

... material produced, extracted, or converted for use for a commercial, medical, or research activity...) Gallium 72 (Ga 72) Germanium 68 (Ge 68) Germanium 71 (Ge 71) Gold 198 (Au 198) Gold 199 (Au 199) Hafnium...

Un cas d’infection à Dracunculoidea en Polynésie française

Czech Academy of Sciences Publication Activity Database

Bercion, R.; Heaulme, M.; Viant, E.; Moravec, František; Bain, O.

2010-01-01

Roč. 70, č. 2 (2010), s. 198-198 ISSN 0025-682X Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculoidea * acute arthritis * French Polynesia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

A Study on Liver Scan using 113mIn Colloid

International Nuclear Information System (INIS)

Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi

1969-01-01

There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.

Impact of galactic and intergalactic dust on the stellar EBL

Czech Academy of Sciences Publication Activity Database

Vavryčuk, Václav

2016-01-01

Roč. 361, č. 6 (2016), 198/1-198/8 ISSN 0004-640X Institutional support: RVO:67985530 Keywords : cosmic background radiation * interstellar dust * light extinction * universe opacity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.622, year: 2016

Browse Title Index

African Journals Online (AJOL)

Items 151 - 198 of 198 ... Issue, Title ... scheme for QoS and energy conservation in cloud computing, Abstract PDF ... Vol 9, No 1 (2013), Performance and Security Evaluation of ... Vol 18, No 1 (2017), Reducing capital flight through local cloud ...

Browse Title Index

African Journals Online (AJOL)

Items 151 - 198 of 198 ... Vol 5, No 1 (2007), Strategic violence-prevention partnerships in a peri-urban ... patriarchal and racist past in addressing post-apartheid sexual violence ... in the public space: reconstruction of a train fire in India, Abstract.

Browse Title Index

African Journals Online (AJOL)

Items 151 - 198 of 198 ... Vol 2, No 5 (2008), Simple heterochromia Iridis: a case report, Abstract. CO Omolase. Vol 5, No 6 (2010), Smoking Habit and Self Reported Periodontal ... The Clinical Pattern and Complications of Severe Malaria in Parts ...

Resonance – Journal of Science Education | News

Indian Academy of Sciences (India)

Science Academies' Refresher Course in Statistical Physics · More Details Fulltext PDF. pp 197-197 Information and Announcements. Science Academies' Refresher Course on Modern Biiotechnology: Concepts and Practice · More Details Fulltext PDF. pp 198-198 Information and Announcements. Forty Ninth Refresher ...

Is parental age related to the risk of Alzheimer's disease

NARCIS (Netherlands)

C.M. van Duijn (Cornelia); W. Schulte (Wim); T.A. Tanja (Teun); R. Haaxma (Rob); A.J. Lameris; R.J. Saan; A. Hofman (Albert)

1990-01-01

textabstractAdvanced maternal and paternal age were investigated as putative risk factors for AD in 198 clinically diagnosed Alzheimer patients and in 198 randomly selected healthy controls. No significant differences in average age of fathers and of mothers at birth of the subject were observed.

A critical analysis of the new equal pay provisions relating to atypical ...

African Journals Online (AJOL)

Keywords: Equal pay; Labour Relations Act; equal pay for atypical employees; atypical employment; sections 198A-198D of the Labour Relations Act; Agency Workers Regulations 2010; Fixed-term Employees (Prevention of Less Favourable Treatment) Regulations 2002; Part-time Workers (Prevention of Less Favourable ...

A single mutation in the envelope protein modulates flavivirus antigenicity, stability, and pathogenesis.

Directory of Open Access Journals (Sweden)

Leslie Goo

2017-02-01

Full Text Available The structural flexibility or 'breathing' of the envelope (E protein of flaviviruses allows virions to sample an ensemble of conformations at equilibrium. The molecular basis and functional consequences of virus conformational dynamics are poorly understood. Here, we identified a single mutation at residue 198 (T198F of the West Nile virus (WNV E protein domain I-II hinge that regulates virus breathing. The T198F mutation resulted in a ~70-fold increase in sensitivity to neutralization by a monoclonal antibody targeting a cryptic epitope in the fusion loop. Increased exposure of this otherwise poorly accessible fusion loop epitope was accompanied by reduced virus stability in solution at physiological temperatures. Introduction of a mutation at the analogous residue of dengue virus (DENV, but not Zika virus (ZIKV, E protein also increased accessibility of the cryptic fusion loop epitope and decreased virus stability in solution, suggesting that this residue modulates the structural ensembles sampled by distinct flaviviruses at equilibrium in a context dependent manner. Although the T198F mutation did not substantially impair WNV growth kinetics in vitro, studies in mice revealed attenuation of WNV T198F infection. Overall, our study provides insight into the molecular basis and the in vitro and in vivo consequences of flavivirus breathing.

76 FR 45879 - West, a Thomson Reuters Business, Thomson Reuters Legal, Including On-Site Leased Workers From...

Science.gov (United States)

2011-08-01

... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,198] West, a Thomson Reuters Business, Thomson Reuters Legal, Including On-Site Leased Workers From Adecco, Including a Teleworker...-W-73,198 is hereby issued as follows: All workers of West, A Thomson Reuters Business, Thomson...

211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

OpenAIRE

Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

2016-01-01

International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

International Nuclear Information System (INIS)

Wilbur, Daniel Scott

2016-01-01

This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

International Nuclear Information System (INIS)

Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

1997-01-01

Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

Southern Forests: a Journal of Forest Science - Vol 198 (2003)

African Journals Online (AJOL)

Reverting urban exotic pine forests to Macchia and indigenous forest vegetation, using cable-yarders on the slopes of Table Mountain, South Africa: management paper · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Pierre Ackerman, Bruce Talbot, 35-44 ...

People and things. CERN Courier, Nov 1979, v. 19(8)

International Nuclear Information System (INIS)

Anon.

1979-01-01

The article covers the celebration of the 'Journée du Personnel' (Staff Day), where over 3000 CERN staff turned up to enjoy various attractions like games, sports, sideshows, competitions, films, music and entertainment, and dancing that went on into the small hours. One highlight was the playing of 'Happy Birthday, CERN — From Fermi lab', recorded at Fermi lab. In other news, the article reports on various people, staff changes within the CERN organization and recent news updates

Scintigraphic aspect of liver in hepatitis. [/sup 198/Au-radiocolloid

Energy Technology Data Exchange (ETDEWEB)

Silva, W M; Medeiros, M [Hospital dos Servidores do Estado, Rio de Janeiro (Brazil). Servico de Medicina Nuclear

1976-01-01

A series of scintigraphs was made in a group of 15 patients with viral hepatitis, and compared with biochemical tests. Although in some patients the last biochemical tests were only slightly elevated, and in others entirely normal, they all continued to show abnormal scintigraphs with a mottled aspect and splenic uptake. It is supposed that some sequellae remain in the hepatic tissue even though the patient responds well in clinical and laboratory tests.

198 A Critical Analysis of Dramaturgy and Theatricality in Okwe ...

African Journals Online (AJOL)

RESOURCE CENTRE

having the stage and theatre audience in mind. Consequently .... observed that some scholars use formalism and new criticism ..... could be seen in the work under review, he or she can conclude that ... A character may be a person or an animal in a book, play, or film .... Literature, New York: Norton & Company. Dobie, A. B. ...

People and things. CERN Courier, Nov 1979, v. 19(8)

Energy Technology Data Exchange (ETDEWEB)

Anon.

1979-11-15

The article covers the celebration of the 'Journée du Personnel' (Staff Day), where over 3000 CERN staff turned up to enjoy various attractions like games, sports, sideshows, competitions, films, music and entertainment, and dancing that went on into the small hours. One highlight was the playing of 'Happy Birthday, CERN — From Fermi lab', recorded at Fermi lab. In other news, the article reports on various people, staff changes within the CERN organization and recent news updates.

Draft Genome Sequences of 64 Salmonella enterica subsp. enterica Enteritidis Isolates from Mice in US

Science.gov (United States)

A ciprofloxacin resistant (CipR) Salmonella enterica subsp. enterica serovar Kentucky ST198 has rapidly and extensively disseminated globally to become a major food-safety and public health concern. Here, we report a complete genome sequence of a CipR S. Kentucky ST198 strain PU131 isolated from a ...

211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability

International Nuclear Information System (INIS)

Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.

1993-01-01

Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)

Determinação da produção de metalo-b-lactamases em amostras de Pseudomonas aeruginosa isoladas em João Pessoa, Paraíba

Directory of Open Access Journals (Sweden)

Santos Filho Lauro

2002-01-01

Full Text Available Bactérias produtoras de metalo-beta-lactamases (MBLs são em grande parte resistentes aos betalactâmicos de largo espectro, incluindo oximino-aminotiazol cefalosporinas e também aos carbapenens. O objetivo deste trabalho foi detectar cepas de Pseudomonas aeruginosa resistentes ao imipenem e à ceftazidima, assim como identificar aquelas produtoras de MBLs. Foram estudadas 198 linhagens não-repetitivas isoladas de diversas amostras clínicas, hospitalares e comunitárias, identificadas bioquimicamente por técnicas de rotina. A triagem para a detecção de amostras produtoras de MBLs foi realizada pelo método de dupla difusão proposto por Arakawa et al. (2000 e modificado por Nakajima et al. (2001, utilizando discos contendo mercaptoacetato de sódio. Foi detectado um percentual de resistência de 19,7% (39/198 ao imipenem e de 15,2% (30/198 à ceftazidima, com 10,1% (20/198 de resistência cruzada aos dois antimicrobianos. Entre estas amostras, 2% (4/198 demonstraram produção de MBLs e padrão de multirresistência. A detecção destas amostras configura um problema emergente, com importantes implicações na terapêutica antimicrobiana, necessitando, portanto, de maior investigação através de metodologia molecular, para melhor caracterizar a extensão do problema.

Parafilimonas rhizosphaerae sp. nov., isolated from the rhizosphere of tomato plant (Solanum lycopersicum L.).

Science.gov (United States)

Cho, Hayoung; Ahn, Jae-Hyung; Weon, Hang-Yeon; Joa, Jae-Ho; Hong, Seung-Beom; Seok, Soon-Ja; Kim, Jeong-Seon; Kwon, Soon-Wo; Kim, Soo-Jin

2017-07-01

A bacterial strain, designated T16E-198T, was isolated from the rhizosphere of tomato plant collected from a farm on Buyeo-gun, Chungcheongnam-do, South Korea. The strain was aerobic, Gram-stain-negative, rod-shaped, non-flagellated and yellow-pigmented. Strain T16E-198T was mesophilic, catalase- and oxidase-positive and with flexirubin-type pigments. A phylogenetic tree based on 16S rRNA gene sequences showed that strain T16E-198T formed a lineage with Parafilimonas terrae 5GHs7-2T, sharing highest sequence similarity of 98.4 % with it and less than 93 % with all the other validly published species. The major fatty acids were iso-C15 : 0, iso-C17 : 0 3-OH and iso-C15 : 1 G. The predominant menaquinone was MK-7. The polar lipids were phosphatidylethanolamine, one unknown aminophospholipid, five unknown aminolipids and five unknown lipids. The DNA G+C content was 41.2 mol%. On the basis of the phenotypic, phylogenetic and chemotaxonomic data presented, strain T16E-198T is considered to represent a novel species of the genus Parafilimonas, for which the name Parafilimonas rhizosphaerae sp. nov. is proposed; the type strain is T16E-198T (=KACC 18786T=JCM 31601T).

Hg stable isotope analysis by the double-spike method.

Science.gov (United States)

Mead, Chris; Johnson, Thomas M

2010-06-01

Recent publications suggest great potential for analysis of Hg stable isotope abundances to elucidate sources and/or chemical processes that control the environmental impact of mercury. We have developed a new MC-ICP-MS method for analysis of mercury isotope ratios using the double-spike approach, in which a solution containing enriched (196)Hg and (204)Hg is mixed with samples and provides a means to correct for instrumental mass bias and most isotopic fractionation that may occur during sample preparation and introduction into the instrument. Large amounts of isotopic fractionation induced by sample preparation and introduction into the instrument (e.g., by batch reactors) are corrected for. This may greatly enhance various Hg pre-concentration methods by correcting for minor fractionation that may occur during preparation and removing the need to demonstrate 100% recovery. Current precision, when ratios are normalized to the daily average, is 0.06 per thousand, 0.06 per thousand, 0.05 per thousand, and 0.05 per thousand (2sigma) for (202)Hg/(198)Hg, (201)Hg/(198)Hg, (200)Hg/(198)Hg, and (199)Hg/(198)Hg, respectively. This is slightly better than previously published methods. Additionally, this precision was attained despite the presence of large amounts of other Hg isotopes (e.g., 5.0% atom percent (198)Hg) in the spike solution; substantially better precision could be achieved if purer (196)Hg were used.

Transgenní miniprasata pro Huntingtonovu nemoc

Czech Academy of Sciences Publication Activity Database

Hodanová, J.; Juhásová, Jana; Valeková, Ivona; Rausová, Petra; Jozefovičová, M.; Juhás, Štefan

2015-01-01

Roč. 198, č. 3 (2015), s. 198-205 ISSN 0506-8231 R&D Projects: GA MŠk ED2.1.00/03.0124; GA MŠk(CZ) 7F14308; GA TA ČR(CZ) TA01011466 Institutional support: RVO:67985904 Keywords : Huntington´s disease Subject RIV: EB - Genetic s ; Molecular Biology

Evaluation of the efficiency of nested q-PCR in the detection of Mycobacterium tuberculosis complex directly from tuberculosis-suspected lesions in post-mortem macroscopic inspections of bovine carcasses slaughtered in the state of Mato Grosso, Brazil.

Science.gov (United States)

Carvalho, Ricardo César Tavares; Furlanetto, Leone Vinícius; Maruyama, Fernanda Harumy; Araújo, Cristina Pires de; Barros, Sílvia Letícia Bomfim; Ramos, Carlos Alberto do Nascimento; Dutra, Valéria; Araújo, Flábio Ribeiro de; Paschoalin, Vânia Margaret Flosi; Nakazato, Luciano; Figueiredo, Eduardo Eustáquio de Souza

2015-08-01

Bovine tuberculosis (BTB) is a zoonotic disease caused by Mycobacterium bovis, a member of the Mycobacterium tuberculosis complex (MTC). The quick and specific detection of this species is of extreme importance, since BTB may cause economic impacts, in addition to presenting imminent risks to human health. In the present study a nested real-time PCR test (nested q-PCR) was used in post-mortem evaluations to assess cattle carcasses with BTB-suspected lesions. A total of 41,193 cattle slaughtered in slaughterhouses located in the state of Mato Grosso, were examined. Of the examined animals, 198 (0.48%) showed BTB-suspected lesions. M. bovis was isolated in 1.5% (3/198) of the samples. Multiplex-PCR detected MTC in 7% (14/198) of the samples. The nested q-PCR test detected MTC in 28% (56/198) of the BTB-suspected lesions, demonstrating higher efficiency when compared to the multiplex-PCR and conventional microbiology. Nested q-PCR can therefore be used as a complementary test in the national program for control and eradication of bovine tuberculosis. Copyright © 2015 Elsevier Ltd. All rights reserved.

Radioactive gold nanoparticles with beta energy and auger electron cascades in nanomedicine: green nanotechnology and radiochemical approaches

International Nuclear Information System (INIS)

Katti, Kattesh V.

2016-01-01

In our continued efforts to apply Green Nanotechnology for the development of therapeutic radioactive gold nanoparticles, we have developed a new generation of 198 Au theranostic probes. Laminin receptors are overexpressed in a large number of human tumors and the high in vivo affinity of EGCG toward Laminin receptors has allowed us to develop Laminin receptor specific radioactive gold nanoparticles to achieve tumor specificity. This lecture will provide: (a) Oncological aspects of Auger electrons through nanomedicine; (b) details on the intervention of nuclear activation analysis and various radioanalytical approaches for the production of tumor specific radioactive gold-198 nanoparticles; and (c) full in vivo investigations on therapeutic properties of EGCG-198-AuNP agent in treating prostate tumors

The Impact of Locus of Control on Language Achievement

Science.gov (United States)

Nodoushan, Mohammad Ali Salmani

2012-01-01

This study hypothesized that students' loci of control affected their language achievement. 198 (N = 198) EFL students took the Rotter's (1966) locus of control test and were classified as locus-internal (ni = 78), and locus-external (ne = 120). They then took their ordinary courses and at the end of the semester, they were given their exams.…

A journey through the stylistics of poetry

DEFF Research Database (Denmark)

Jensen, Kim Ebensgaard

2015-01-01

Review of Peter Verdonk, The Stylistics of Poetry: Context, Cognition, Discourse, History. (Series: Advances in Stylistics). London: Bloomsbury, 2013, xi + 198 pp., ISBN 978-1-4411-5878-9.......Review of Peter Verdonk, The Stylistics of Poetry: Context, Cognition, Discourse, History. (Series: Advances in Stylistics). London: Bloomsbury, 2013, xi + 198 pp., ISBN 978-1-4411-5878-9....

Low-dose-rate interstitial brachytherapy preserves good quality of life in buccal mucosa cancer patients

International Nuclear Information System (INIS)

Tayier, A.; Hayashi, Keiji; Yoshimura, Ryoichi

2011-01-01

The purpose of this study was to determine the results and long-term changes in radiation toxicity of stage I-II buccal mucosa cancer patients treated by low-dose-rate (LDR) brachytherapy with 198 Au grains. A total of 133 stage I-II buccal mucosa carcinomas patients received 198 Au grain implantation brachytherapy between January 1982 and July 2005: 75 of them were treated by 198 Au grain implantation alone and 58 were treated by 198 Au implantation in combination with external irradiation. The average 198 Au-grain dose was 70 Gy in 7 days. Gross tumor areas ranged from 2.4 cm 2 to 9 cm 2 , and the clinical target areas ranged from 6 cm 2 to 15 cm 2 . The follow-up periods ranged from 3 months to 20 years (mean: 5 years 11 months and median: 5 years 1 months). Failure at the site of the primary lesion occurred in 17 patients. Post-treatment mucosal ulceration developed in 15 patients, and all were cured within 25 months by conservative treatment. Osteoradionecrosis was diagnosed in 8 patients, but only one patient required surgical treatment. No severe complications or aggravation of complications developed more than 10 years after treatment. The results of low-dose-rate (LDR)-brachytherapy (BT) alone and LDR-BT in combination with external irradiation at a total dose of 25 Gy were acceptable from the standpoint of cure rate and quality of life (QOL). (author)

Role of apparent diffusion coefficients with diffusion-weighted magnetic resonance imaging in differentiating between benign and malignant bone tumors.

Science.gov (United States)

Wang, Tingting; Wu, Xiangru; Cui, Yanfen; Chu, Caiting; Ren, Gang; Li, Wenhua

2014-11-29

Benign and malignant bone tumors can present similar imaging features. This study aims to evaluate the significance of apparent diffusion coefficients (ADC) in differentiating between benign and malignant bone tumors. A total of 187 patients with 198 bone masses underwent diffusion-weighted (DW) magnetic resonance (MR) imaging. The ADC values in the solid components of the bone masses were assessed. Statistical differences between the mean ADC values in the different tumor types were determined by Student's t-test. Histological analysis showed that 84/198 (42.4%) of the bone masses were benign and 114/198 (57.6%) were malignant. There was a significant difference between the mean ADC values in the benign and malignant bone lesions (Pbenign and malignant bone tumors.

Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

Energy Technology Data Exchange (ETDEWEB)

Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

2016-07-19

This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate ²¹¹At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar ²¹¹At capture (>95%) from 8M HCl solutions and release with conc. NH₄OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of ²¹¹At when loading [²¹¹At]astatate appeared to be similar to that of [²¹¹At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of ²¹¹At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO₃, but higher capture rates (e.g. 99%) can be obtained when 10M HNO₃ is mixed with an equal quantity of 8M HCl; Addition of reductants to the ²¹¹At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated ²¹¹At isolation studies have been conducted with full-scale target dissolution and ²¹¹At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO₃ was used (rather than HCl) for loading the ²¹¹At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for ²¹¹At separation from bismuth, which allow use of HNO₃/HCl mixtures for loading and NaOH for eluting ²¹¹At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

Deciphering effects of functional groups and electron density on azo dyes degradation by graphene loaded TiO{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Zhang, Qian [College of Chemical Engineering, HuaQiao University, Xiamen 361021 (China); Liang, Xiao [School of Environment and Architecture, University of Shanghai for Science and Technology, Shanghai 200093 (China); Chen, Bor-Yann [Department of Chemical and Materials Engineering, National I-Lan University, 26047, Taiwan (China); Chang, Chang-Tang, E-mail: ctchang@niu.edu.tw [Department of Environmental Engineering, National I-Lan University, 26047, Taiwan (China)

2015-12-01

Highlights: • The degradation pathways of RB5, RB171 and RR198 have been identified. • The favorable bond to be broken under photo degradation was deciphered in this research. • The breakages of the bonds were due to the electron density changes around the bonds. • The hydroxyl radicals as the main oxidized species were confirmed by positive hole trapper and ESR. - Abstract: This study tended to decipher the mechanism of photo degradation of azo dyes, which bond was favorable to be broken for application of wastewater decolorization. That is, from chemical structure perspective, the critical substituents to affect electron donor/acceptor for dye degradation would be identified in this research. The model reactive blacks (RB5), reactive blue 171 (RB171) and reactive red 198 (RR198) were degraded by graphene loaded TiO{sub 2}, indicating how the electron withdrawing and releasing groups affect azo dye degradability. The byproducts and intermediate products were analyzed by ultraviolet–visible spectroscopy (UV–vis), gas chromatography–mass spectrometry (GC–MS) and ion chromatography (IC). Furthermore, the radicals involved in the reaction were found by electron paramagnetic resonance (ESR) to confirm the main oxidized species of hydroxyl radicals rather than the light generated positive holes. The finding revealed that the breakages of the bonds were due to the electron density changes around the bonds. This principle can be applicable not only for RB5 degradation, but also for reactive blue 171 (RB171), reactive red 198 (RR198) and some other textile dyes.

Removal of reactive dyes from aqueous solutions by a non-conventional and low cost agricultural waste: adsorption on ash of Aloe Vera plant

Directory of Open Access Journals (Sweden)

Mohammad Malakootian

2014-08-01

Full Text Available Dyes are an important class of pollutants and disposal of them in precious water resources must be avoided. Among various methods adsorption occupies a prominent place in dye removal. The aim of this study is to evaluate adsorption of dye Reactive Red 198 and Blue 19 (RR-198 & RB-19 (on to Aloe Vera plant ash from aqueous solutions. In this research Aloe Vera ash was prepared at laboratory conditions and then after shredding, screened by ASTM standard sieve with 60 -200 mesh sizes and the effects of pH (3-12, adsorbent dose (0.1-1 g/L, contact time (10-60 min, initial dye concentration (10-160 mg/L and temperature were investigated in the experiment. In different samples Dye concentration was measured by spectrophotometer at 592 nm and 520 nm wavelength for RR198 and RB19 respectively. Also the Langmuir and Freundlich adsorption isotherms were determined in order to describe the relations between the colored solutions and the adsorbent. The results of this study showed that acidic conditions were more conducive to enhance the hydrolysis rate than basic ones as the decomposition was optimum at pH 3. The adsorption rate of RR-198 and RB-19 dyes was increased by increasing of initial dye concentration, increasing of adsorbent dose in 0.1 to 0.4 mg/L. Dye solution was decolorized in a relatively short time (20 min. The efficiencies for RR-198 and RB- 19 reactive dyes were 82.68% and 90.42% respectively. The maximum adsorption capacity (qmax has been found to be 80.152 mg/g for RR-198 reactive dye and 88.452 mg/g for Blue 19 reactive dye. Adsorption isotherms were examined by Freundlich and Langmuir isotherm that finally showed the Freundlich multilayer isotherm has better accordance with dates. The results indicate that Aloe Vera ash plant as a natural and inexpensive adsorbent is a suitable adsorbent for the adsorption of textile dyes.

All Equal: Article 198 of the Objective of Civil Procedure Code

Directory of Open Access Journals (Sweden)

Luciane Mara Correa Gomes

2016-10-01

Full Text Available The implementation of the electronic process in Brazil was made to be a way to minimize the slowness in dealing with cases. Created the first barrier of inequality, because there was not the adequacy of the system to people with special needs. The Civil Procedure Code calls for equal treatment by imposing the Judiciary duty purpose of access, spreading the installation charge of treatment rooms with technical support and personnel to jurisdictional, disabled and elderly. In the absence of physical space, allows the law to practice through physical, creating imbalance in parity procedural weapons.

Treatment of Synthetic Wastewater Containing Reactive Red 198 by Electrocoagulation Process

OpenAIRE

N.M Mahmoodi; A Ameri; M Gholami; A Jonidi jafari; A Dalvand

2011-01-01

"nBackground and Objectives: Discharge of textile colored wastewater industries without providing enough treatment in water bodies, is harmful for human and aquatic organisms and poses serious damages to the environment. Most of conventional wastewater treatment methods don't have enough efficiency to remove textile dyes from colored wastewater; thus in this research the efficiency of electrocoagulation treatment process with aluminum electrodes for treatment of a synthetic wastewater co...

: tous les projets | Page 198 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

End Date: 19 mars 2015. Sujet: NUTRITION, Disease control, RESEARCH, CHILDREN, TELEVISION, FOOD CONSUMPTION, PERU. Région: Peru, South America, North and Central America. Programme: Alimentation, environnement et santé. Financement total : CA$ 215,000.00. Examen des liens entre la télévision et les ...

Leonurine (SCM-198) improves cardiac recovery in rat during chronic infarction.

Science.gov (United States)

Liu, XinHua; Pan, LiLong; Gong, QiHai; Zhu, YiZhun

2010-12-15

Leonurine, an alkaloid typically found in Herba leonuri, is known to have both antioxidant and cardioprotective properties. In the present study, we investigated the cardioprotective mechanism of leonurine the in vivo rat model of chronic myocardial ischemia and in vitro H9c2 cardiac myocyte model of oxidative stress. Myocardial ischemia was induced by ligating the left anterior descending coronary artery. Rats were divided into sham, myocardial ischemia+saline, and myocardial ischemia+leonurine (15 mg/kg/day). Cardiac function was recorded by catheterization. Apoptosis-related factor vascular endothelial growth factor (VEGF), survivin, Bcl-2 and Bax and pro-survival signaling pathways Akt, hypoxia inducible factor (HIF)-1α were measured by Western blotting or RT-PCR. Our results showed leonurine significantly improved myocardial function as evidenced by the decreased left ventricle end-diastolic pressure and the increased +dP/dt. Interestingly, leonurine increased the phosphorylation of Akt, the protein and gene expression of Bcl-2, but it reduced the protein and gene expression of Bax in vivo. Meanwhile leonurine significantly increased Akt phosphorylation in a concentration-dependent manner in H9c2 cardiac myocyte induced by oxidative stress in vitro, which was abolished by a phosphoinositide 3-kinase (PI3K) inhibitor, LY294002. Furthermore, leonurine not only increased the expression of HIF-1α but also the expression of survivin and VEGF. The results of present study demonstrated, for the first time that leonurine has potent anti-apoptotic effects after chronic myocardial ischemia mediated by activating the PI3K/Akt signaling pathway. Angiogenic mechanisms may be partially responsible for such an effect, which needs to be studied further. Copyright © 2010 Elsevier B.V. All rights reserved.

Asie du sud | Page 198 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

The stories presented in Success Stories in Asian Aquaculture reflect the unique nature of Asian aquaculture, providing first-time insight into how and why it has become so successful. Overall, the book demonstrates how the resiliency, adaptability, and innovation of small-scale aquaculture farmers have been crucial to this ...

Alpha particle emitters in medicine

International Nuclear Information System (INIS)

Fisher, D.R.

1989-09-01

Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system

International Nuclear Information System (INIS)

Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.

1982-01-01

A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies

Decolorization of different textile dyes by Penicillium simplicissimum and toxicity evaluation after fungal treatment

Directory of Open Access Journals (Sweden)

L.R. Bergsten-Torralba

2009-12-01

Full Text Available The objective of this study was to investigate the capacity of decolorization and detoxification of the textile dyes Reactive Red 198 (RR198, Reactive Blue 214 (RB214, Reactive Blue 21 (RB21 and the mixture of the three dyes (MXD by Penicillium simplicissimum INCQS 40211. The dye RB21, a phthalocyanine, was totally decolorized in 2 days, and the others, the monoazo RR198, the diazo RB214 and MXD were decolorized after 7 days by P. simplicissimum. Initially the dye decolorization involved dye adsorption by the biomass followed by degradation. The acute toxicity after fungal treatment was monitored with the microcrustacean Daphnia pulex and measured through Effective Concentration 50% (EC50. P. simplicissimum reduced efficiently the toxicity of RB21 from moderately acutely toxic to minor acutely toxic and it also reduced the toxicity of RB214 and MXD, which remained minor acutely toxic. Nevertheless, the fungus increased the toxicity of RR198 despite of the reduction of MXD toxicity, which included this dye. Thus, P. simplicissimum INCQS 40211 was efficient to decolorize different textile dyes and the mixture of them with a significant reduction of their toxicity. In addition this investigation also demonstrated the need of toxicological assays associated to decolorization experiments.

Liver scanning with sup(99m)Tc-phytate

Energy Technology Data Exchange (ETDEWEB)

Kubo, A; Isobe, Y; Kobayashi, T; (Keio Univ., Tokyo (Japan). School of Medicine); Kinoshita, Fumio; Shibata, Masayoshi

1975-03-01

/sup 198/Au-colloid has been widely used for liver scanning in Japan but it is not the best scanning agent because of the large exposure dose to the patient. The authors performed a few basic experiments with sup(99m)Tc-phytate, the preparation of which is very easy. The labeling efficiency was found to be 97.5% immediately after preparation and it remained fairly stable for a period of time. As a result, the compound can be used up to 6 hours after preparation without fear of chemical instability. Liver scanning with sup(99m)Tc-phytate was done on 116 patients and was compared with /sup 198/Au-colloid liver-scanning. Scans made with sup(99m)Tc were found to be superior to those made with /sup 198/Au in the resolution of surface defects in the liver, while at increasing depths the resolution with sup(99m)Tc dropped rapidly, apparently due to absorption of its relatively low energy photon. This indicates the importance of taking multidirectional views. The degrees of splenic concentration of sup(99m)Tc-phytate were fairly close to those of /sup 198/Au-colloid. Therefore, liver scanning with sup(99m)Tc-phytate is useful in the diagnostic evaluation of diffuse parenchymal liver disease.

Liver scanning with sup(99m)Tc-phytate

International Nuclear Information System (INIS)

Kubo, Atsushi; Isobe, Yoshinori; Kobayashi, Takeshi; Kinoshita, Fumio; Shibata, Masayoshi.

1975-01-01

198 Au-colloid has been widely used for liver scanning in Japan but it is not the best scanning agent because of the large exposure dose to the patient. The authors performed a few basic experiments with sup(99m)Tc-phytate, the preparation of which is very easy. The labeling efficiency was found to be 97.5% immediately after preparation and it remained fairly stable for a period of time. As a result, the compound can be used up to 6 hours after preparation without fear of chemical instability. Liver scanning with sup(99m)Tc-phytate was done on 116 patients and was compared with 198 Au-colloid liver-scanning. Scans made with sup(99m)Tc were found to be superior to those made with 198 Au in the resolution of surface defects in the liver, while at increasing depths the resolution with sup(99m)Tc dropped rapidly, apparently due to absorption of its relatively low energy photon. This indicates the importance of taking multidirectional views. The degrees of splenic concentration of sup(99m)Tc-phytate were fairly close to those of 198 Au-colloid. Therefore, liver scanning with sup(99m)Tc-phytate is useful in the diagnostic evaluation of diffuse parenchymal liver disease. (auth.)

Understanding effects of chemical structure on azo dye decolorization characteristics by Aeromonas hydrophila

Energy Technology Data Exchange (ETDEWEB)

Hsueh, Chung-Chuan [Department of Chemical and Materials Engineering, National I-Lan University, I-Lan 260, Taiwan (China); Chen, Bor-Yann, E-mail: bychen@niu.edu.tw [Department of Chemical and Materials Engineering, National I-Lan University, I-Lan 260, Taiwan (China); Yen, Chia-Yi [Department of Chemical and Materials Engineering, National I-Lan University, I-Lan 260, Taiwan (China)

2009-08-15

This novel comparative study tended to disclose how the molecular structures present in seven azo dyes including two types of azo dyes (i.e., naphthol type azo dyes - Reactive Black 5 (RB 5), Reactive Blue 171 (RB 171), Reactive Green 19 (RG19), Reactive Red 198 (RR198), Reactive Red 141 (RR141) and non-naphthol type azo dyes - Direct Yellow 86 (DY86), Reactive Yellow 84 (RY84)) affected color removal capability of Aeromonas hydrophila. Generally speaking, the decolorization rate of naphthol type azo dye with hydroxyl group at ortho to azo bond was faster than that of non-naphthol type azo dye without hydroxyl group, except of RG19. The azo dyes with electron-withdrawing groups (e.g., sulfo group in RR198, RB5 and RR141) would be easier to be decolorized than the azo dyes with the electron-releasing groups (e.g., -NH-triazine in RB171 and RG19). In addition, the azo dyes containing more electron-withdrawing groups (e.g., RR198, RB5 and RR141) showed significantly faster rate of decolorization. The azo dyes with electron-withdrawing groups (e.g., sulfo group) at para and ortho to azo bond (e.g., RR198, RB5 and RR141) could be more preferred for color removal than those at meta (e.g., DY86 and RY84). The former azo dyes with para and ortho sulfo group provided more effective resonance effects to withdraw electrons from azo bond, causing azo dyes to be highly electrophilic for faster rates of reductive biodecolorization. However, since the ortho substituent caused steric hindrance near azo linkage(s), azo dyes with para substituent could be more favorable (e.g., SO{sub 2}(CH{sub 2}){sub 2}SO{sub 4}{sup -} in RR198 and RB5) than those with ortho substituent (e.g., sulfo group at RR141) for decolorization. Thus, the ranking of the position for the electron-withdrawing substituent in azo dyes to escalate decolorization was para > ortho > meta. This study suggested that both the positions of substituents on the aromatic ring and the electronic characteristics of

Aphid parasitoid (Hymenoptera:Braconidae: Aphidiinae) in wetland habitats in western Palearctic: key and associated aphid parasitoid guilds

Czech Academy of Sciences Publication Activity Database

Tomanović, Ž.; Starý, Petr; Kavallieratos, N. G.; Gagić, V.; Plećaš, M.; Janković, M.; Rakhshani, E.; Ćetković, A.; Petrović, A.

2012-01-01

Roč. 48, 1-2 (2012), s. 189-198 ISSN 0037-9271 Grant - others:The Ministry of Science and Technological Development of the Republic of Serbia(RS) 043001 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphid parasitoids * tritrophic interactions * wetlands Subject RIV: EH - Ecology, Behaviour Impact factor: 0.529, year: 2012 http://zoologie.umh.ac.be/asef/pdf/2012_48_01_02/full/Tomanovic_et_al_2012_ASEF_48_1_2_189_198_full.pdf

Encyclopedia of Explosives and Related Items. Volume 10

Science.gov (United States)

1983-01-01

SBR 75 Nylon 130 Polyvinyl Chloride 85 Polyethylene 80 160 Polyvinyl Acetate 75 Teflon FEP, TFE 160 160 Furan Resin 75 Phenolic Resin ___75. Kel-F 300...0 6706>Zo> 1372 pp ’np/W1/3 (s/kg1/3 ) 1.499 -5/6 0 4267>Z 0 >198 Tbpp/Wi/(s/kg1/ 3 ) 0.532 -5/6 0 1372>Z 0>198 bpp /W"/(s/kg/ 3) 0.099 -3/5 0 6706>Z0

Dosimetry in intrathecal radiogold therapy. 4

International Nuclear Information System (INIS)

Doege, H.; Hliscs, R.; Hennig, K.

1979-01-01

The radiation dose absorbed depends on the distribution of the 198 Au colloid, its physical properties and the applied activity as well as on the anatomy of the source and the target. These methodic fundamentals were studied. Assuming a homogeneous distribution on the surface of the source organ the radiopharmaceutical in 24 children suffering from acute leukemia the effective dose was calculated to be (296 +- 137 rads) for the intracranial subarachnoid space, (1648 +- 823 rads) for the spinal cord and (35 +- 26 rads) for the liver following administration of 1.5 - 3 mCi 198 Au colloid. The sources of error caused by the complicated anatomy of the CSF space and by differences in the detailed distribution of the 198 Au colloid are discussed. The advantages of this method - good compatibility and intactness of the nervous tissues - can be explained by the sharp decrease of the dose absorbed. (author)

Lifetimes of excited states in 196198Pt; application of interacting bason approximation model to even Pt isotopes systematics

International Nuclear Information System (INIS)

Bolotin, H.H.; Stuchbery, A.E.; Morrison, I.; Kennedy, D.L.; Ryan, C.G.; Sie, S.H.

1981-01-01

The lifetimes and lifetime limits of the low-lying excited states up to and including the 6 1 + levels in 196 198 Pt were determined by the rcoil-distance method (RDM). Gamma-ray angular distributions in 198 Pt were also measured. These states were populated by multiple Coulomb excitation using 220-MeV 58 Ni ion beams and the measurements carried out in coincidence with backscattered projectiles. The measured mean lives of the states and B(E2) values inferred for the transitions between levels are presented. These specific findings, and the observed structure systematics obtained from the combination of the present results and those of prior workers for the even 194 - 198 Pt isotopes, are critically compared with our structure calculations employing the Interacting Boson Approximation (IBA) model incorporating a symmetry-breaking quadrupole force. Evaluative comparisons are also made with Boson Expansion Theory (BET) calculations

Suspension Array for Multiplex Detection of Eight Fungicide-Resistance Related Alleles in Botrytis cinerea

Directory of Open Access Journals (Sweden)

Xin Zhang

2016-09-01

Full Text Available A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA, H272 and 272Y of the Succinate dehydrogenase iron–sulfur subunit gene (SdhB, I365 and 365S of the putative osmosensor histidine kinase gene (BcOS1, and F412 and 412S of the 3-ketoreductase gene (erg27. This assay was first established and optimized with eight plasmid templates containing the DNA sequence variants BenA-E198, BenA-198A, SdhB-H272, SdhB-272Y, BcOS1-I365, BcOS1-365S, erg27-F412, and erg27-412S. Results indicated that none of the probes showed cross-reactivity with one another. The minimum limit of detection for these genotypes was one copy per test. Four mutant plasmids were mixed with 10 ng/μL wild-type genomic DNA in different ratios. Detection sensitivity of mutant loci was 0.45% for BenA-E198A, BcOS1-I365S, and erg27-F412S, and was 4.5% for SdhB-H272Y. A minimum quantity of 0.1 ng of genomic DNA was necessary to obtain reliable results. This is the first reported assay that can simultaneously detect mutations in BenA, SdhB, BcOS1, and erg27.

Suspension Array for Multiplex Detection of Eight Fungicide-Resistance Related Alleles in Botrytis cinerea.

Science.gov (United States)

Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei

2016-01-01

A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea . Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene ( BenA ), H272 and 272Y of the Succinate dehydrogenase iron-sulfur subunit gene ( SdhB) , I365 and 365S of the putative osmosensor histidine kinase gene ( BcOS1 ), and F412 and 412S of the 3-ketoreductase gene ( erg27 ). This assay was first established and optimized with eight plasmid templates containing the DNA sequence variants BenA- E198, BenA- 198A, SdhB- H272, SdhB- 272Y, BcOS1- I365, BcOS1- 365S, erg27 -F412, and erg27 -412S. Results indicated that none of the probes showed cross-reactivity with one another. The minimum limit of detection for these genotypes was one copy per test. Four mutant plasmids were mixed with 10 ng/μL wild-type genomic DNA in different ratios. Detection sensitivity of mutant loci was 0.45% for BenA- E198A, BcOS1- I365S, and erg27 -F412S, and was 4.5% for SdhB- H272Y. A minimum quantity of 0.1 ng of genomic DNA was necessary to obtain reliable results. This is the first reported assay that can simultaneously detect mutations in BenA , SdhB , BcOS1 , and erg27 .

Long-term results of radiotherapy for subfoveal choroidal neovascularization (CNV) in age-related macular degeneration (ARMD)

Energy Technology Data Exchange (ETDEWEB)

Kim, Bo Kyong; Kim, Il Han [Seoul National University College of Medicine, Seoul (Korea, Republic of)

2007-06-15

We performed this prospective randomized study to evaluate the efficacy and the complications of radiotherapy for Subfoveal CNV in ARMD and to compare the treatment results at two dosages (14.4 Gy and 19.8 Gy). 60 eyes of 55 patients were enrolled, and randomized into 14.4 Gy (31 eyes) or 19.8 Gy (29 eyes) groups. CT was used to plan the radiotherapy. All patients received radiotherapy with a 1.8 Gy daily dose using 4 MV photon. We categorized treatment results as improved, stable, or deteriorated based on visual acuity changes of more than 2 lines on the ETDRS chart. Median follow-up period was 33.5 months. At 12 months, visual acuity improved in 9 (16.7%), stable in 41 (75.9%), and aggravated in 4 (7.4%) of 54 evaluated eyes. At 24 months, 49 eyes (81.7%) were evaluated. Visual acuity improved in 6 (12.2%), was stable in 33 (67.4%), and deteriorated in 10 (20.4%). At 36 months, 37 eyes were evaluated. Six (16.2%) eyes were improved, 21 (56.8%) stable, and 10 (27.0%) deteriorated. No significant difference in response was observed between the 14.4 Gy and 19.8 Gy groups (Mantel-Haenszel {chi} {sup 2} = 0.4756). The proportion of eyes with a vision of 20/100 {<=} increased from 28.3% initially to 32.7% after 24 months of radiotherapy. There were no severe acute or chronic complications. External beam radiotherapy with doses of 14.4 or 19.8 Gy may be an effective treatment for subfoveal CNV in ARMD. No dose-response relationships with respect to treatment response or toxicity were observed between the 14.4 Gy and 19.8 Gy groups.

Formulation, Development, and In Vitro Evaluation of a CD22 Targeted Liposomal System Containing a Non-Cardiotoxic Anthracycline for B Cell Malignancies

Directory of Open Access Journals (Sweden)

Nivesh K. Mittal

2018-04-01

Full Text Available Doxorubicin cardiotoxicity has led to the development of superior chemotherapeutic agents such as AD 198. However, depletion of healthy neutrophils and thrombocytes from AD 198 therapy must be limited. This can be done by the development of a targeted drug delivery system that delivers AD 198 to the malignant cells. The current research highlights the development and in vitro analysis of targeted liposomes containing AD 198. The best lipids were identified and optimized for physicochemical effects on the liposomal system. Physiochemical characteristics such as size, ζ-potential, and dissolution were also studied. Active targeting to CD22 positive cells was achieved by conjugating anti-CD22 Fab’ to the liposomal surface. Size and ζ-potential of the liposomes was between 115 and 145 nm, and −8 to−15 mV. 30% drug was released over 72 h. Higher cytotoxicity was observed in CD22+ve Daudi cells compared to CD22−ve Jurkat cells. The route of uptake was a clathrin- and caveolin-independent pathway. Intracellular localization of the liposomes was in the endolysosomes. Upon drug release, apoptotic pathways were activated partly by the regulation of apoptotic and oncoproteins such as caspase-3 and c-myc. It was observed that the CD22 targeted drug delivery system was more potent and specific compared to other untargeted formulations.

X-ray diffraction study of the fine structure of twaron fibres in the temperature range 750 kelvin - 9500 kelvin

International Nuclear Information System (INIS)

Abu Obaid, A. A.

1991-01-01

The thesis dealt with the fine structural behaviour of twaron fibres, spun from the polymer poly (p-phenylene terephthalamide), due to physical treatments in the temperature range 75 to 984 kelvin (-198 to 675 degrees celsius). The treatments were annealing, cooling, cold ageing and vibratory milling. The structure was characterized by wide-angle x-ray diffraction (WAXS) and thermogravimetric analysis (TGA). The structural parameters included crystallinity, microparacrystal (mPc) sizes, net plane spacings, unit cell dimensions and mass stability. The TGA results indicated good mass stability up to 500 degrees celsius. The crystallinity and mPc sizes reached their maximum values after annealing the fibres at 425 degrees celsius (crystallinity increased by 5% and mPC sizes increased by approximately 40 to 50 %). After 500 degrees celsius, the crystallinity and mPC sizes dropped remarkably. Cooling the twaron fibres down to -198 degrees celsius did not affect the structure. Cold ageing of the fibres at -15 degrees celsius for periods up to 100 days, and cold ageing at -198 degrees celsius up to 48 hours did not affect the structure as well; however cold ageing at -198 degrees celsius for 120 hours caused a drop of 5% in the crystallinity and 10% in the mPc sizes. 35 refs., 28 figs., 9 tabs. (A.M.H.)

Analysis of Manganese Superoxide Dismutase and Glutathione Peroxidase 1 Gene Polymorphisms in Vitiligo.

Science.gov (United States)

Seçkin, Havva Yıldız; Kalkan, Göknur; Bütün, İlknur; Akbaş, Ali; Baş, Yalçın; Karakuş, Nevin; Benli, İsmail

2016-08-01

Vitiligo is a hereditary/acquired progressive pigmentation disorder characterized by discoloration of skin as a result of melanocyte dysfunction. Recent studies have proposed that oxidant/antioxidant status plays an important role in vitiligo pathogenesis because of the toxic effects on melanocytes. In this study, we aimed to investigate possible associations of MnSOD Ala-9Val and GPx1 Pro198Leu polymorphisms with vitiligo with in Turkish population. The study group consists of 57 patients with vitiligo and 69 healthy controls. Genotyping is performed to identify MnSOD Ala-9Val and GPx1 Pro198Leu polymorphisms. The method used for genotyping was based on the PCR amplification and detection of polymorphisms by hybridization probes labeled with fluorescent dyes. Both the genotype and allele frequencies of MnSOD Ala-9Val (p = 0.817 and p = 0.553, respectively) and GPx1 Pro198Leu polymorphisms (p = 0.422 and p = 0.673, respectively) were not significantly different between vitiligo patients and the control group. Although no significant difference was found, this is the first report investigating the possible associations between the MnSOD Ala-9Val and GPx1 Pro198Leu polymorphisms in Turkish population. Further studies with large populations will be able to clarify the association better.

Suspension Array for Multiplex Detection of Eight Fungicide-Resistance Related Alleles in Botrytis cinerea

OpenAIRE

Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei

2016-01-01

A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE) assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA), H272 and 272Y of the Succinate dehydrogenase iron–sulfur...

The M198 Howitzer as a Direct Support Weapon during Amphibious Operations.

Science.gov (United States)

1980-06-06

critical to the success of f:;ture amphibio ..s ot.er-.tions. Purpose of the Study, The purpose of this study is to determine the imrpact of the ,19 ’s...principle amphibio ;- shies lift capatilities and physical characte-istics indic -tcs thir flexibility a ,d speed, or lack tnhreof, in d::>.rking large

Sex Education and Sex Stereotypes: Theory and Practice. Working Paper No. 198.

Science.gov (United States)

Stubbs, Margaret L.

This paper presents an explanation of practitioners' reactions to sex equitable sex education. Several constraints can prohibit practitioners from engaging in sex equitable sex education: (1) lack of community support; (2) lack of expertise in human sexuality education; (3) vagueness of school committee views; and (4) lack of answers to logistical…

Stemcell Information: SKIP000844 [SKIP Stemcell Database[Archive

Lifescience Database Archive (English)

Full Text Available 370S 10001.198.01 10001.198.01 パーキンソン病 G20 Parkinson Disease 168600 ... 68 60-69 Male Ashkenazi Jewish ... ...Ashkenazi Jewish ... Yes No Transgene-free iPS cells from Parkinson Disease patient who has Monozygotic twin br....023 iPSC-derived dopamine neurons reveal differences between monozygotic twins discordant for Parkinson...other.Using CytoTune iPS Sendai reprogramming protocol (Life Technologies). 一卵性双生児のパーキンソン

Phosphorylation and subcellular localization of p27Kip1 regulated by hydrogen peroxide modulation in cancer cells.

Directory of Open Access Journals (Sweden)

Irene L Ibañez

Full Text Available The Cyclin-dependent kinase inhibitor 1B (p27Kip1 is a key protein in the decision between proliferation and cell cycle exit. Quiescent cells show nuclear p27Kip1, but this protein is exported to the cytoplasm in response to proliferating signals. We recently reported that catalase treatment increases the levels of p27Kip1 in vitro and in vivo in a murine model. In order to characterize and broaden these findings, we evaluated the regulation of p27Kip1 by hydrogen peroxide (H(2O(2 in human melanoma cells and melanocytes. We observed a high percentage of p27Kip1 positive nuclei in melanoma cells overexpressing or treated with exogenous catalase, while non-treated controls showed a cytoplasmic localization of p27Kip1. Then we studied the levels of p27Kip1 phosphorylated (p27p at serine 10 (S10 and at threonine 198 (T198 because phosphorylation at these sites enables nuclear exportation of this protein, leading to accumulation and stabilization of p27pT198 in the cytoplasm. We demonstrated by western blot a decrease in p27pS10 and p27pT198 levels in response to H(2O(2 removal in melanoma cells, associated with nuclear p27Kip1. Melanocytes also exhibited nuclear p27Kip1 and lower levels of p27pS10 and p27pT198 than melanoma cells, which showed cytoplasmic p27Kip1. We also showed that the addition of H(2O(2 (0.1 µM to melanoma cells arrested in G1 by serum starvation induces proliferation and increases the levels of p27pS10 and p27pT198 leading to cytoplasmic localization of p27Kip1. Nuclear localization and post-translational modifications of p27Kip1 were also demonstrated by catalase treatment of colorectal carcinoma and neuroblastoma cells, extending our findings to these other human cancer types. In conclusion, we showed in the present work that H(2O(2 scavenging prevents nuclear exportation of p27Kip1, allowing cell cycle arrest, suggesting that cancer cells take advantage of their intrinsic pro-oxidant state to favor cytoplasmic localization

Design of a Chemical Processing Apparatus for Radioisotopes of Short Half-Life; Projet d'une Installation de Traitement Chimique de Radioelements a Courtes Periodes; ПРОЕКТ УСТАНОВКИ ДЛЯ ХИМИЧЕСКОЙ ОБРАБОТКИ КОРОТКОЖИВУЩИХ РАДИОЭЛЕМЕНТОВ; Proyecto para una Instalacion de Tratamiento Quimico de Radioelementos de Periodo Corto

Energy Technology Data Exchange (ETDEWEB)

Douis, M.; Valade, J. [Centre d' Etudes Nucleaires, Saclay (France)

1963-03-15

It has appeared to us useful to make suggestions to radiochemists having at their disposal a small reactor (e. g., 10{sup 12} n/cm{sup 2}s flux) regarding which radioisotopes they can prepare and the minimum equipment required. The paper comprises three main parts: 1. Possible radioisotopes, which may be divided into two categories: (a) radioisotopes for medical uses, including: Na{sup 24}, K{sup 42}, Br{sup 82}, Cu{sup 64}, As{sup 76}, Hg{sup 197} and colloidal Au{sup 198}; and (b) radioisotopes for scientific or industrial uses, including in addition to the above-named: Sb{sup 122}, As{sup 77}, Mn{sup 56} and Au{sup 198} (chloride). 2. Chemical processing, in which two categories of radioisotopes emerge: (a) the category involving simple solution, normally requiring either cold dissolution in water or dilute acid or hot dissolution in concentrated acids. This category includes: Na{sup 24}, K{sup 42}, Br{sup 12}, Hg{sup 197}, Sb{sup 122}, Mn{sup 56} and Au{sup 198} (chloride). (b) The category involving complex separations or transformations, in which fall preparations by Szilard-Chalmers effect, reactions (n, p), (n, {gamma}), followed by {beta}-decay or formation of colloids. The following maybe mentioned: Cu{sup 54}, As{sup 76}, As{sup 77} and colloidal Au{sup 198} and 3. Preparation areas. It is essential that these radioisotopes be prepared in leak-tight and shielded areas and be grouped according to their affinities. We accordingly suggest an apparatus consisting of 3 cells 2 m in length by 1 m in depth, linked together by a conveyor and used, e.g., for the following processes: 1st cell: Introduction of containers, opening and preparation of Na{sup 24}, K{sup 42}, and Br{sup 82}; 2nd cell: Preparation of two out of the following three radioisotopes : Cu{sup 64}, As{sup 76} and colloidal Au{sup 198}; and 3rd cell: Bringing into solution of radioisotopes for various uses and preparation of Hg{sup 197}. (author) [French] Il a paru interessant de proposer IL des

Sexuelle Belästigung aus strafrechtlicher Sicht Sexual Harassment from the Perspective of Criminal Law

Directory of Open Access Journals (Sweden)

Maria Eder-Rieder

2004-07-01

Full Text Available Der Kern der Arbeit ist die juristische Aufarbeitung der Grenzen und Reichweite der in der Schweiz seit 1. Oktober 1992 in Kraft befindlichen Regelungen zur sexuellen Belästigung durch Vornahme einer sexuellen Handlung vor jemanden (Art. 198 Abs. 1 StGB, der tätlichen sexuellen Belästigung und der verbalen Belästigung (Art. 198 Abs. 2 StGB. Diese Tatbestände werden anhand von Beispielen erläutert, mit weiteren Varianten der sexuellen Belästigung verglichen und zu anderen Tatbeständen abgegrenzt. Ebenso wird auf das Verhältnis zum Zivilrecht und die Problematik des Strafprozesses eingegangen. Abschließend wird der kriminalpolitischen Frage über den Sinn der strafrechtlichen Sanktionierung nachgegangen.The core of this work is the judicial reappraisal of the boundaries and range of Swiss regulations—effective since October 1, 1992—on sexual harassment through carrying out a sexual action in the presence of someone (Art. 198 Paragraph 1 of the penal code or violent sexual harassment and verbal harassment (Art. 198 Paragraph 2 of the penal code. These elements of offences are illustrated on the basis of examples, are compared to further variations of sexual harassment and are distinguished from other offences. The relationship between civil law and the difficulties of criminal procedures are also dealt with. At the end of the book, the criminal-political question of the meaning of penal sanctions is examined.

Investigation of mercury-containing proteins by enriched stable isotopic tracer and size-exclusion chromatography hyphenated to inductively coupled plasma-isotope dilution mass spectrometry

Energy Technology Data Exchange (ETDEWEB)

Shi Junwen [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Feng Weiyue [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]. E-mail: fengwy@mail.ihep.ac.cn; Wang Meng [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Zhang Fang [Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Li Bai [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Wang Bing; Zhu Motao [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Chai Zhifang [Laboratory for Bio-Environmental Health Sciences of Nanoscale Materials and Key Laboratory of Nuclear Analytical Techniques, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)]|[Institute of Nuclear Technology, Shenzhen University, Shenzhen 518060 (China)]|[Institute of Nanochemistry and Nanosafety, Shanghai University, Shanghai (China)

2007-01-30

In order to investigate trace mercury-containing proteins in maternal rat and their offspring, a method of enriched stable isotopic tracer ({sup 196}Hg and {sup 198}Hg) combined with size-exclusion chromatography (SEC) coupled to inductively coupled plasma-isotope dilution mass spectrometry (ICP-IDMS) was developed. Prior to the analysis, {sup 196}Hg- and {sup 198}Hg-enriched methylmercury was administrated to the pregnant rats. Then the mercury-containing proteins in serum and brain cytosol of the dam and pup rats were separated by size-exclusion columns and the mercury was detected by ICP-MS. The ICP-MS spectrogram of the tracing samples showed significantly elevated {sup 196}Hg and {sup 198}Hg isotopic signals compared with the natural ones, indicating that the detection sensitivity could be increased by the tracer method. The contents of mercury in chromatographic fractions of the dam and pup rat brain cytosol were quantitatively estimated by post-column reverse ID-ICP-MS. The quantitative speciation differences of mercury in brain cytosol between the dam and pup rats were observed, indicating that such studies could be useful for toxicological estimation. Additionally, the isotopic ratio measurement of {sup 198}Hg/{sup 202}Hg in the tracing samples could be used to identify the artifact mercury species caused in the analytical procedure. The study demonstrates that the tracer method combined with high-performance liquid chromatography (HPLC)-ICP-IDMS could provide reliably qualitative and quantitative information on mercury-containing proteins in organisms.

Investigation of mercury-containing proteins by enriched stable isotopic tracer and size-exclusion chromatography hyphenated to inductively coupled plasma-isotope dilution mass spectrometry

International Nuclear Information System (INIS)

Shi Junwen; Feng Weiyue; Wang Meng; Zhang Fang; Li Bai; Wang Bing; Zhu Motao; Chai Zhifang

2007-01-01

In order to investigate trace mercury-containing proteins in maternal rat and their offspring, a method of enriched stable isotopic tracer ( 196 Hg and 198 Hg) combined with size-exclusion chromatography (SEC) coupled to inductively coupled plasma-isotope dilution mass spectrometry (ICP-IDMS) was developed. Prior to the analysis, 196 Hg- and 198 Hg-enriched methylmercury was administrated to the pregnant rats. Then the mercury-containing proteins in serum and brain cytosol of the dam and pup rats were separated by size-exclusion columns and the mercury was detected by ICP-MS. The ICP-MS spectrogram of the tracing samples showed significantly elevated 196 Hg and 198 Hg isotopic signals compared with the natural ones, indicating that the detection sensitivity could be increased by the tracer method. The contents of mercury in chromatographic fractions of the dam and pup rat brain cytosol were quantitatively estimated by post-column reverse ID-ICP-MS. The quantitative speciation differences of mercury in brain cytosol between the dam and pup rats were observed, indicating that such studies could be useful for toxicological estimation. Additionally, the isotopic ratio measurement of 198 Hg/ 202 Hg in the tracing samples could be used to identify the artifact mercury species caused in the analytical procedure. The study demonstrates that the tracer method combined with high-performance liquid chromatography (HPLC)-ICP-IDMS could provide reliably qualitative and quantitative information on mercury-containing proteins in organisms

Evaluation of the liver scintigraphy with sup(99m)Tc-Sn-colloid, 2

International Nuclear Information System (INIS)

Kimura, Kazufumi; Nishimura, Tsunehiko; Takeda, Hiroshi; Furukawa, Toshiyuki; Kajiya, Fumihiko.

1975-01-01

Clinical significance of the liver scintigraphy with sup(99m)Tc-Sn-colloid was evaluated in comparison with those with 198 Au-colloid. The liver scintigrams with sup(99m)Tc-Sn-colloid and 198 Au-colloid were done in 36 cases of various hepatic diseases and RI accumulation curves in the liver and the spleen, and the blood disapearance curves were also obtained. The conclusions were as follows. The liver scintigrams with sup(99m)Tc-Sn-colloid proved to be more sensitive in the detection of tumors, especially, in the lower margin, left lobe and superficial layers of the liver than those with 198 Au-colloid. In all cases, including normal and cirrhotic subjects, visualizations of the spleen were seen on the scintigrams with sup(99m)Tc-Sn-colloid. In diffuse hepatic diseases, comparing both radiopharmaceuticals, the splenic accumulations were studied qualitatively and quantitatively. As a result, the ratio (spleen/liver) was thought to be useful for the differentiation of diffuse hepatic diseases concerned with splenic function and/or size. It was also shown that sup(99m)Tc-Sn-colloid was useful as a spleen scanning agent. The Tl/2 in the liver accumulation curves with sup(99m)Tc-Sn-colloid were not as clearly differentiated in the various hepatic diseases as those with 198 Au-colloid where those indexes were useful in the evaluation of liver functions. (auth.)

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 231 ... Query: 198 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 257 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL

The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

International Nuclear Information System (INIS)

Chatal, J. F.

2000-01-01

The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

On the theory of time dilation in chemical kinetics

Science.gov (United States)

Baig, Mirza Wasif

2017-10-01

The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

Energy Technology Data Exchange (ETDEWEB)

Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

2016-08-01

The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

Energy Technology Data Exchange (ETDEWEB)

Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

2005-08-01

Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 4] ... Length = 122 ... Query: 139 SHKHPHILIVEDDAIQSKLLQAYLKSNFSITATTNGREALQFLQHNTVDLIISDIQMPEM 198 ... SHKHPHILIVEDDA...IQSKLLQAYLKSNFSITATTNGREALQFLQHNTVDLIISDIQMPEM Sbjct: 1 ... SHKHPHILIVEDDA

ORF Alignment: NC_004557 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available INKDIIKRRSGYNIEIKKVLVKDINKKRDLKIPEDLITTDVDEILEDPSIDIVVE 75 ... Query: 139 IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSD...IE 198 ... IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSDIE Sbjct: 136 IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSDIE 195 ...

ORF Alignment: NC_004113 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available VLYSLQTRLRFEDVDLPLLAKRPVKTV 60 ... Query: 139 YSGLEQIPSASEAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGL 198 ... YSGLEQIPSAS...EAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGL Sbjct: 121 YSGLEQIPSASEAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGL 180 ...

Interaction between IGFBP7 and insulin: a theoretical and experimental study

Science.gov (United States)

Ruan, Wenjing; Kang, Zhengzhong; Li, Youzhao; Sun, Tianyang; Wang, Lipei; Liang, Lijun; Lai, Maode; Wu, Tao

2016-04-01

Insulin-like growth factor binding protein 7 (IGFBP7) can bind to insulin with high affinity which inhibits the early steps of insulin action. Lack of recognition mechanism impairs our understanding of insulin regulation before it binds to insulin receptor. Here we combine computational simulations with experimental methods to investigate the interaction between IGFBP7 and insulin. Molecular dynamics simulations indicated that His200 and Arg198 in IGFBP7 were key residues. Verified by experimental data, the interaction remained strong in single mutation systems R198E and H200F but became weak in double mutation system R198E-H200F relative to that in wild-type IGFBP7. The results and methods in present study could be adopted in future research of discovery of drugs by disrupting protein-protein interactions in insulin signaling. Nevertheless, the accuracy, reproducibility, and costs of free-energy calculation are still problems that need to be addressed before computational methods can become standard binding prediction tools in discovery pipelines.

Gold sorption from aqueous solutions by hydroxides and oxides at conditions of complex formation and oxidation-reduction

International Nuclear Information System (INIS)

Novikov, A.I.; Shekoturova, E.K.; Ribalko, T.A.

1986-01-01

With using of radionuclide 198 Au 3+ at initial form 198 AuCl 4 - the sorption of Au 3+ at its concentrations from 1.27·10 3 till 1.9·10 -9 mol/l from solutions of NaClO 4 (0.1 and 1 mol/l), KHO 3 (0.1 and 1 mol/l), NaNO 3 (1 mol/l), NaCl(0.7-3 mol/l), KCl(0.01; 0.1 and 1 mol/l), NH 4 NO 3 (0.1 and 1 mol/l)NH 4 Cl(10 -3 ; 10 -2 ; 10 -1 and 1 mol/l) in a wide ph range (0+14) by hydroxides of Fe(III), Zr, oxides of Fe(III), Ti(IV), Mn(IV) and Sn(IV) is studied. The dependences of sorption value of Au 3+ on ph of medium, composition and concentrations of electrolytes in solution are defined. Calculations on condition of Au 3+ in aqueous solutions are conducted. Optimal conditions of gold concentration (including 198 Au) and its separation from carrier at sorption process are defined as well.

In vivo integrity of polymer-coated gold nanoparticles

Science.gov (United States)

Kreyling, Wolfgang G.; Abdelmonem, Abuelmagd M.; Ali, Zulqurnain; Alves, Frauke; Geiser, Marianne; Haberl, Nadine; Hartmann, Raimo; Hirn, Stephanie; de Aberasturi, Dorleta Jimenez; Kantner, Karsten; Khadem-Saba, Gülnaz; Montenegro, Jose-Maria; Rejman, Joanna; Rojo, Teofilo; de Larramendi, Idoia Ruiz; Ufartes, Roser; Wenk, Alexander; Parak, Wolfgang J.

2015-07-01

Inorganic nanoparticles are frequently engineered with an organic surface coating to improve their physicochemical properties, and it is well known that their colloidal properties may change upon internalization by cells. While the stability of such nanoparticles is typically assayed in simple in vitro tests, their stability in a mammalian organism remains unknown. Here, we show that firmly grafted polymer shells around gold nanoparticles may degrade when injected into rats. We synthesized monodisperse radioactively labelled gold nanoparticles (198Au) and engineered an 111In-labelled polymer shell around them. Upon intravenous injection into rats, quantitative biodistribution analyses performed independently for 198Au and 111In showed partial removal of the polymer shell in vivo. While 198Au accumulates mostly in the liver, part of the 111In shows a non-particulate biodistribution similar to intravenous injection of chelated 111In. Further in vitro studies suggest that degradation of the polymer shell is caused by proteolytic enzymes in the liver. Our results show that even nanoparticles with high colloidal stability can change their physicochemical properties in vivo.

Contribution to the study of collective states of heavy nuclei by means of coulomb excitation; Contribution a l'etude des etats collectifs des noyaux lourds par excitation coulombienne

Energy Technology Data Exchange (ETDEWEB)

Barloutaud, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1958-06-15

The following nuclei were excited by protons of 5 MeV maximum energy: {sup 182}W - {sup 184}W - {sup 186}W - {sup 186}Os - {sup 188}Os - {sup 189}Os - {sup 190}Os - {sup 192}Os - {sup 194}Pt - {sup 196}Pt - {sup 198}Pt - {sup 198}Hg - {sup 200}Hg - {sup 202}Hg - {sup 204}Hg - {sup 206}Pb. The reduced probabilities of the various transitions were deduced from the coulomb excitation cross-section measurements. For some even-even nuclei two 2 + levels were excited. The properties of the excited levels are interpreted in terms of the collective model. (author) [French] Au moyen de protons d'energie inferieure a 5 MeV, l'excitation coulombienne des noyaux suivants a ete etudiee: {sup 182}W - {sup 184}W - {sup 186}W - {sup 186}Os - {sup 188}Os - {sup 189}Os - {sup 190}Os - {sup 192}Os - {sup 194}Pt - {sup 196}Pt - {sup 198}Pt - {sup 198}Hg - {sup 200}Hg - {sup 202}Hg - {sup 204}Hg - {sup 206}Pb. La mesure de la section efficace d'excitation coulombienne a permis de deduire les -probabilites reduites des diverses transitions observees. Dans certains noyaux pair-pair, deux niveaux de caractere 2 + ont ete excites. L'interpretation de ces niveaux en termes de niveaux de rotation et de niveaux de vibration a l'aide du modele collectif est discutee. En particulier, la variation des proprietes de ces niveaux avec la deformation nucleaire permet de fixer des limites a la validite des diverses hypotheses entrant dans le modele collectif. (auteur)

Computationally Efficient Modeling of Hydrocarbon Oxidation Chemistry and Flames Using Constituents and Species

Science.gov (United States)

2012-02-10

Cremer , J-Y Chen, C.K. Westbrook, L.Q. Maurice, J. Propul. Power 18 (1) (2002) 192–198. K. Harstad, J. Bellan / Combustion and Flame 157 (2010) 1594... Cremer , J.-Y. Chen, C.K. Westbrook, L.Q. Maurice, J. Propuls. Power 18 (1) (2002) 192–198. a 10-9 10-7 10-5 10-3 10-1 101 N oh (m ol /m 3 ) T0 = 800...Caltech by the Army Research Office under the direction of Drs. David Mann, Kevin McNesby and Ralph Anthenien. References 1U. C. Müeller, N. Peters, A

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ADACRLLGDRAYRLCLTDMRLPDGDGIELVAHIQTQQPGLPVAVV 78 ... Query: 150 AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPV...NCGAISPEL 209 ... AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL Sbjct: 139 AALAQLR...VQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL 198 ... Query: 270 GAHAEESVDVR

FCJ-198 New International Information Order (NIIO Revisited: Global Algorithmic Governance and Neocolonialism

Directory of Open Access Journals (Sweden)

Danny Butt

2016-03-01

Full Text Available The field of Internet governance has been dominated by Euro-American actors and has largely resisted consideration of a holistic and integrative rights-based agenda, confining itself to narrow discussions on the technical stability of Internet Protocol resources and debates about nation-state involvement in multistakeholder governance of those resources. In light of the work of Edward Snowden documenting the close relationship between government security agencies and dominant social media platforms, this paper revisits the relevance of the New International Information Order (NIIO, a conceptualisation of the global politics of information described at the 1973 Fourth Summit Conference of the Non-Aligned Movement of nations in Algiers. This paper argues that critical analysis of the oligopolistic structure of “platforms” and their algorithmic forms of governance can build a more inclusive movement toward social justice by extending the NIIO framework’s emphasis on decolonisation, collective ownership of strategic information resources, and documentation of powerful transnational entities.

Is macromastia a risk factor for breast cancer? A study on 198 patients.

Science.gov (United States)

Talghini, Shahla

2013-11-01

Macromastia, or breast hypertrophy, is a very common finding and a frequent cause of reduction mammaplasty all over the world. This study aims to examine the breast tissue specimens obtained by reduction mammaplasty in patients with macromastia in terms of the frequency of histopathological abnormalities (malignant and non-malignant lesions). In this cross-sectional, retrospective study, paraffin-embedded specimens of breast tissue after reduction mammaplasty were histopathologically reviewed in Tabriz Imam Reza Teaching Hospital in three years (2010-2013). All the specimens were sectioned, stained and examined by an adroit pathologist. One hundred ninety eight out of 271 primary specimens were eligible for this study. The mean age of the patients was 37.09 +/- 8.98 (range: 20-59) years, with mean body mass index of 27.44 +/- 3.85 (range: 21-35) kg m(-2). Based on the findings of microscopic examination, normal tissue was present in 98 cases (49.5%), all with increased content of fat. Fibrocystic change was the prominent benign entity, which was reported in 47.5% of the cases. Intraductal papilloma was detected 2 cases (1%). There were 4 cases with malignant lesions (2%), including 2 cases (1%) with invasive ductal carcinoma (age: 22 and 31 years old) and 2 cases (1%) with lobular carcinoma in situ (age: 21 and 35 years old). Considering the intraductal papilloma as a premalignant condition, the total rate of non-benign lesions reached to 3%. Based on the results of the present study, macromastia may be considered as a risk factor of breast malignancy. Thorough histopathological examination of the breast specimens after reduction mammaplasty, as well as strict screening of the women with nonsurgical macromastia is highly recommended.

Slim 198gold-grain implanter loaded with standard royal marsden 14-grain magazines

International Nuclear Information System (INIS)

Delclos, L.; Moore, E.B.

1979-01-01

We designed a slim gold-grain implanter with adaptable lengths to implant areas accessible only through long, narrow, examining instruments, such as a suspension laryngoscope. The implanter is loaded with the same 14-grain magazine designed for and supplied with the Royal Marsden gun. The simplicity of the loading mechanism with a minimum of moving parts makes the instrument practically trouble free. Although it is designed to be used along narrow examining instruments, it can also be used in any situation in which a permanent implant is required, for instance, prostatic cancer and pelvic recurrences in cancer of the uterine cervix previously treated by external and intracavitary irradiation

Leonurine (SCM-198) attenuates myocardial fibrotic response via inhibition of NADPH oxidase 4.

Science.gov (United States)

Liu, Xin-Hua; Pan, Li-Long; Deng, Hai-Yan; Xiong, Qing-Hui; Wu, Dan; Huang, Guo-Ying; Gong, Qi-Hai; Zhu, Yi-Zhun

2013-01-01

In our previous studies, we have reported that leonurine, a plant phenolic alkaloid in Herba leonuri, exerted cardioprotective properties in a number of preclinical experiments. Herein, we investigated the roles and the possible mechanisms of leonurine for reducing fibrotic responses in angiotensin II (Ang II)-stimulated primary neonatal rat cardiac fibroblasts and post-myocardial infarction (MI) rats. In in vitro experiments performed in neonatal rat cardiac fibroblasts, leonurine (10-20 μM) pretreatment attenuated Ang II-induced activation of extracellular signal-regulated kinase 1/2, production of intracellular reactive oxygen species (ROS), expression and activity of matrix metalloproteinase (MMP)-2/9, and expression of α-smooth muscle actin and types I and III collagen. A small interfering RNA-mediated knockdown strategy for NADPH oxidase 4 (Nox4) revealed that Nox4 was required for Ang II-induced activation of cardiac fibroblasts. In vivo studies using a post-MI model in rats indicated that administration of leonurine inhibited myocardial fibrosis while reducing cardiac Nox4 expression, ROS production, NF-κB activation, and plasma MMP-2 activity. In conclusion, our results provide the first evidence that leonurine could prevent cardiac fibrosis and the activation of cardiac fibroblasts partly through modulation of a Nox4-ROS pathway. Copyright © 2012 Elsevier Inc. All rights reserved.

42 CFR 413.198 - Recordkeeping and cost reporting requirements for outpatient maintenance dialysis.

Science.gov (United States)

2010-10-01

...) Section 413.157, Return on equity capital of proprietary providers; (ii) Section 413.200, Reimbursement of... providers, and §§ 413.13, 413.30, 413.35, 413.40, 413.74, and §§ 415.55 through 415.70, § 415.162, and § 415...

Sexospécificités | Page 198 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

The Indigenous peoples who live there depend on this forest for food, medicine, building materials and much more. But parts of the rainforest are being cut by outsiders, the pressure on natural resources is increasing, and the livelihoods of the Indigenous peoples are threatened. Read more about Conserving biodiversity, ...

ORF Alignment: NC_002935 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tein ... [Corynebacterium diphtheriae] ... Length = 153 ... Query: 139 PAIPDDGPEIIVMTHPLDNVSEIDDV...HAEFLDQPDDDWLELYHFRGKALPRHALELLRTT 198 ... PAIPDDGPEIIVMTHPLDNVSEIDDVHAEFL...DQPDDDWLELYHFRGKALPRHALELLRTT Sbjct: 1 ... PAIPDDGPEIIVMTHPLDNVSEIDDVHAEFLDQPDDDWLELYHFRGKALPRHALELLRTT 60 ... Qu

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available nsporter ... [Nocardia farcinica IFM 10152] ... Length = 119 ... Query: 139 AGQYMTPEVVALPSDLTVAEA...LATVRAKGAHAETVYTLPVVDSGRRLTGIVELRELVLAR 198 ... AGQYMTPEVVALPSDLTVAEALATVR...AKGAHAETVYTLPVVDSGRRLTGIVELRELVLAR Sbjct: 1 ... AGQYMTPEVVALPSDLTVAEALATVRAKGAHAETVYTLPVVDSGRRLTGIVELRELVLAR 60 ...

Intracapsular irradiation therapy of craniopharyngiomas with radioactive gold

International Nuclear Information System (INIS)

Kodama, Takafumi; Matsukado, Yasuhiko; Uemura, Shozaburo

1981-01-01

Sixteen cases out of 27 patients with craniopharyngiomas were arbitrarily subjected to combined treatment of simple surgical evacuation and intracapsular irradiation with 198-Au. Follow-up studies were performed on 15 cases and they ranged from 6 months to 11 years. One patient was omitted from the study because of a short postoperative period. Immediate postoperative morbidity and the endocrine functions at the end of the follow-up study were compared with those of the patients who underwent extensive surgical resection of the tumors. Intracapsular irradiation with 198-Au was found to have satisfactory effects in the treatment of cystic craniopharyngioma, especially in recurrent cases of initially solid tumors, with respect to the preservation of the endocrine functions and the daily activity of the patients. The immediate postoperative hazards in the patients' care were also much less and they were found to be easily manageable. The patients, who had been followed up for over 5 years, maintained an occupational IQ score in the normal range and the patients under school age were all able to continue their school lives. One of the female patients, who had been married after the treatment, could have two children without any specific replacement therapy, and another patient in childhood who had shown physical retardation due to HGH deficiency, showed favorable results with crescormon administration in comparison with cases of extensive resection. Although the dosimetric value of 198-Au should be varied according to the size and thickness of the capsule, it was found that 15 to 30 mCi of 198-Au was the appropriate dosis for treatment. (author)

A review of isotopic composition as an indicator of the natural and anthropogenic behavior of mercury

International Nuclear Information System (INIS)

Ridley, W. Ian; Stetson, Sarah J.

2006-01-01

There are seven stable isotopes of Hg that can be fractionated as a result of inorganic and organic interactions. Important inorganic reactions involve speciation changes resulting from variations in environmental redox conditions, and phase changes resulting from variations in temperature and/or atmospheric pressure. Important organic reactions include methylation and demethylation, reactions that are bacterially mediated, and complexing with organic anions in soils. The measurement of Hg isotopes by multi-collector-inductively coupled plasma-mass spectrometry (MC-ICP-MS) is now sufficiently precise and sensitive that it is potentially possible to develop the systematics of Hg isotopic fractionation. This provides an opportunity to evaluate the utility of Hg isotopes in identifying source processes, transport mechanisms, and sinks. New values are provided for, 201 Hg/ 198 Hg, 200 Hg/ 198 Hg, 199 Hg/ 198 Hg for three standard materials (IRMM-AE639, SRM 1641c, SRM 3133) that can be used to make inter-laboratory data comparisons, and these values are tabulated with published isotopic information. Overall, the isotopic data for these standards agree to approximately 0.2 per mille . The paper reviews Hg isotope studies that deal with hydrothermal ore deposits, sediments, coal and organic complexing

Enhanced electrochemical properties of vanadium-doped titanium niobate as a new anode material for lithium-ion batteries

International Nuclear Information System (INIS)

Wen, Xiaoyan; Ma, Chenxiang; Du, Chenqiang; Liu, Jie; Zhang, Xinhe; Qu, Deyang; Tang, Zhiyuan

2015-01-01

The Vanadium-doped TiNb 2 O 7 (TNO) samples have been investigated as novel anode active materials for application in lithium-ion batteries. The samples are characterized by X-ray diffraction patterns (XRD), raman spectrum, scanning electron microscopy (SEM), transmission electron microscopy (TEM), galvanostatic charge-discharge tests, and cyclic voltammetry (CV) tests. The XRD results indicate that V-doping expands the lattice parameters of TiNb 2 O 7 samples and facilitates the enhanced lithium ion diffusion. SEM and TEM results show that lattice expansion caused by V-doping doesn’t significantly change the particle size distribution of TiNb 2 O 7 samples. The electrochemical measurements indicate that the TiNb 1.98 V 0.02 O 7 anode material displays a highly reversible capacity and excellent cycling stability. The initial discharge capacities of TiNb 1.98 V 0.02 O 7 are 298.48 mAh g −1 and 171.99 mAh g −1 at 0.3C and 10C, respectively, indicating that the TiNb 1.98 V 0.02 O 7 material can be utilized as a promising anode material for lithium-ion batteries.

A novel GATA3 nonsense mutation in a newly diagnosed adult patient of hypoparathyroidism, deafness, and renal dysplasia (HDR) syndrome.

Science.gov (United States)

Nanba, Kazutaka; Usui, Takeshi; Nakamura, Michikazu; Toyota, Yuko; Hirota, Keisho; Tamanaha, Tamiko; Kawashima, Sachiko-Tsukamoto; Nakao, Kanako; Yuno, Akiko; Tagami, Tetsuya; Naruse, Mitsuhide; Shimatsu, Akira

2013-01-01

Hypoparathyroidism, deafness, and renal dysplasia (HDR) syndrome is an autosomal dominant disorder caused by a GATA3 gene mutation. Here we report a novel mutation of GATA3 in a patient diagnosed with HDR syndrome at the age of 58 with extensive intracranial calcification. A 58-year-old Japanese man showed severe hypocalcemia and marked calcification in the basal ganglia, cerebellum, deep white matter, and gray-white junction on computed tomography (CT). The serum intact parathyroid hormone level was relatively low against low serum calcium concentration. The patient had been diagnosed with bilateral sensorineural deafness in childhood and had a family history of hearing disorders. Imaging studies revealed no renal anomalies. The patient was diagnosed with HDR syndrome, and genetic testing was performed. Genetic analysis of GATA3 showed a novel nonsense mutation at codon 198 (S198X) in exon 3. The S198X mutation leads to a loss of two zinc finger deoxyribonucleic acid (DNA) binding domains and is considered to be responsible for HDR syndrome. We identified a novel nonsense mutation of GATA3 in an adult patient with HDR syndrome who showed extensive intracranial calcification.

The Blood Disappearance Rate of 1{sup 98A}u-Colloid and Changes of Hepatic Blood Flow During Position Change in Normal Persons and in Patients with Various Hepatic Diseases

Energy Technology Data Exchange (ETDEWEB)

Cho, Bo Yeon [Capital Armed Force General Hospital, Seoul (Korea, Republic of); Hong, Kee Suk; Koh, Chang Soon; Lee, Mun Ho [Seoul National University College of Medicine, Seoul (Korea, Republic of)

1977-03-15

To evaluate the diagnostic significance of the blood disappearance rate of {sup 198}Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of {sup 198}Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1) In normal control, the mean blood disappearance half time of {sup 198}Au-colloid in supine position was 2.7+-0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2) In acute hepatitis, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0+-0.45, 3.5+-0.74, 7.2+-3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3) In the normal control and acute hepatitis, the decreases of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively.

Drug resistance detection and mutation patterns of multidrug resistant tuberculosis strains from children in Delhi

Directory of Open Access Journals (Sweden)

Jyoti Arora

2017-06-01

Full Text Available A total of 312 sputum samples from pediatric patients presumptive of multidrug resistant tuberculosis were tested for the detection of drug resistance using the GenoTypeMTBDRplus assay. A total of 193 (61.8% patients were smear positive and 119 (38.1% were smear negative by Ziehl–Neelsen staining. Line probe assay (LPA was performed for 208 samples/cultures (193 smear positive samples and 15 cultures from smear negative samples. Valid results were obtained from 198 tests. Of these, 125/198 (63.1% were sensitive to both rifampicin (RIF and isoniazid (INH. 73/198 (36.9% were resistant to at least INH/RIF, out of which 49 (24.7% were resistant to both INH and RIF (multidrug resistant. Children with tuberculosis are often infected by someone close to them, so strengthening of contact tracing in the program may help in early diagnosis to identify additional cases within the household. There is a need to evaluate newer diagnostic assays which have a high sensitivity in the case of smear negative samples, additional samples other than sputum among young children not able to expectorate, and also to fill the gap between estimated and reported cases under the program.

ORF Alignment: NC_005955 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... quintana str. Toulouse] ... Length = 198 ... Query: 11 ... ALRAFERGEILVVTDDNDRENEGDLTVAAVHCTEEKMAFIIRHTTGIVCAPM...LKEEAQRF 70 ... ALRAFERGEILVVTDDNDRENEGDLTVAAVHCTEEKMAFIIRHTTGIVCAPM...LKEEAQRF Sbjct: 1 ... ALRAFERGEILVVTDDNDRENEGDLTVAAVHCTEEKMAFIIRHTTGIVCAPMLKEEAQRF 60 ... Query: 131 PLIAHEGG

Bifunctional chelates of Rh-105 and Au-199 as potential radiotherapeutic agents

International Nuclear Information System (INIS)

Troutner, D.E.; Schlemper, E.O.

1990-01-01

Since last year we have: continued the synthesis of pentadentate bifunctional chelating agents based on diethylene triamine; studied the chelation Rh-105, Au-198 (as model for Au-199) and Tc-99m with these agents as well as chelation of Pd-109, Cu-67, In-111, and Co-57 with some of them; synthesized a new class of potential bifunctional chelating agents based on phenylene diamine; investigated the behavior of Au-198 as a model for Au-199; begun synthesis of bifunctional chelating agents based on terpyridly and similar ligands; and continued attempts to produce tetradentate bifunctional chelates based on diaminopropane. Each of these will be addressed in this report

Recent results on fusion and direct reactions with weakly bound stable nuclei

International Nuclear Information System (INIS)

Shrivastava, A.

2011-01-01

Recent measurements of fusion and direct reactions in case of weakly bound stable nuclei at extreme sub-barrier energies using a sensitive off beam technique are presented. First section deals with deep sub-barrier fusion cross-section measurement for 67 Li + 198 Pt followed by the study of fragment capture reaction of 7 Li + 198 Pt. Deviation in the slope of the fusion excitation function, as observed in case of medium heavy systems, is absent in the present asymmetric systems at these low energies. This study shows the absence of fusion hindrance, suggesting modifications in models that explain deep sub-barrier fusion data to incorporate weakly bound asymmetric systems

ORF Alignment: NC_004557 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Clostridium tetani E88] ... Length = 226 ... Query: 78 ... IKLAVILAAGLGSRLNSVTEDNIPKGMLEIEGKSLVERSINNLFENGIE...RIIIVTGHLNN 137 ... IKLAVILAAGLGSRLNSVTEDNIPKGMLEIEGKSLVERSINNLFENGIE...RIIIVTGHLNN Sbjct: 1 ... IKLAVILAAGLGSRLNSVTEDNIPKGMLEIEGKSLVERSINNLFENGIERIIIVTGHLNN 60 ... Query: 198 DKKDCVLL

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ding ... response regulator [Azoarcus sp. EbN1] ... Length = 243 ... Query: 139 GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP 198 ... GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP Sbjct: 1 ... GRSRAMQDLYQKVLRVAASEANVLITGESGVGKELVARALHDNSTRAKGPYVAVHCAS

Indirect Lymphography and its Importance in Oncology; La Lymphographie Indirecte et son Interet en Oncologie; Kosvennaya limfografiya i ee znachenie v onkologii; La Linfografia Indirecta y su Interes en Oncologia

Energy Technology Data Exchange (ETDEWEB)

Delaloye, B.; Magnenat, P. [Laboratoire des Radioisotopes, Clinique Medicale Universitaire de Lausanne, Lausanne (Switzerland)

1964-10-15

Indirect lymphography, which only requires a subcutaneous injection of colloidal gold-198 with a particle diameter of 50 A in the tributary region of the lymphatic system being explored, makes possible, by scintigraphic recording, a clear representation of the ganglionic lymphatic chains. The problems of collimation in getting optimum definition are discussed. With this method of investigating the lymphatic system, measurement of the time of appearance of the gold in the blood yields indirect information regarding the rate of transit of the colloidal gold particles in the lymphatic vessels. Useful information is also obtained on neoplastic infiltrations of the ganglia and hence it is possible to determine the extent of a metastatic infiltration. Clinical examples are described. In addition, the authors describe a new technique for hepatic lymphography by the transcutaneous, sub-capsular injection of colloidal gold-198. This technique reveals the anterior and posterior mediastinal lymphatic chains. (author) [French] La lymphographie indirecte, qui ne necessite qu'une injection sous-cutanee d'or-198 colloiedal dont le diametre des particules est de 50 Adans le territoire tributaire du systeme lymphatique que l'on veut explorer, permet par enregistrement scintigraphique une bonne mise en evidence des chaines ganglionnaires lymphatiques. Les problemes de collimation sont discutes afin d'obtenir la meilleure definition possible. Ce mode d'investigation du systeme lymphatique permet, lorsqu'on mesure le temps d'apparition de l'or dans le sang, d'obtenir indirectement des renseignements sur la vitesse du transit des particules d'or colloiedal dans les vaisseaux lymphatiques. On obtient egalement d'utiles renseignements sur les infiltrations neoplastiques des ganglions et, de ce fait, il est possible de connaitre l'etendue d'une infiltration metastatique. Des exemples cliniques sont decrits. De plus, les auteurs decrivent une nouvelle technique de lymphogtaphie hepatique

Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

Energy Technology Data Exchange (ETDEWEB)

Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

2011-01-15

Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

International Nuclear Information System (INIS)

Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

1981-01-01

This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

Energy Technology Data Exchange (ETDEWEB)

Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

1981-01-01

This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

International Nuclear Information System (INIS)

Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir

2011-01-01

Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

Proceedings of transuranium elements

International Nuclear Information System (INIS)

Anon.

1992-01-01

The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ion ... SMC protein, putative [Staphylococcus epidermidis RP62A] ... Length = 198 ... Query: 3 ... YLKSIDAIGFKSFADHT...NVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGAKM 62 ... YLKSIDAIGFKSFADHT...NVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGAKM Sbjct: 1 ... YLKSIDAIGFKSFADHTNVQFDKGVTAIVGPNGSGKSNITDA

Determinação da compatibilidade de desenvolvimento de culturas bacteriocinogênicas e fermento láctico Determination of the growth compatibility between bacteriocinogenic and starter cultures

Directory of Open Access Journals (Sweden)

Maristela da Silva do Nascimento

2009-03-01

Full Text Available Além da utilização como bioconservantes de alimentos, algumas culturas bacteriocinogênicas estão sendo empregadas para acelerar a maturação de queijos. Porém a compatibilidade de desenvolvimento destas culturas com o fermento láctico é essencial para a obtenção de produtos característicos. O objetivo deste estudo foi avaliar a compatibilidade de desenvolvimento de Lactococcus lactis subsp. lactis ATCC 11454, Lactobacillus plantarum ALC 01 e Enterococcus faecium FAIR-E 198 com duas marcas comerciais de fermentos lácticos. Inicialmente, foi determinada a sensibilidade in vitro dos fermentos às culturas bacteriocinogênicas, somente Lc. lactis subsp. lactis ATCC 11454 foi capaz de promover a inibição de ambos os fermentos. Durante desenvolvimento associativo em leite a 35 ºC, as culturas bacteriocinogênicas não afetaram significativamente a produção de ácido láctico pelos fermentos. Estes, por sua vez proporcionaram aumento significativo da atividade de pediocina AcH e enterocina FAIR-E 198 e supressão da atividade da nisina. Dentre todas as culturas lácticas, Lb. plantarum ALC 01 apresentou a maior atividade de aminopeptidases (0,226 a 0,390. Portanto, baseado nos resultados em questão, Lb. plantarum ALC 01 e E. faecium FAIR-E 198 apresentam características de compatibilidade de desenvolvimento com o fermento mesofílico tipo O para serem empregadas como adjuntas no processamento de queijos.In addition to being used as food bioconservants, some bacteriocinogenic cultures have been employed to accelerate cheese ripening. However, the compatibility between their growth and starter cultures is essential to obtain the characteristic products. The purpose of this study was to evaluate the growth compatibility between Lactococcus lactis subsp. lactis ATCC 11454, Lactobacillus plantarum ALC 01, and Enterococcus faecium FAIR-E 198 and two commercial starter cultures. Initially, the sensibility in vitro of the starter to

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erase ... family [Azoarcus sp. EbN1] ... Length = 198 ... Query: 102 HGCGQDXXXXXXXXXXXXXXXXXXXXVLLPEQASEAN...PNRCWNWFGREPVVAMEAAILKA 161 ... HGCGQD ... VLLPEQASEAN...PNRCWNWFGREPVVAMEAAILKA Sbjct: 23 ... HGCGQDSASFAATTRAAANARAGGYAVLLPEQASEANPNRCWNWFGREPVVAMEAAILKA 82 ... Quer

Examining porous bio-active glass as a potential osteo-odonto-keratoprosthetic skirt material.

Science.gov (United States)

Huhtinen, Reeta; Sandeman, Susan; Rose, Susanna; Fok, Elsie; Howell, Carol; Fröberg, Linda; Moritz, Niko; Hupa, Leena; Lloyd, Andrew

2013-05-01

Bio-active glass has been developed for use as a bone substitute with strong osteo-inductive capacity and the ability to form strong bonds with soft and hard tissue. The ability of this material to enhance tissue in-growth suggests its potential use as a substitute for the dental laminate of an osteo-odonto-keratoprosthesis. A preliminary in vitro investigation of porous bio-active glass as an OOKP skirt material was carried out. Porous glass structures were manufactured from bio-active glasses 1-98 and 28-04 containing varying oxide formulation (1-98, 28-04) and particle size range (250-315 μm for 1-98 and 28-04a, 315-500 μm for 28-04b). Dissolution of the porous glass structure and its effect on pH was measured. Structural 2D and 3D analysis of porous structures were performed. Cell culture experiments were carried out to study keratocyte adhesion and the inflammatory response induced by the porous glass materials. The dissolution results suggested that the porous structure made out of 1-98 dissolves faster than the structures made from glass 28-04. pH experiments showed that the dissolution of the porous glass increased the pH of the surrounding solution. The cell culture results showed that keratocytes adhered onto the surface of each of the porous glass structures, but cell adhesion and spreading was greatest for the 98a bio-glass. Cytokine production by all porous glass samples was similar to that of the negative control indicating that the glasses do not induce a cytokine driven inflammatory response. Cell culture results support the potential use of synthetic porous bio-glass as an OOKP skirt material in terms of limited inflammatory potential and capacity to induce and support tissue ingrowth.

Familial clustering of myocardial infarction in first-degree relatives

DEFF Research Database (Denmark)

Nielsen, Mia; Andersson, Charlotte; Gerds, Thomas A

2013-01-01

showed an RR of 4.30 (95% confidence interval 3.53–5.23) for siblings of a patient with MI. Children of parents with MI also showed high risk: for children of a maternal case RR 2.40 (2.20–2.60), and of a paternal case RR 1.98 (1.98–2.09), respectively; P value for gender interaction paternal...... case with MI at an age 50 years was associated with a risk of 1.83 (1.73–1.93). For maternal cases below and above 50 years of age the risks were 3.23 (2.56–4.10) and 2.31 (2.11–2.52), respectively. Conclusion First-degree relatives...

ORF Alignment: NC_005788 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available gossypii ATCC 10895] ref|NP_986570.1| AGL097Cp ... [Eremothecium gossypii] ... Length = 198 ... Query: 449 NPRKFESWL...HTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXX 508 ... NPRKFESWLHTATLANIATVF...KDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTT ... Sbjct: 1 ... NPRKFESWLHTATLANIATVFKDSDSKEWR

Internal irradiation for cystic craniopharyngioma

International Nuclear Information System (INIS)

Kobayashi, T.; Kageyama, N.; Ohara, K.

1981-01-01

The authors report the results of internal irradiation with labeled chromic phosphate (32P) and gold-198 (198Au) colloid in eight cases of cystic craniopharyngiomas. They used a newly developed dosimetric formula, by which the radiation dose at the cyst wall and at any point far from the radioactive source can be calculated. Ten courses of irradiation in eight patients were carried out by injection of either 32P or 198Au colloid into the cyst through an Ommaya drainage system that had been placed at craniotomy. Follow-up studies ranging from 13 to 156 months revealed that all cysts were effectively treated, with elimination of fluid or collapse of the cyst. This was confirmed by Conray cystography and/or computerized tomography. Not only the dose delivered to the wall but also the thickness of the cyst wall and the location of the cyst are important factors in planning internal irradiation. A safe and adequate dose to the cyst wall could range between 9000 to 30,000 rads for craniopharyngioma. This treatment is suitable for large cysts that are thought to be difficult to remove radically, recurrent cysts resistant to previous treatment, or multiple cysts. Internal irradiation may also be applicable in other cystic intracranial tumors if dosimetry is calculated accurately

198 "Viviendas dinámicas sin deuda" en Valdivia, X Región, Chile

Directory of Open Access Journals (Sweden)

Bonet Miró, Ana

2007-06-01

Full Text Available The purpose of the competition as well as the project developed in response to the social, constructive and climate specific conditions of Valdivia, X Region, Chile, is the design and construction of experimental social housing, whose cost, including land and services, would not exceed 7,500 $ per unit. The housing units should be designed in order to grow and to be adapted by owners and should allow for achieving higher urban density as average so to reduce the burden of costs derived from land acquisition and services. The project adopts a three-storey compact typology such as a “big house”, with 2 units on ground floor and 4 duplex on upper floors. The local wood construction tradition and the good level of acceptance of it within the context of Valdivia, bring us to develop a mixed construction system, concrete and wood, which not only is suitable to the geotechnical and seismic conditions of the ground, but also to the economical restrictions and to the requirements of spatial flexibility so necessary when designing a minimal housing unit.El objetivo del concurso y del proyecto desarrollado posteriormente, adaptado a los condicionantes sociales, constructivos y climatológicos de Valdivia, X Región, Chile, es el diseño y construcción de unas viviendas sociales experimentales, cuyo coste, incluida la repercusión del suelo no exceda de 7.500 $ por unidad. Dichas viviendas tienen que ser aptas para su crecimiento y adaptación posterior y lograr una mayor densidad que las habitualmente conseguidas en estos programas con el fin de abaratar los costos derivados de la compra del terreno. Se adopta una tipología compacta de “casa grande”, de tres alturas, con 2 viviendas en planta baja y 4 dúplex en las plantas superiores. La tradición constructiva local en madera y la buena aceptación que la misma tiene en el contexto de Valdivia han llevado a proponer un sistema mixto, hormigón y madera que no sólo responde bien a los condicionantes geotécnicos y sísmicos del solar y a las limitaciones económicas sino también a la flexibilidad espacial necesaria en un proyecto de vivienda mínima.

Andalusi sherds from Prague

Czech Academy of Sciences Publication Activity Database

Charvát, Petr; Hrdlička, Ladislav; Delery, C.

2013-01-01

Roč. 65, č. 1 (2013), s. 198-206 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Middle Ages * Prague * commerce * Spain * Almohad empire Subject RIV: AC - Archeology, Anthropology, Ethnology

Auf dem Weg zum Portalverbund – das neue Onlinezugangsgesetz (OZG) / Thorsten Siegel

Index Scriptorium Estoniae

Siegel, Thorsten

2018-01-01

Haldusteenustele liidu ja liidumaade tasandil infotehnoloogilise juurdepääsu tagamisest ühtse portaali loomise ja seadustamisega; põhiseaduse artikli 91 tõlgendamisest. Vt samal teemal ka lk. 193-198

Nuclear accident dosimetry: the calibration of Geiger-Mueller and 2π proportional counters for sulphur and gold

International Nuclear Information System (INIS)

Delafield, H.J.; Reading, A.H.

1981-10-01

A reference, 2π precision counter was set up at Harwell and absolutely calibrated for the measurement of sulphur discs ( 32 P) and gold foils ( 198 Au) used in the UK personnel criticality dosimeter. Sample sulphur discs and gold foils were irradiated in the GLEEP reactor at Harwell, counted in the 2π counter, and their activities absolutely assayed by the National Physical Laboratory. The 2π counter was then used to intercalibrate the GM counters used routinely for the assessment of the criticality dosimeter. The mean measured efficiencies of the GM counters were found to be for 32 P in sulphur discs within +- 4%, and for gold ( 198 Au) within +- 6% of the values given by previous calibrations. (author)

Investigation of hydrolysis products in the acetone-butanol fermentation of vegetable agricultural waste materials

Energy Technology Data Exchange (ETDEWEB)

Nakhmanovich, B M

1960-01-01

Determinations of the fundamental chemical composition of corn stalk, sunflower husk, and hemp scutch by chromatography were reported, e.g. pentoses (1.98, 1.98, 2.01%), hexoses (1.59, 1.72, 2.01% respectively.) and various amino acids (arginine, asparagine, histidine, glutamine, glycine, lysine, proline, serine, tyrosine, threonine, cysteine, cystine, alanine, and aspartic and glutamic acids). The sterilized products from the hydrolysis (pentoses, hexoses) in a combined mixture with a meal mash were normally fermented at 37/sup 0/ in the presence of acetone-butanol bacteria for 40 to 48 hours, yielding 10.46 to 12.50% of acetone, 15.09 to 18.0% of butanol, 3.79 to 6.08% of ethanol (a total yielding being 30 to 42% of solvents).

Band crossings in mercury nuclei: effect of occupation of i13/2 neutron orbits

International Nuclear Information System (INIS)

Khadkikar, S.B.; Praharaj, C.R.

1984-04-01

The K=0 + ground band and two rotation-aligned bands (K=1 + or K2 + two quasi-particle band and K=2 + four quasi-particle band) are studied in 198 Hg, 194 Hg and 190 Hg by angular momentum projection from Hartree-Fock and particle-hole intrinsic states. There is a first anomaly in these three nuclei around 8(h/2π) due to the crossing of the ground band and the two quasi-particle band. Because of the nature of occupation of i13/2 orbitals the four quasi-particle band is too highlying in 198 Hg and does not cross the two quasi-particle bands, while such a second crossing occurs in 194 Hg and 190 Hg near 20 (h/2π). (author)

Sexuelle Belästigung aus strafrechtlicher Sicht

Directory of Open Access Journals (Sweden)

Maria Eder-Rieder

2004-07-01

Full Text Available Der Kern der Arbeit ist die juristische Aufarbeitung der Grenzen und Reichweite der in der Schweiz seit 1. Oktober 1992 in Kraft befindlichen Regelungen zur sexuellen Belästigung durch Vornahme einer sexuellen Handlung vor jemanden (Art. 198 Abs. 1 StGB, der tätlichen sexuellen Belästigung und der verbalen Belästigung (Art. 198 Abs. 2 StGB. Diese Tatbestände werden anhand von Beispielen erläutert, mit weiteren Varianten der sexuellen Belästigung verglichen und zu anderen Tatbeständen abgegrenzt. Ebenso wird auf das Verhältnis zum Zivilrecht und die Problematik des Strafprozesses eingegangen. Abschließend wird der kriminalpolitischen Frage über den Sinn der strafrechtlichen Sanktionierung nachgegangen.

Low dose irradiation and risk of leukaemia: A case-control study

International Nuclear Information System (INIS)

Chobanova, N.; Bayrakova, A.

1997-01-01

The effect of low dose irradiation (medical X-ray diagnostic) on the developing of leukaemias in adults is investigated. The influence of non-radiation agents (occupational exposure to chemical carcinogens, past viral infections, family aggregations) to leukaemias are considered also. During this retrospective study 228 patients have been examined with the following diagnosis: acute myeloid leukaemia, chronic myelogenous leukaemias, myelodisplastic syndrome and non-Hodgkin lymphoma (diagnosed between 1991-1993). Each case has been matched with two controls. Statistically significant increase has been found in the risk of developing leukaemias after X-ray diagnostic irradiation (OR = 1.98, 95% CI = 1.14 ./. 3.46). Exposure to chemical agents is also associated with significant increase in the risk (OR = 1.98, 95% CI = 1.25 ./. 2.86). (author)

Variation in leaf anatomy within the Elytrigia intermedia – E. ×mucronata – E. repens (Poaceae) hybrid complex

Czech Academy of Sciences Publication Activity Database

Paštová, Ladislava

2017-01-01

Roč. 23, č. 2 (2017), s. 187-198 ISSN 1310-7771 Institutional support: RVO:67985939 Keywords : hybrid * leaf blade selection * micromorphology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

40 CFR 270.305 - What tank information must I keep at my facility?

Science.gov (United States)

2010-07-01

... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... 267.198. (j) For tank systems in which ignitable, reactive, or incompatible wastes are to be stored or...

Formation of less-known structurally complex ζb and orthorhombic quasicrystalline approximant εn on solidification of selected Al–Pd–Cr alloys

Czech Academy of Sciences Publication Activity Database

Adamech, A.; Černičková, I.; Ďuriška, L.; Kolesár, V.; Drienovský, M.; Bednarčík, J.; Svoboda, Milan; Janovec, J.

2014-01-01

Roč. 97, NOV (2014), s. 189-198 ISSN 1044-5803 Institutional support: RVO:68081723 Keywords : complex metallic alloys * aluminium alloys * intermetallics Subject RIV: JG - Metallurgy Impact factor: 1.845, year: 2014

Čas Kouzelného vrchu

Czech Academy of Sciences Publication Activity Database

Dubský, Ivan

-, č. 72 (2008), s. 87-198 ISSN 1210-2881 Institutional research plan: CEZ:AV0Z90090514 Keywords : Exploration * Magic Mountain * mystery * mystery of time * Thomas Mann Subject RIV: AA - Philosophy ; Religion

Cancer therapy with alpha-emitters labeled peptides.

Science.gov (United States)

Dadachova, Ekaterina

2010-05-01

Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.

Selective targeting of tumour neovasculature by a radiohalogenated human antibody fragment specific for the ED-B domain of fibronectin

International Nuclear Information System (INIS)

Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.

2001-01-01

Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)

Studies of liver scintigram by sup(99m)Tc-sodium phytate

International Nuclear Information System (INIS)

Abe, Masahide; Matsui, Kengo; Chiba, Kazuo; Yamada, Hideo; Iio, Masahiro

1974-01-01

Inositol hexaphosphate occurs in nature either free or in compounds (phytic acid). It is soluble in water and becomes a microcolloid by chelating serum calcium after intravenous injection, and forming insoluble calcium phytate, which undergoes reticuloendothelial localization. Case reports were made on all patients who had liver scan studies between August and December, 1973. Eighty-eight patients were studied with a total of 96 liver scans with sup(99m)Tc-phytate. Among these, the hepatic blood flow of eighteen were studied with sup(99m)Tc-phytate and 198 Au-colloid simultaneously. Labeling of sup(99m)Tc-phytate was easy, it remained stable for a long time and only a few free technetium were revealed (labeling yield: average 93.6%). The blood clearance of sup(99m)Tc-phytate was slower than that of 198 Au-colloid. This suggests that the liver scan must begin more than twenty minutes after the injection. Comparing their affinities for the reticuloendothelial system, sup(99m)Tc-phytate shows a greater accumulation in the spleen than does 198 Au-colloid. sup(99m)Tc-phytate is a useful diagnostic scanning agent of the liver and spleen. Because of its superior physical characteristics excellent scans are readily obtained with minimal radiation to the patient and there have been no side effects who have received sup(99m)Tc-phytate. (author)

Genetic Polymorphisms in Endothelin-1 as Predictors for Long-Term Survival and the Cardiac Index in Patients Undergoing On-Pump Cardiac Surgery.

Directory of Open Access Journals (Sweden)

Ashham Mansur

Full Text Available Genetic variants within the endothelin-1 gene (EDN1 have been associated with several cardiovascular diseases and may act as genetic prognostic markers. Here, we explored the overall relevance of EDN1 polymorphisms for long-term survival in patients undergoing on-pump cardiac surgery. A prospectively collected cohort of 455 Caucasian patients who underwent cardiac surgery with cardiopulmonary bypass was followed up for 5 years. The obtained genotypes and inferred haplotypes were analyzed for their associations with the five-year mortality rate (primary endpoint. The EDN1 T-1370G and K198N genotype distributions did not deviate from Hardy-Weinberg equilibrium and the major allele frequencies were 83% and 77%, respectively. The cardiovascular risk factors were equally distributed in terms of the different genotypes and haplotypes associated with the two polymorphisms. The five-year mortality rate did not differ among the different EDN1 T-1370G and K198N genotypes and haplotypes. Haplotype analysis revealed that carriers of the G-T (compound EDN1 T-1370G G/K198N T haplotype had a higher cardiac index than did non-carriers (p = 0.0008; however, this difference did not reach significance after adjusting for multiple testing. The results indicate that common variations in EDN1 do not act as prognostic markers for long-term survival in patients undergoing on-pump cardiac surgery.

Naše první zkušenosti s infekcemi vyvolanými Arthroderma benhamiae (Trichophyton sp.)

Czech Academy of Sciences Publication Activity Database

Skořepová, M.; Hubka, Vít; Polášková, S.; Stará, J.; Čmoková, A.

2014-01-01

Roč. 89, č. 4 (2014), s. 192-198 ISSN 0009-0514 Grant - others:Universita Karlova(CZ) 1344214 Institutional support: RVO:61388971 Keywords : Arthroderma benhamiae * dermatophytoses * Trichophyton sp. Subject RIV: EE - Microbiology, Virology

The impact of changes in labour broking on an integrated petroleum and chemical company

Directory of Open Access Journals (Sweden)

Yvonne T. Joubert

2017-05-01

Contribution / value-add: The study represents original research, extending the current body of knowledge on the perceptions of employees in the human resources department regarding the changes to section 198 of the LRA.

Características fotossintéticas de genótipos de capim-elefante anão (Pennisetum purpureum Schum., em estresse hídrico - DOI: 10.4025/actascianimsci.v32i1.8961 Photosynthetic characteristics of dwarf elephant grass (Pennisetum purpureum Schum. genotypes under different hydric conditions - DOI: 10.4025/actascianimsci.v32i1.8961

Directory of Open Access Journals (Sweden)

Alena Torres Netto

2009-12-01

Full Text Available O experimento foi realizado com o objetivo de avaliar as trocas gasosas de genótipos de capim-elefante anão, em diferentes condições hídricas. O delineamento experimental foi inteiramente casualizado com três repetições. Foram avaliados três genótipos de capim-elefante anão (Mott, CNPGL 94-34-3 e CNPGL 92-198-7 em duas condições de umidade do solo: irrigado (I e não-irrigado (NI. Foi observada diferença entre os tratamentos I e NI para todos os genótipos em relação à taxa fotossintética, condutância estomática, transpiração e déficit de pressão de vapor. O genótipo CNPGL 94-34-3 apresentou maior tolerância ao estresse hídrico, seguido pelos genótipos Mott e CNPGL 92-198-7. Todos os genótipos avaliados apresentaram, em condições ideais de umidade do solo, alta taxa fotossintética, caracterizando, deste modo, os genótipos estudados como plantas de elevada eficiência fotossintética.The experiment was carried out aiming to evaluate the gas exchange of dwarf elephant grass genotypes under different hydric conditions, in a randomized design with three replications. Genotypes of dwarf elephant grass (Mott, CNPGL 94-34-3 and CNPGL 92-198-7 were analyzed under two hydric conditions: irrigated (I and non-irrigated (NI. Differences between treatments I and NI were observed for all genotypes for photosynthesis, stomatal conductance, transpiration and water vapor pressure deficit. Genotype CNPGL 94-34-3 presented highest tolerance to hydric stress, followed by Mott and CNPGL 92-198-7 genotypes. All genotypes presented high photosynthetic rate, under ideal conditions of soil humidity, thus characterizing the analyzed dwarf elephant grass genotypes as plants with high photosynthetic efficiency.

Dynamic and scintigraphic studies of diffuse hepatic diseases using sup(99m)Tc-Sn-phytate

International Nuclear Information System (INIS)

Akisada, Masayoshi; Miyamae, Tatsuya.

1975-01-01

From March 1974 to May 1974, liver scintigraphies were performed at Mitsui Memorial Hospital. Three groups of patients were composed of: 24 of liver cirrhosis, 29 of chronic hepatitis and 30 of a normal control group. The mixture of 1.5 mCi of sup(99m)Tc-phytate and 30 μCi of 198 Au-colloid were injected rapidly. Ksub(L) value of sup(99m)Tc-phytate in the liver cirrhosis group was lower than the chronic hepatitis group, which was lower than the normal group. The correlation between Tsub(1/2) (L) and Tsub(1/2)(P): In the normal group, the coefficient correlation between Tsub(1/2)(L) and Tsub(1/2)(P) was fairly good both in sup(99m)Tc-phytate and in 198 Au-colloid, whereas the correlation was low in the chronic hepatitis group and liver cirrhosis group. The how correlation between the Ksub(L) values of sup(99m)Tc-phytate and 198 Au-colloid: The correlation of the Ksub(L) value was low in all three groups. Ksub(L) values in sup(99m)Tc-phytate were higher than they were in 198 Au-colloid in all three groups. When each probe was placed on the temporal and thigh region simultaneously for obtaining the peripheral blood clearance, the Tsub(1/2)(P) value (temporal) was always smaller than the Tsub(1/2)(P) value (thigh). Grade of kidney visualization in liver scintigraphy using sup(99m)Tc-phytate: Kidney activities were seen in 72.9% of 83 patients and there was no grade difference between the normal, chronic hepatitis and liver cirrhosis group. An additional attempt to determine the nature and size of ''sup(99m)Tc-phytate in vivo colloid'', Ca ion was added to sup(99m)Tc-phytate solution prior to the injection. Lung, spleen, and liver were simultaneously visualized using this ''in vitro sup(99m)Tc-phytate minicolloid''. (Evans, J.)

Errores algebraicos más comunes en los estudiantes de primer ingreso de las carreras de Informática, Administración y Turismo del Centro Universitario de los Valles de la Universidad de Guadalajara

Directory of Open Access Journals (Sweden)

Emilio Ramírez Mora

2015-10-01

Full Text Available En la presente investigación se analizan los errores algebraicos más comunes que cometen los estudiantes de primer ingreso de las licenciaturas de Informática, Administración y Turismo. La acotación del estudio a errores algebraicos se debe a que los conocimientos algebraicos básicos constituyen un conocimiento deseable antes de cursar las asignaturas de Matemáticas I y Precálculo. El test se aplicó a un total de 198 estudiantes, el cual consta de 15 reactivos de opción múltiple y se tiene un 51.31% de respuestas incorrectas, un 5.08% de respuestas sin contestar. El promedio general de los 198 estudiantes es de 43.60. Un estudiante no obtuvo ninguna respuesta correcta, así como ninguno los 15 reactivos correctamente. El error más común fue para el reactivo número 15 con el 69.19% de respuestas incorrectas; este reactivo serefiere a encontrar la solución de una ecuación cuadrática.  SummaryIn this research the most common algebraic errors committed by first semester students of Informatics, Administration and Tourism programs are analyzed. The idea of studying algebraic errors is due to the fact that basic algebraic knowledge constitutes a desirable knowledge before studying the subjects of Math I and Precalculus. The test was applied to 198 students. This test is formed by 15 reagents of multiple option and it had a 51,31% of incorrect answers, and 5,08% of noanswered questions. The general average of the 198 students is 43,60. A student did not obtain any correct answer, as well as none got the 15 reagents correctly. The most common error was for the reagent number 15 with the 69,19% of incorrect answers; this point refers to find the solution of a quadratic equation.

Antifouling Compounds from Marine Invertebrates

OpenAIRE

Qi, Shu-Hua; Ma, Xuan

2017-01-01

In this review, a comprehensive overview about the antifouling compounds from marine invertebrates is described. In total, more than 198 antifouling compounds have been obtained from marine invertebrates, specifically, sponges, gorgonian and soft corals.

African Journal of Traditional, Complementary and Alternative ...

African Journals Online (AJOL)

org/10.21010/ajtcam.v13i6.9 .... Muhammad Abuzar Ghaffari, Bashir Ahmed Chaudhary, Muhammad Uzair, Khuram Ashfaq, 194-198 ... Abdelkader Benhelima, Zohra Kaid-Omar, Houari Hemida, Tarek Benmahdi, Ahmed Addou, 204-214.

English in the Czech Republic: Linguists’ perspectives

Czech Academy of Sciences Publication Activity Database

Kaderka, Petr; Prošek, Martin

-, č. 28 (2014), s. 173-198 ISSN 0933-1883 Institutional support: RVO:68378092 Keywords : language situation * English as a global language * attitudes towards English * national language institution * sociolinguistics * Czech Republic Subject RIV: AI - Linguistics

Aging changes in the breast

Science.gov (United States)

... this page: //medlineplus.gov/ency/article/003999.htm Aging changes in the breast To use the sharing ... chap 198. Walston JD. Common clinical sequelae of aging. In: Goldman L, Schafer AI, eds. Goldman-Cecil ...

Treatment with radioactive drugs

International Nuclear Information System (INIS)

McDougall, I.R.

1978-01-01

The use of 131 I in the treatment of thyroid diseases is described. The therapeutic possibilities of application for ther radionuklide, e.g. phosphorus 32, gold 198, or yttrium 90 are discussed. (VJ) [de

Antifouling Compounds from Marine Invertebrates.

Science.gov (United States)

Qi, Shu-Hua; Ma, Xuan

2017-08-28

In this review, a comprehensive overview about the antifouling compounds from marine invertebrates is described. In total, more than 198 antifouling compounds have been obtained from marine invertebrates, specifically, sponges, gorgonian and soft corals.

Ultratrace determination of platinum in biological materials via neutron activation and radiochemical separation

International Nuclear Information System (INIS)

Zeisler, R.; Greenberg, R.R.

1982-01-01

A neutron activation analysis scheme based upon a radiochemical separation of the activation products has been developed. The method utilizes the inherent sensitivity of the activation reaction 198 Pt(n,ν) 199 Pt and counting of the daughter nuclide 199 Au. This nuclide is radiochemically separated from interfering activities by homogeneous precipitation as elemental gold. The remaining interference of the secondary reaction 197 Au(n,ν) 198 Au(n,ν) 199 Au from gold in the samples is quantitatively assessed and corrected. During this process accurate gold concentrations in the samples are obtained at ultratrace levels. The analysis scheme is applied to gold and platinum determinations in biological Standard Reference Materials and human liver specimens. Gold and platinum are determined at concentrations of 5x10 - 11 g/g, and at higher levels. (author)

Indication of Dexa Scheroson in the field of radiology

International Nuclear Information System (INIS)

Tateno, Ikuro

1978-01-01

20 - 100 mg of Dexa Scheroson was used to treat thyroid crisis (5 cases) occurred after administration of 131 I to hyperthyroidism and to prevent side effects of 198 Au colloid injected intraperitoneally for cancerous peritonitis (3 cases). This drug was also used to treat iodine shock (2 cases) occurred when using contrast medium containing iodine for diagnosis and to prevent iodine shock (5 cases). Dexa Scheroson was effective in 14 of 15 cases, and side effects were not recognized in any cases. One case which was unresponsive to this drug had asystole caused by thyroid crisis occurred suddenly after administration of 131 I. Dexa Scheroson was thought to prevent onset of radiation fibrosis due to intraperitoneal injection of 198 Au colloid. Effectiveness of Dexa Scheroson was certified in each case. (Serizawa, K.)

Air Mobility Command’s En Route Support Infrastructure: A Construct of Aircraft Type and Geographic Location Utilized to Assess En Route Aircraft Logistic Support

Science.gov (United States)

2007-06-01

Minor EDDF Rhein Main AB, Germany 721 AMOG 726 Air Mobility Squadron Minor EGUN RAF Mildenhall, United Kingdom 721 AMOG 727 Air Mobility Squadron...45.7 58.8 EGUL KC-135 5 221.7 44.3 13.5 0.8 177.0 176.2 66.8 4463.4 0.05 58.6 -14.2 102.9 EGUN C-130 34 1439.3 42.3 38.7 0.5 127.3 126.8 32.1 1028.5...0.05 10.8 31.6 53.1 EGUN C-141 28 1098.6 39.2 20.2 0.8 170.5 169.7 43.9 1925.2 0.05 16.3 23.0 55.5 EGUN C-17 22 1016.5 46.2 30.0 0.3 198.5 198.2 52.1

Physicians' use of plasma methylmalonic acid as a diagnostic tool

DEFF Research Database (Denmark)

Hvas, A M; Vestergaard, H; Gerdes, Lars Ulrik

2000-01-01

with a plasma methylmalonic acid measurement above the reference interval. Information on diagnostic decisions was available for 177 patients. MAIN OUTCOME MEASURES: Reasons for requesting plasma methylmalonic acid and the reactions to the finding of elevated plasma methylmalonic acid. RESULTS: An explicit......OBJECTIVES: To investigate physicians' reasons for requesting plasma methylmalonic acid and their reactions to an increased concentration of plasma methylmalonic acid. DESIGN: Study of medical records. SETTING: Three somatic district hospitals in Denmark. SUBJECTS: Medical records of 198 patients...... reason for requesting plasma methylmalonic acid was stated in 57% of 198 examined medical records, known or suspected anaemia being the most frequent reason. No further action was taken in 109 (62%) of the 177 cases available for follow-up. Amongst the remaining 68 patients, the finding of an increased...

Preventing Catastrophe: U.S. Policy Options for the Management of Nuclear Weapons in South Asia

National Research Council Canada - National Science Library

Wojtyaiak, Martin

2001-01-01

The "peaceful nuclear explosion" of an Indian device in 1974 was a watershed event that called upon the U,S to focus its nonproliferation policy in South Asia, During the mid-198Os, Pakistan developed...

Germination responses of diploid Butomus umbellatus to light, temperature and flooding

Czech Academy of Sciences Publication Activity Database

Hroudová, Zdenka; Zákravský, Petr

2003-01-01

Roč. 198, - (2003), s. 37-44 ISSN 0367-2530 R&D Projects: GA AV ČR KSK6005114 Keywords : emergent macrophytes * sexual reproduction * seeds Subject RIV: EF - Botanics Impact factor: 0.882, year: 2003

Kunstivaldkonna tähtsus : seos avalike eesmärkidega / Alberta Arthurs, Frank Hodsoll ; tõlk. Johanna Ross

Index Scriptorium Estoniae

Arthurs, Alberta

2008-01-01

Originaali pealkiri: The importance of the arts sector : how it relates to the public purpose // The Journal of Arts Management, Law and Society. Vol. 28, nr. 2, lk. 102-108. Lühidalt autoritest lk. 198

Search Results | Page 3 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 21 - 30 of 198 ... Home · Project; Food, Environment, and Health .... Reducing dietary related risks associated with non-communicable diseases in Bangladesh ... The most direct and effective method for reducing tobacco consumption is ...

Factors Associated with Unmet Need for Modern Contraception in ...

African Journals Online (AJOL)

AJRH Managing Editor

Study Design. Data for this study .... design based on sampling participants from selected venues. .... Number mentioned**. Injectable / Depo-Provera. 21. Implant. 1. Pill. 38. Male condom. 198 ..... Surveys and ORC Macro, 2006. 25. Gallo MF ...

Structural Studies of Lipid A from a Lipopolysaccharide of the Coxiella burnetii isolate RSA 514 (Crazy)

Czech Academy of Sciences Publication Activity Database

Vadovič, P.; Fuleová, A.; Ihnatko, R.; Škultéty, L.; Halada, Petr; Toman, R.

2009-01-01

Roč. 15, č. 2 (2009), s. 198-199 ISSN 1198-743X Institutional research plan: CEZ:AV0Z50200510 Keywords : lipid * lipopolysaccharide * crazy Subject RIV: EE - Microbiology, Virology Impact factor: 4.014, year: 2009

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

Gender, vulnerability, and violence in urban Pakistan | IDRC ...

International Development Research Centre (IDRC) Digital Library (Canada)

2016-09-30

Sep 30, 2016 ... SERIES: IMPACT STORIES | SAFE AND INCLUSIVE CITIES ... and violence in urban Pakistan (PDF, 198KB) and about the Safe and Inclusive Cities initiative. ... Economic growth is driving population growth in Indian cities, ...

杨梅叶水溶性提取物的抗氧化、抗菌活性与防腐应用

Czech Academy of Sciences Publication Activity Database

君酸, 杨.; 云酸, 朱.; 清酸, 吴.; 洁酸, 尹.; Langhansová, Lenka; Vaněk, Tomáš; 生酸, 高.

2014-01-01

Roč. 28, č. 2 (2014), s. 198-202 ISSN 1006-2513 Institutional support: RVO:61389030 Keywords : Myrica rubra leaf * antioxidation * antisepsis Subject RIV: EF - Botanics http://d.g.wanfangdata.com.cn/Periodical_zgsptjj201402029.aspx

Magnetic properties of ion beam mixed and annealed Ag/Fe/Ag-(001)-layers

Czech Academy of Sciences Publication Activity Database

Kurowski, D.; Brand, K.; Pelzl, J.; Frait, Zdeněk

198/199, - (1999), s. 360-362 ISSN 0304-8853. [MML`98. Vancouver, 00.00.1998] Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.195, year: 1999

Long-lasting imprint of former glassworks on vegetation pattern in an extremely species-rich grassland: A battle of species pools on mesic soils

Czech Academy of Sciences Publication Activity Database

Hájek, M.; Dresler, P.; Hájková, Petra; Hettenbergerová, E.; Milo, P.; Plesková, Z.; Pavonič, M.

2017-01-01

Roč. 20, č. 7 (2017), s. 1233-1249 ISSN 1432-9840 Institutional support: RVO:67985939 Keywords : biodiversity * phosphorus * soil magnetims * archaeology Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.198, year: 2016

The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor

Czech Academy of Sciences Publication Activity Database

Boubakri, H.; Seghezzi, N.; Duchateau, M.; Gominet, M.; Kofroňová, Olga; Benada, Oldřich; Mazodier, P.; Pernodet, J.-L.

2015-01-01

Roč. 197, č. 21 (2015), s. 3388-3399 ISSN 0021-9193 Institutional support: RVO:61388971 Keywords : PROTEASOMAL ATPASE HOMOLOG * MYCOBACTERIUM-TUBERCULOSIS * 20S PROTEASOME Subject RIV: EE - Microbiology, Virology Impact factor: 3.198, year: 2015

Nové velké laserové projekty Evropské unie v ČR

Czech Academy of Sciences Publication Activity Database

Rohlena, Karel

2010-01-01

Roč. 60, č. 4 (2010), 197-198 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10100523 Keywords : diode pumped solid state lasers * repetative regime * high average power Subject RIV: BH - Optics, Masers, Lasers

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science; Volume 34; Issue 4 ... has a dielectric anomaly of ferroelectric to paraelectric type at 198°C, and exhibits ... that the compound has negative temperature coefficient of resistance (NTCR) behaviour.

Toxic effects, bioconcentration and depuration of verapamil in the early life stages of common carp (Cyprinus carpio L.)

Czech Academy of Sciences Publication Activity Database

Steinbach, C.; Fedorova, G.; Prokeš, Miroslav; Grabicová, K.; Máchová, J.; Grabic, R.; Valentová, O.; Kocour Kroupová, H.

461-462, 461-462 (2013), s. 198-206 ISSN 0048-9697 Institutional support: RVO:68081766 Keywords : Bioconcentration * Embryo-larval test * Half-life time * Heart rate * Verapamil Subject RIV: GL - Fishing Impact factor: 3.163, year: 2013

SU-F-T-198: Dosimetric Comparison of Carbon and Proton Radiotherapy for Recurrent Nasopharynx Carcinoma

Energy Technology Data Exchange (ETDEWEB)

Sheng, Y; Zhao, J; Wang, W; Lin, L; Liu, X; Shahnazi, K [Shanghai Proton and Heavy Ion Center, Shanghai (China)

2016-06-15

Purpose: Various radiotherapy planning methods for locally recurrent nasopharynx carcinoma (R-NPC) have been proposed. The purpose of this study was to compare carbon and proton therapy for the treatment of R-NPC in terms of dose coverage for target volume and sparing for organs at risk (OARs). Methods: Six patients who were suffering from R-NPC and treated using carbon therapy were selected for this study. Treatment plans with a total dose of 57.5Gy (RBE) in 23 fractions were made using SIEMENS Syngo V11. An intensity-modulated radiotherapy optimization method was chosen for carbon plans (IMCT) while for proton plans both intensity-modulated radiotherapy (IMPT) and single beam optimization (proton-SBO) methods were chosen. Dose distributions, dose volume parameters, and selected dosimetric indices for target volumes and OARs were compared for all treatment plans. Results: All plans provided comparable PTV coverage. The volume covered by 95% of the prescribed dose was comparable for all three plans. The average values were 96.11%, 96.24% and 96.11% for IMCT, IMPT, and proton-SBO respectively. A significant reduction of the 80% and 50% dose volumes were observed for the IMCT plans compared to the IMPT and proton-SBO plans. Critical organs lateral to the target such as brain stem and spinal cord were better spared by IMPT than by proton-SBO, while IMCT spared those organs best. For organs in the beam path, such as parotid glands, the mean dose results were similar for all three plans. Conclusion: Carbon plans yielded better dose conformity than proton plans. They provided similar or better target coverage while significantly lowering the dose for normal tissues. Dose sparing for critical organs in IMPT plans was better than proton-SBO, however, IMPT is known to be more sensitive to range uncertainties. For proton plans it is essential to find a balance between the two optimization methods.

198 “Viviendas dinámicas sin deuda” en Valdivia, X Región, Chile

OpenAIRE

Bonet Miró, Ana; Brunelli, Luca

2007-01-01

The purpose of the competition as well as the project developed in response to the social, constructive and climate specific conditions of Valdivia, X Region, Chile, is the design and construction of experimental social housing, whose cost, including land and services, would not exceed 7,500 $ per unit. The housing units should be designed in order to grow and to be adapted by owners and should allow for achieving higher urban density as average so to reduce the burden of costs derived from l...

How do 10-camphorsulfonic acid, silver or aluminum nanoparticles influence optical, electrochemical, electrochromic and photovoltaic properties of air and thermally stable triphenylamine-based polyazomethine with carbazole moieties?

Czech Academy of Sciences Publication Activity Database

Ivan, A.; Boharewicz, B.; Tazbir, I.; Filapek, M.; Korona, P.K.; Wróbel, Piotr; Stefaniuk, T.; Ciesielski, A.; Wojtkiewicz, J.; Wronkowska, A.A.; Wronkowski, A.; Zboromirska-Wnukiewicz, B.; Grankowska-Ciechanowicz, S.; Kaminska, M.; Szoplik, T.

2015-01-01

Roč. 185, December (2015), s. 198-210 ISSN 0013-4686 Institutional support: RVO:67985882 Keywords : refraction index * nanoparticles * bulk heterojunction polymer solar cells Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 4.803, year: 2015

The HP 9825 A program for the determination of an isotope half-life

International Nuclear Information System (INIS)

Jujuratisbela, Uju.

1980-01-01

Determination of half life of gold 198, indium 116, manganese 56, copper 64 are presented, using least squares method in HP 9825 A. This method is more accurate and needs less time than graphic method. (author tr.)

Temperature Dependence of the Stability of Ion Pair Interactions ...

Indian Academy of Sciences (India)

The occurrence of bridging water molecules between the ions ensures that the ions are not ... The structural features that render this thermostability ..... dehydrogenase single site mutant T198I from Thermus thermophilus with PDB ID 1BDM.

Dicty_cDB: Contig-U13873-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available hora medicaginis isolate P... 203 e-100 EU080374_1( EU080374 |pid:none) Phytophthora cuy... hibernalis isolate PD... 198 e-100 EU080354_1( EU080354 |pid:none) Phytophthora cuyabensis isolate PD... 19

Stálé prezentace výsledků archeologických výzkumů v Žatci

Czech Academy of Sciences Publication Activity Database

Čech, Petr

2010-01-01

Roč. 70, č. 3 (2010), s. 198-200,232,234 ISSN 1210-5538 Institutional research plan: CEZ:AV0Z80020508 Keywords : church architecture * floor plans in pavement * in situ Subject RIV: AC - Archeology, Anthropology, Ethnology

Search Results | Page 9 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 81 - 90 of 198 ... This trend is expected to continue and intensify in developing ... Evaluating New Chilean National Regulations on the Food Supply ... Argentina is one of the world's highest consumers of sugar-sweetened beverages ...

Big Rock Point Nuclear Plant. Semiannual operations report No. 22, January--June 1975

International Nuclear Information System (INIS)

1975-01-01

Net electrical power generated was 50,198.2 MWH(e) with the reactor on line 922.6 hrs. Information is presented concerning power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, and abnormal occurrences. (FS)

Annual report 1986 Interfacultary Reactor Institute

International Nuclear Information System (INIS)

1987-01-01

In this annual report of the Dutch Interfacultary Reactor Institute, summary- and detailed reports are presented of Current research during 198? of the departments radiochemistry, radiation chemistry, radiation physics, and reactor physics. (H.W.). refs.; figs.; tabs

Cortical and limbic excitability in rats with absence epilepsy

Czech Academy of Sciences Publication Activity Database

Tolmacheva, Elena A.; van Luijtelaar, G.; Chepurnov, S. A.; Kaminskij, Julij; Mareš, Pavel

2004-01-01

Roč. 62, č. 2-3 (2004), s. 189-198 ISSN 0920-1211 Institutional research plan: CEZ:AV0Z5011922 Keywords : excitability * cortex * rats WAG/Rij Subject RIV: FH - Neurology Impact factor: 2.897, year: 2004

Browse Title Index

African Journals Online (AJOL)

Items 101 - 150 of 198 ... ... seminar on health of Afro-descendant populations, Salvador, Brazil, Abstract ... H El-Sayed, O Zekry, H Abbas, SA Hamid, A Hyder ... in a global quest or an experiment in "Empowered deliberative democracy"?

Neutron structures of the Helicobacter pylori 5'-methylthioadenosine nucleosidase highlight proton sharing and protonation states

Energy Technology Data Exchange (ETDEWEB)

Banco, Michael T.; Mishra, Vidhi; Ostermann, Andreas; Schrader, Tobias E.; Evans, Gary B.; Kovalevsky, Andrey; Ronning, Donald R.

2016-11-16

MTAN (5'-methylthioadenosine nucleosidase) catalyzes the hydrolysis of the N-ribosidic bond of a variety of adenosine-containing metabolites. The Helicobacter pylori MTAN (HpMTAN) hydrolyzes 6-amino-6-deoxyfutalosine in the second step of the alternative menaquinone biosynthetic pathway. Substrate binding of the adenine moiety is mediated almost exclusively by hydrogen bonds, and the proposed catalytic mechanism requires multiple proton-transfer events. Of particular interest is the protonation state of residue D198, which possesses a pKa above 8 and functions as a general acid to initiate the enzymatic reaction. In this study we present three corefined neutron/X-ray crystal structures of wild-type HpMTAN cocrystallized with S-adenosylhomocysteine (SAH), Formycin A (FMA), and (3R,4S)-4-(4-Chlorophenylthiomethyl)-1-[(9-deaza-adenin-9-yl)methyl]-3-hydroxypyrrolidine (p-ClPh-Thio-DADMe-ImmA) as well as one neutron/X-ray crystal structure of an inactive variant (HpMTAN-D198N) cocrystallized with SAH. These results support a mechanism of D198 pKa elevation through the unexpected sharing of a proton with atom N7 of the adenine moiety possessing unconventional hydrogen-bond geometry. Additionally, the neutron structures also highlight active site features that promote the stabilization of the transition state and slight variations in these interactions that result in 100-fold difference in binding affinities between the DADMe-ImmA and ImmA analogs.

Measurement of thermal neutron cross-section and resonance integral for the 165Ho(n,γ) 166gHo reaction using electron linac-based neutron source

Science.gov (United States)

Nguyen, Van Do; Pham, Duc Khue; Kim, Tien Thanh; Kim, Guinyun; Lee, Manwoo; Kim, Kyung Sook; Kang, Heung-Sik; Cho, Moo-Hyun; Ko, In Soo; Namkung, Won

2011-01-01

The thermal neutron cross-section and the resonance integral of the 165Ho(n,γ) 166gHo reaction have been measured by the activation method using a 197Au(n,γ) 198Au monitor reaction as a single comparator. The high-purity natural Ho and Au foils with and without a cadmium shield case of 0.5 mm thickness were irradiated in a neutron field of the Pohang neutron facility. The induced activities in the activated foils were measured with a calibrated p-type high-purity Ge detector. The correction factors for the γ-ray attenuation ( Fg), the thermal neutron self-shielding ( Gth), the resonance neutron self-shielding ( Gepi) effects, and the epithermal neutron spectrum shape factor ( α) were taken into account. The thermal neutron cross-section for the 165Ho(n,γ) 166gHo reaction has been determined to be 59.7 ± 2.5 barn, relative to the reference value of 98.65 ± 0.09 barn for the 197Au(n,γ) 198Au reaction. By assuming the cadmium cut-off energy of 0.55 eV, the resonance integral for the 165Ho(n,γ) 166gHo reaction is 671 ± 47 barn, which is determined relative to the reference value of 1550 ± 28 barn for the 197Au(n,γ) 198Au reaction. The present results are, in general, good agreement with most of the previously reported data within uncertainty limits.

Nigerian dental technology students and human immunodeficiency virus infection: knowledge, misconceptions and willingness to care.

Science.gov (United States)

Azodo, Cc; Omili, Ma; Akeredolu, Pa

2014-05-01

The rehabilitative dental care is important for maintaining adequate nutrition, guarding against wasting syndrome and malnutrition among human immunodeficiency virus (HIV)-infected individuals. The aim of this study is to determine the Nigerian dental technology students' knowledge and misconceptions about HIV infection and their willingness to care for HIV-infected patients. This descriptive cross-sectional study of dental technology students of Federal School of Dental Therapy and Technology Enugu, Nigeria was conducted in 2010. Data was subjected to descriptive, non-parametric and parametric statistics using the statistical package for the social sciences (SPSS) version 17.0 (Chicago Illinois, USA). P 4.0% (8/198) of the respondents erroneous described HIV as harmless, self-limitation and antibiotics responsive infection respectively. Of the respondents, 78.8% (156/198) and 83.3% (165/198) of them expressed willingness to care for HIV-infected patients and expressed need for training in the clinical care of HIV-infected patients respectively. Overall, the respondents opined that the dental therapists are the most suitable dental professional to pass HIV-related information to patients in the dental setting ahead of dentists and dental surgery assistants. The expressed willingness to care for HIV-infected patients, knowledge about the mode of HIV transmission and prevention among the respondents were high with existent misconceptions. There were no significant differences in the knowledge about HIV infection and willingness to care for HIV-infected patients among respondents in the lower class and those in upper class.

Dissolution kinetics of Pd and Pt from automobile catalysts by naturally occurring complexing agents

Czech Academy of Sciences Publication Activity Database

Šebek, O.; Mihaljevič, M.; Strnad, L.; Ettler, V.; Ježek, J.; Štědrý, R.; Drahota, P.; Ackerman, Lukáš; Adamec, V.

2011-01-01

Roč. 198, December (2011), s. 331-339 ISSN 0304-3894 Institutional research plan: CEZ:AV0Z30130516 Keywords : automobile catalyst * Platinum group elements * mobilisation * leaching * kinetic Subject RIV: DD - Geochemistry Impact factor: 4.173, year: 2011

Radiation protection in brachytherapy

International Nuclear Information System (INIS)

Benitez, Manuel

1996-02-01

It covers technical procedures in medical applications for cancer treatment. Radiation protection principles in brachytherapy. Medical uses in therapy for Sr-90, Cs-137, Co-60, Ra-226, Ir-192, Au-198, Bi-214, Pb-214. (The author)

Neural Network Based Reactive Navigation for Mobile Robot in Dynamic Environment

Czech Academy of Sciences Publication Activity Database

Krejsa, Jiří; Věchet, S.; Ripel, T.

2013-01-01

Roč. 198, č. 2013 (2013), s. 108-113 ISSN 1012-0394 Institutional research plan: CEZ:AV0Z20760514 Institutional support: RVO:61388998 Keywords : mobile robot * reactive navigation * artificial neural networks Subject RIV: JD - Computer Applications, Robotics

Browse Title Index

African Journals Online (AJOL)

Items 1 - 50 of 198 ... African Safety Promotion: A Journal of Injury and Violence Prevention. ... for domestic violence management and prevention in Emergency Care, Abstract PDF ... E de Beer, K Groenewald, S Nkosi, E van Niekerk, L Vermaak.

Inflation convergence within the European Union: a panel data analysis

Czech Academy of Sciences Publication Activity Database

Kočenda, Evžen; Papell, D. H.

1997-01-01

Roč. 2, č. 3 (1997), s. 189-198 ISSN 1076-9307 Keywords : inflation convergence * European Union * panel data Subject RIV: AH - Economics http://search.ebscohost.com/login.aspx?direct=true&db=bth&AN=16616418&site=ehost-live

Is the motivation to become a teacher related to pre-service teachers' intentions to remain in the profession?

NARCIS (Netherlands)

Bruinsma, Marjon; Jansen, Ellen P. W. A.

2010-01-01

This study investigated 198 pre-service teachers' intrinsic and extrinsic motivation for becoming teachers and focused on the distinction between adaptive motives, which promote lasting and effective engagement, and maladaptive motives, which promote superficial engagement. We examined the

On the nature of unusual intensity changes in the infrared spectra of the enflurane ... acetone complexes

Czech Academy of Sciences Publication Activity Database

Zierkiewicz, W.; Zalesny, R.; Hobza, Pavel

2013-01-01

Roč. 15, č. 16 (2013), s. 6001-6007 ISSN 1463-9076 Institutional support: RVO:61388963 Keywords : shifting hydrogen-bonds * center-dot-o * molecular-orbital methods Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.198, year: 2013

AcEST: DK956079 [AcEST

Lifescience Database Archive (English)

Full Text Available ia ivanovii GN=iap PE=3... 38 0.020 sp|Q9P403|CIH1_COLLN Intracellular hyphae pro...L++ Sbjct: 198 YTVKSGDTIWALSSKYGTSVQNIMSWNNLSSSSIYVGQVLAV 239 >sp|Q9P403|CIH1_COLLN Intracellular hyphae

Isotopic Tracing of Thallium Contamination in Soils Affected by Emissions from Coal-Fired Power Plants

Czech Academy of Sciences Publication Activity Database

Vaněk, A.; Grösslová, Z.; Mihaljevič, M.; Trubač, J.; Ettler, V.; Teper, L.; Cabala, J.; Rohovec, Jan; Zádorová, T.; Penížek, V.; Pavlů, L.; Holubík, O.; Němeček, K.; Houška, J.; Drábek, O.; Ash, C.

2016-01-01

Roč. 50, č. 18 (2016), s. 9864-9871 ISSN 0013-936X Institutional support: RVO:67985831 Keywords : environmental implications * isotope * fractionation * combustion * utility * health * oxides * silver * lead Subject RIV: DD - Geochemistry Impact factor: 6.198, year: 2016

Evaluation of an Implementation Model : A National Investigation of VA Residential Programs

NARCIS (Netherlands)

Cook, Joan M.; Dinnen, Stephanie; Coyne, James C.; Thompson, Richard; Simiola, Vanessa; Ruzek, Josef; Schnurr, Paula P.

This national investigation utilizes qualitative data to evaluate an implementation model regarding factors influencing provider use of two evidence-based treatments for posttraumatic stress disorder (PTSD). Semi-structured qualitative interviews with 198 mental health providers from 38 Department

Morphological and functional diversity of minor ampullate glands in spiders from the superfamily Amaurobioidea (Entelegynae: RTA clade)

Czech Academy of Sciences Publication Activity Database

Řezáč, M.; Krejčí, T.; Goodacre, S.L.; Haddad, C. R.; Řezáčová, Veronika

2017-01-01

Roč. 45, č. 2 (2017), s. 198-208 ISSN 0161-8202 Institutional support: RVO:61388971 Keywords : Cribellate capturing threads * major ampullate * silk glands Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 0.988, year: 2016

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

Book Reviews Megaherbivores: the influence of very large body size ...

African Journals Online (AJOL)

437 pp. Price: OM 198,00. Scholars in the field of soil zoology will welcome this book. .... ontogenetic processes shape and constrain a particular vocal signal draws ... the structure of calls and, therewith, the perceptual capabilities of recipients.

Quantifying intrinsic quality of commercial varieties of Basmati rice

International Nuclear Information System (INIS)

Sagar, M.A.; Salim, M.; Siddiqui, H.

2003-01-01

Twelve quality-trait of five commercial varieties of Basmati rice viz: Basmati 370, Basmati 385, Basmati 198, Basmati 6129 and Super Basmati, were determined according to standard methods. Under existing conditions, it is very difficult to assess overall quality of Basmati rice-varieties, because if a variety is superior in one quality trait, it is inferior in another quality trait, to some other Basmati rice variety, which creates confusion. In order to determine the overall quality-status, we have made an effort to quantify the various quality-traits. Each quality-trait has been allotted a score, in terms of its importance, and the overall status of each variety is computed. Based on our estimation, Super Basmati is of highest quality (98.21%), followed by Basmati 6129 (96.46%), Basmati 370 (95.59%), Basmati 385 (95.26%) and Basmati 198 (92.95%). (author)

Variation of Optical Quenching of Photoconductivity with Resistivity in Unintentional Doped GaN

International Nuclear Information System (INIS)

Qi-Feng, Hou; Xiao-Liang, Wang; Hong-Ling, Xiao; Cui-Mei, Wang; Cui-Bai, Yang; Jin-Min, Li

2010-01-01

The optical quenching of photoconductivity under dual illumination in GaN samples with different resistivity is investigated to reveal the variation of deep levels. The samples are grown by metal organic chemical vapour deposition without intentional doping. Quenching bands centered at 1.35eV, 1.55eV, 1.98eV, and 2.60eV are observed. It is found that the 1.98eV quenching band is dominated in all the samples and the 2.60eV band is observed only in the high-resistivity samples. The possible defect levels responsible for the quenching bands and the origin of different quenching behaviour at 2.60eV are discussed. It is suggested that the defect level responsible for quenching at 2.60eV plays an important role for the enhancement of resistivity

Alternative strategy for converting an inverting glycoside hydrolase into a glycosynthase.

Science.gov (United States)

Honda, Yuji; Fushinobu, Shinya; Hidaka, Masafumi; Wakagi, Takayoshi; Shoun, Hirofumi; Taniguchi, Hajime; Kitaoka, Motomitsu

2008-04-01

The tyrosine residue Y198 is known to support a nucleophilic water molecule with the general base residue, D263, in the reducing-end xylose-releasing exo-oligoxylanase (Rex). A mutation in the tyrosine residue changing it into phenylalanine caused a drastic decrease in the hydrolytic activity and a small increase in the F(-) releasing activity from alpha-xylobiosyl fluoride in the presence of xylose. In contrast, mutations at D263 resulted in the decreased F(-) releasing activity. As a result of the high F(-) releasing activity and low hydrolytic activity, Y198F of Rex accumulates a large amount of product during the glycosynthase reaction. We propose a novel method for producing a glycosynthase from an inverting glycoside hydrolase by mutating a residue that holds the nucleophilic water molecule with the general base residue while keeping the general base residue intact.

Molecular characterization of a heterothallic mating system in .i.Pseudogymnoascus destructans./i., the fungus causing white-nose syndrome of bats

Czech Academy of Sciences Publication Activity Database

Palmer, J.M.; Kubátová, A.; Nováková, Alena; Minnis, A.M.; Kolařík, M.; Lindner, D.L.

2014-01-01

Roč. 4, č. 9 (2014), s. 1755-1763 ISSN 2160-1836 Institutional support: RVO:60077344 Keywords : Genetics of Sex * geomyces * mating type * sexual reproduction * white-nose syndrome Subject RIV: EE - Microbiology, Virology Impact factor: 3.198, year: 2014

Human adipose tissue-derived mesenchymal stem cells expressing yeast cytosinedeaminase::uracil phosphoribosyltransferase inhibit intracerebral rat glioblastoma

Czech Academy of Sciences Publication Activity Database

Altanerova, V.; Cihova, M.; Babič, Michal; Rychly, B.; Ondicova, K.; Mravec, B.; Altaner, C.

2012-01-01

Roč. 130, č. 10 (2012), s. 2455-2463 ISSN 0020-7136 Institutional research plan: CEZ:AV0Z40500505 Keywords : glioblastoma * mesenchymal stem cells * suicide gene therapy Subject RIV: CD - Macromolecular Chemistry Impact factor: 6.198, year: 2012

Investigation of the Transcriptome of Prairie Cord Grass, a New Cellulosic Biomass Crop

KAUST Repository

Gedye, Kristene; Gonzalez-Hernandez, Jose; Ban, Yuguang; Ge, Xijin; Thimmapuram, Jyothi; Sun, Fengjie; Wright, Chris; Ali, Shahjahan; Boe, Arvid; Owens, Vance

2010-01-01

in this paper describes the first investigation of the transcriptome of prairie cordgrass via Next Generation Sequencing Technology, 454 GS FLX. A total of 556,198 expressed sequence tags (ESTs) were produced from four prairie cordgrass tissues: roots, rhizomes

Dvě poznámky : O provokativní výstavě I.N.R.I.; O smrti Mohamedově v středověkých pramenech

Czech Academy of Sciences Publication Activity Database

Spunar, Pavel

2001-01-01

Roč. 9, č. 2 (2001), s. 197-198 ISSN 1210-3640 Institutional research plan: CEZ:AV0Z9062906 Keywords : commentar on exhibition "I.N.R.I." and on middleage text about Mohammed Subject RIV: AA - Philosophy ; Religion

Selectivity of Nanocrystalline IrO2-Based Catalysts in Parallel Chlorine and Oxygen Evolution

Czech Academy of Sciences Publication Activity Database

Kuznetsova, Elizaveta; Petrykin, Valery; Sunde, S.; Krtil, Petr

2015-01-01

Roč. 6, č. 2 (2015), s. 198-210 ISSN 1868-2529 EU Projects: European Commission(XE) 214936 Institutional support: RVO:61388955 Keywords : iridium dioxide * oxygen evolution * chlorine evolution Subject RIV: CG - Electrochemistry Impact factor: 2.347, year: 2015

Validation of an abbreviated Vitalpac™ Early Warning Score (ViEWS) in 75,419 consecutive admissions to a Canadian regional hospital.

LENUS (Irish Health Repository)

Kellett, John

2012-03-01

The early warning score derived from 198,755 vital sign sets in the Vitalpac™ database (ViEWS) has an area under the receiver operator characteristic curve (AUROC) for death of acute unselected medical patients within 24h of 88%.

Water relations in Norway spruce trees growing at ambient and elevated CO2 concentrations

Czech Academy of Sciences Publication Activity Database

Kupper, P.; Sellin, A.; Klimánková, Zdeňka; Pokorný, Radek; Puértolas, J.

2006-01-01

Roč. 50, č. 4 (2006), s. 603-609 ISSN 0006-3134 Institutional research plan: CEZ:AV0Z60870520 Keywords : global change * sap flux * shoot water potential Subject RIV: EH - Ecology, Behaviour Impact factor: 1.198, year: 2006

Martinez-Romero et al., Afr J Tradit Complement Altern Med. (2016 ...

African Journals Online (AJOL)

acer

198 ... Conclusion: It was possible to know and discuss the variety of applications of the Neem tree, including the bark, leaves, fruit, flowers, and roots, each with very favorable ... antifungal, dermatological, and dental agent. This oil has been ...

ORIGINAL ARTICLE 230

African Journals Online (AJOL)

boaz

from lysed red blood cells leak into the urine. ... In most severe cases of the disease fatality rates can ... pregnancy by testing negative to a blood pregnancy ..... hygiene, 94(3), pp.195-198. 22. World Health Organisation, 2004. Integrated.

The growth, structured and optics of CsI-PbI.sub.2./sub. co-evaporated thin films

Czech Academy of Sciences Publication Activity Database

Somma, F.; Nikl, Martin; Nitsch, Karel; Giampaolo, C.; Phani, A. R.; Santucci, S.

2000-01-01

Roč. 373, - (2000), s. 195-198 ISSN 0040-6090 R&D Projects: GA MŠk ME 059 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.160, year: 2000

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 198 ... Vol 2, No 1 (2004), Design and Implementation of Child Injury ... bullying in the playground: Football and gender 'policing' at school, Abstract PDF ... for sexual- and genderbased violence research and prevention in South ...

Materialistic Thinking and Its Mental-Hygienic Implications among Students of Budapest Business School

Science.gov (United States)

Gombás, Judit

2015-01-01

Previous research with extrinsic ("materialistic") and intrinsic ("non-materialistic") life goals suggest that intrinsic aspirations (e.g. relationships, community service, personal development) are associated with a better functioning, mentally and physically more healthy personality. In this survey 198 undergraduate students…

Petrogenesis of orogenic lamproites of the Bohemian Massif: Sr-Nd-Pb-Li isotope constraints for Variscan enrichment of ultra-depleted mantle domains

Czech Academy of Sciences Publication Activity Database

Krmíček, Lukáš; Romer, R. L.; Ulrych, Jaromír; Glodny, J.; Prelevič, D.

2016-01-01

Roč. 35, 1 July (2016), s. 198-216 ISSN 1342-937X Institutional support: RVO:67985831 Keywords : Silica-rich lamproites * Sr-Nb-Pb-Li isotopes * mantle metasomatism * Variscides Subject RIV: DB - Geology ; Mineralogy Impact factor: 6.959, year: 2016

Dicty_cDB: Contig-U11810-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available otein; Short=MT... 78 8e-13 S55598( S55598 ) tegument protein 03 - equine herpesv...( S55669 ) tegument protein 75 - equine herpesvirus 2 &U208... 61 1e-07 AE009950_198( AE009950 |pid:none) Py

Role of phytohormones in organogenic ability of elm multiplicated shoots

Czech Academy of Sciences Publication Activity Database

Malá, J.; Gaudinová, Alena; Dobrev, Petre; Eder, Josef; Cvikrová, Milena

2006-01-01

Roč. 50, č. 1 (2006), s. 8-14 ISSN 0006-3134 Institutional research plan: CEZ:AV0Z5038910; CEZ:AV0Z50380511 Keywords : auxin * cytokinins * multiplication of elm Subject RIV: GK - Forestry Impact factor: 1.198, year: 2006

Temperature and face dependent copper–graphene interactions

Czech Academy of Sciences Publication Activity Database

da Costa e Silva, S.; Ek Weis, Johan; Frank, Otakar; Kalbáč, Martin

2015-01-01

Roč. 93, NOV 2015 (2015), s. 793-799 ISSN 0008-6223 R&D Projects: GA MŠk LL1301 Institutional support: RVO:61388955 Keywords : graphene * charge transfer * copper Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.198, year: 2015

Antibacterial activity of three Cameroonian honey types against ...

African Journals Online (AJOL)

reported treated using honey (Anna et al.,. 2015). It has been used for dressing wounds. (burns, surgical wounds, and skin ulcers) probably ... moreover bacterial resistance to it is yet to be .... In most cases ..... Burns Fire Disasters, 14: 198-201.

a survey of ecto and intestinal parasites of tilapia zillii

African Journals Online (AJOL)

DR. AMINU

6.1%), and Protozoa Cyst 198 (11.0%). Adult fishes were more infected than the juvenile, females were significantly more infected (P <0.05). Infection increases with length and body weight. Physio-chemical parameter of the lake was good and.

Fulltext PDF

Indian Academy of Sciences (India)

2018-02-02

Feb 2, 2018 ... electrode system. Based on chronopotentiometry, CNFs exhibited the highest capacity up to 198 F g ... sumer electronics, portable systems, memory back-up sys- tems, etc. Of late .... working voltage = 12 kV, feed rate = 0.5 ml ...

The impact of HLA matching on long-term transplant outcome after allogeneic hematopoietic stem cell transplantation for CLL: a retrospective study from the EBMT registry.

NARCIS (Netherlands)

Michallet, M.; Sobh, M.; Milligan, D.; Morisset, S.; Niederwieser, D.; Koza, V.; Ruutu, T.; Russell, N.H.; Verdonck, L.; Dhedin, N.; Vitek, A.; Boogaerts, M.; Vindelov, L.; Finke, J.; Dubois, V.; Biezen, A. van; Brand, R.; Witte, T.J.M. de; Dreger, P.

2010-01-01

We analyzed 368 chronic lymphocytic leukemia patients who underwent allogeneic hematopoietic stem cell transplantation reported to the EBMT registry between 1995 and 2007. There were 198 human leukocyte antigen (HLA)-identical siblings; among unrelated transplants, 31 were well matched in high

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 198 ... Issue, Title ... Vol 13, No 1 (2015), Biometric Enhancement of Home and Office Security to Reduce Assassinations in Nigeria, Abstract PDF ... Vol 9, No 1 (2013), Cloud Computing: Key to IT Development in West Africa ...

Cutaneous leishmaniasis with lymphadenopathy due to Leishmania donovani

Czech Academy of Sciences Publication Activity Database

Faber, W. R.; Wonders, J.; Jensema, A. J.; Chocholová, Eva; Kager, P. A.

2009-01-01

Roč. 34, č. 5 (2009), E196-E198 ISSN 0307-6938 Institutional research plan: CEZ:AV0Z60220518 Keywords : LYMPH -NODE INVOLVEMENT * BRAZILIENSIS * INFECTION Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.550, year: 2009

Search Results | Page 5 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 41 - 50 of 198 ... Obesity in South Africa is becoming a major public health issue for the country ... animals, Sri Lanka derives both risks and benefits from its wildlife. ... and outdoors, is a major worldwide health and environmental problem, ...

National Strategy for Combating Terrorism: Prospects and Implications

Science.gov (United States)

2003-12-01

their canine explosives detection programs. Customs increased searches of passengers, baggage, and cargo leaving the US. Finally, the ATF was...77 Bernard Lewis, “The Roots of Muslim Rage ,” in Kegley, 198-200. 78 Wilfred Thesiger, Arabian Sands (Green, UK

Rozvoj plastických deformací v oceli při konstantním zatížení a jejich význam pro plynárenskou praxi

Czech Academy of Sciences Publication Activity Database

Gajdoš, Lubomír; Šperl, Martin; Pařízek, P.

2013-01-01

Roč. 93, č. 9 (2013), s. 198-203 ISSN 0032-1761 R&D Projects: GA ČR(CZ) GAP105/10/2052 Institutional support: RVO:68378297 Keywords : low-temperature creep * deformation * pipe Subject RIV: JL - Materials Fatigue, Friction Mechanics

The Population Structure of African Cultivated Rice Oryza glaberrima (Steud.)

DEFF Research Database (Denmark)

Semon, Mande; Nielsen, Rasmus; Jones, Monty P.

2005-01-01

Genome-wide linkage disequilibrium (LD) was investigated for 198 accessions of Oryza glaberrima using 93 nuclear microsatellite markers. Significantly elevated levels of LD were detected, even among distantly located markers. Free recombination among loci at the population genetic level was shown...

Organizational Health and Higher Education: Concept and Measurement Scale Development.

Science.gov (United States)

Klingele, William E.; Lyden, Julie A.; Vaughan, Beverly J.

2001-01-01

A scale to measure higher education institutions' organizational health was developed and tested using 198 survey responses. Scale dimensions include communication adequacy, participation/involvement, commitment/loyalty, morale, external reputation, ethics, performance recognition, goal alignment, leadership, development, and resource use.…

Quantification of Gaseous Elemental Mercury Dry Deposition to Environmental Surfaces using Mercury Stable Isotopes in a Controlled Environment

Science.gov (United States)

Rutter, A. P.; Schauer, J. J.; Shafer, M. M.; Olson, M.; Robinson, M.; Vanderveer, P.; Creswell, J. E.; Parman, A.; Mallek, J.; Gorski, P.

2009-12-01

atmospheric turbulence and wind speed. GEM enriched in stable isotope 198 (GEM-198) was released into the room from source at elevated but environmentally relevant concentrations of GEM-198 for several days. Uptake of GEM-198 from deciduous and conifer trees, grass turf, 3 types of soil, sand, concrete, asphalt, and adsorbent coated deposition coupons were quantified over several days. Exposures were conducted between 10oC and 30oC, in dark and light conditions. Mercury was recovered from the samples using acidic digestions and surface leaches, and then analyzed for the content of GEM-198 by high resolution ICPMS. Experimental results demonstrated that uptake by White Ash, White Spruce, and Kentucky bluegrass were significantly higher than uptakes measured for two Wisconsin soils, peat, sand, concrete and asphalt at all of the conditions studied. Deposition resistances for surface transfer processes for were calculated for each of the substrates across the conditions studied for use in atmospheric model simulations.

Preparation and in vivo evaluation of radioiodinated closo-decaborate(2-) derivatives to identify structural components that provide low retention in tissues

International Nuclear Information System (INIS)

Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.

2010-01-01

Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.

Platinum stable isotope analysis of geological standard reference materials by double-spike MC-ICPMS.

Science.gov (United States)

Creech, J B; Baker, J A; Handler, M R; Bizzarro, M

2014-01-10

We report a method for the chemical purification of Pt from geological materials by ion-exchange chromatography for subsequent Pt stable isotope analysis by multiple-collector inductively coupled plasma mass spectrometry (MC-ICPMS) using a 196 Pt- 198 Pt double-spike to correct for instrumental mass bias. Double-spiking of samples was carried out prior to digestion and chemical separation to correct for any mass-dependent fractionation that may occur due to incomplete recovery of Pt. Samples were digested using a NiS fire assay method, which pre-concentrates Pt into a metallic bead that is readily dissolved in acid in preparation for anion-exchange chemistry. Pt was recovered from anion-exchange resin in concentrated HNO 3 acid after elution of matrix elements, including the other platinum group elements (PGE), in dilute HCl and HNO 3 acids. The separation method has been calibrated using a precious metal standard solution doped with a range of synthetic matrices and results in Pt yields of ≥90% with purity of ≥95%. Using this chemical separation technique, we have separated Pt from 11 international geological standard reference materials comprising of PGE ores, mantle rocks, igneous rocks and one sample from the Cretaceous-Paleogene boundary layer. Pt concentrations in these samples range from ca. 5 ng g -1 to 4 μg g -1 . This analytical method has been shown to have an external reproducibility on δ 198 Pt (permil difference in the 198 Pt/ 194 Pt ratio from the IRMM-010 standard) of ±0.040 (2 sd) on Pt solution standards (Creech et al., 2013, J. Anal. At. Spectrom. 28, 853-865). The reproducibility in natural samples is evaluated by processing multiple replicates of four standard reference materials, and is conservatively taken to be ca. ±0.088 (2 sd). Pt stable isotope data for the full set of reference materials have a range of δ 198 Pt values with offsets of up to 0.4‰ from the IRMM-010 standard, which are readily resolved with this technique. These

76 FR 12295 - James Luehman; Denial of Petition for Rulemaking

Science.gov (United States)

2011-03-07

... position due, in part, to that employee's having engaged in protected whistleblowing activities. Tennessee... unfavorable personnel action even in the absence of whistleblowing.'' \\3\\ Id. at 198. \\3\\ Ultimately, the... same personnel action anyway, regardless of the whistleblowing activity. The petitioner mistakenly...

76 FR 77887 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

Science.gov (United States)

2011-12-14

... mounted snow plow blade Service road rehabilitation Acquire aircraft rescue and firefighting fire suits..., Anchorage, AK 11/04/11 22,000,000 21,043,173 01/01/06 01/01/06 06-17-C-01-ORD, Chicago, IL 11/08/11 73,198...

15 CFR 922.191 - Definitions.

Science.gov (United States)

2010-01-01

... Sanctuary regulations. State Archaeologist means the State Archaeologist, Michigan Historical Center... decisions related to the Treaty. Underwater cultural resource means: (1) Any sunken watercraft, including a... underwater cultural resource by the Director pursuant to § 922.198. Underwater cultural resource also means...

Fulltext PDF

Indian Academy of Sciences (India)

IAS Admin

Resonance journal of science education. March 2014 Volume 19 Number 3. GENERALARTICLES. 198 John McCarthy – Father of Artificial Intelligence. V Rajaraman. 208 LISP. Harish Karnick. 222 Elementary? Question Answering, IBM's Watson, and the Jeopardy! Challenge. Raman Chandrasekar. 242 Cloud Computing.

77 FR 15966 - Ohio: Final Authorization of State Hazardous Waste Management Program Revision

Science.gov (United States)

2012-03-19

... Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA). ACTION: Final..., 1989 (54 FR 27170) to implement the RCRA hazardous waste management program. We granted authorization... Combustors; Final Rule, Checklist 198, February 14, 2002 (67 FR 6968); Hazardous Waste Management System...

76 FR 56708 - Ohio: Final Authorization of State Hazardous Waste Management Program Revision

Science.gov (United States)

2011-09-14

... Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA). ACTION: Proposed..., 1989 (54 FR 27170) to implement the RCRA hazardous waste management program. We granted authorization... December 7, 2004. Waste Combustors; Final Rule; Checklist 198. Hazardous Waste Management March 13, 2002...

Thermal treatment of fluorinated graphene: An in situ Raman spectroscopy study

Czech Academy of Sciences Publication Activity Database

da Costa, Sara; Ek Weis, Johan; Frank, Otakar; Bastl, Zdeněk; Kalbáč, Martin

2015-01-01

Roč. 84, č. 1 (2015), s. 347-354 ISSN 0008-6223 R&D Projects: GA ČR(CZ) GAP208/12/1062 Institutional support: RVO:61388955 Keywords : fluorine * graphene * monolayers Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.198, year: 2015

South African Journal of Clinical Nutrition - Vol 24, No 4 (2011)

African Journals Online (AJOL)

South African private practising clinical dietitians' perceptions of the relevance of service-specific healthcare marketing principles and communication elements · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. LM Hanekom, GJ Gericke, PJ Becker, 192-198.

Nedestruktivní hodnocení a monitorování ocelových a betonových stavebních konstrukcí

Czech Academy of Sciences Publication Activity Database

Převorovský, Zdeněk; Kober, Jan; Krofta, Josef; Chlada, Milan

2013-01-01

Roč. 23, 1-2 (2013), s. 24-29 ISSN 1213-3825 R&D Projects: GA MPO(CZ) FR-TI1/198 Institutional support: RVO:61388998 Keywords : structural health monitoring * civil structures * nonlinear elastic wave spectroscopy * acoustic emission Subject RIV: JN - Civil Engineering

Design guidelines for self-assessment support for adult academic distance learning

NARCIS (Netherlands)

Menendez Blanco, Maria; Van der Veer, Gerrit; Benvenuti, Laura; Kirschner, Paul A.

2011-01-01

Menendez Blanco, M., Van der Veer, G., Benvenuti, L., & Kirschner, P. A. (2011). Design guidelines for self-assessment support for adult academic distance learning. In H-J Shalin (Ed.), Constructing self-discovery learning spaces online: scaffolding and decision making technologies (pp. 169-198).

Trickle Bed Reactor Operation under Forced Liquid Feed Rate Modulation

Czech Academy of Sciences Publication Activity Database

Hanika, Jiří; Jiřičný, Vladimír; Karnetová, P.; Kolena, J.; Lederer, J.; Skála, D.; Staněk, Vladimír; Tukač, V.

2007-01-01

Roč. 13, č. 4 (2007), s. 192-198 ISSN 1451-9372 R&D Projects: GA MPO(CZ) FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : trickle -bed reactor * period * feed rate Subject RIV: CI - Industrial Chemistry, Chemical Engineering

From (p)ppGpp to (pp)pGpp: Characterization of Regulatory Effects of pGpp Synthesized by the Small Alarmone Synthetase of Enterococcus faecalis

Czech Academy of Sciences Publication Activity Database

Gaca, A. O.; Kudrin, P.; Colomer-Winter, C.; Beljantseva, J.; Liu, K.; Anderson, B.; Wang, J. D.; Rejman, Dominik; Potrykus, K.; Cashel, M.; Hauryliuk, V.; Lemos, J. A.

2015-01-01

Roč. 197, č. 18 (2015), s. 2908-2919 ISSN 0021-9193 R&D Projects: GA ČR GA15-11711S Institutional support: RVO:61388963 Keywords : pGpp * stringent response * bacteria Subject RIV: CC - Organic Chemistry Impact factor: 3.198, year: 2015

Browse Title Index

African Journals Online (AJOL)

Items 1 - 50 of 198 ... ... Analysis of the Negative Impact of Cigarette Smoking on Human Population ... Vol 9, No 1 (2013), A model of authoring system for e-learning courses ... Vol 7, No 1 (2013), A Novel Web-Based Student Academic Records ...

Evaluation of a Conceptual Model for Gas-Particle Partitioning of\

Czech Academy of Sciences Publication Activity Database

Shahpoury, P.; Lammel, G.; Albinet, A.; Sofuoğlu, A.; Dumanoğlu, Y.; Sofuoğlu, S.C.; Ždímal, Vladimír; Wagner, Zdeněk

2016-01-01

Roč. 50, č. 22 (2016), s. 12312-12319 ISSN 0013-936X Grant - others:IITSCRF(TR) 2013-IYTE-14 Institutional support: RVO:67985858 Keywords : dimethyl sulfoxide * aromatic hydrocarbon * aromatic compounds Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.198, year: 2016

Nález hnědáska rozrazilového (Melitaea diamina) na severní Moravě (Česká republika)

Czech Academy of Sciences Publication Activity Database

Vicherek, P.; Spitzer, Lukáš; Beneš, Jiří

2010-01-01

Roč. 2, - (2010), s. 197-198 ISSN 1803-960X R&D Projects: GA MŠk LC06073; GA ČR GAP505/10/2167 Institutional research plan: CEZ:AV0Z50070508 Keywords : faunistics * Melitaea diamina * Lepidoptera Subject RIV: EG - Zoology

Cross-diagnostic validity of the SF-36 physical functioning scale in patients with stroke, multiple sclerosis and amyotrophic lateral sclerosis: a study using Rasch analysis

NARCIS (Netherlands)

Dallmeijer, Annet J.; de Groot, Vincent; Roorda, Leo D.; Schepers, Vera P. M.; Lindeman, Eline; van den Berg, Leonard H.; Beelen, Anita; Dekker, Joost

2007-01-01

The aim of this study was to investigate unidimensionality and differential item functioning of the SF-36 physical functioning scale (PF10) in patients with various neurological disorders. Patients: Patients post-stroke (n = 198), with multiple sclerosis (n = 151) and amyotrophic lateral sclerosis

~.Nigerian Veterinary Journal

African Journals Online (AJOL)

dental care, castration and ovariohysterectomy. (Meredith and. Crossby, 2001). Rabbits are considered as difficult patients in relation to anaesthesia. ..... technicians. Academic Press Ltd,. London: 98-100. FLECKNELL, P.A. (1991). Anaesthesia and post-operative care of small mammals. In practice., 12:181-198.

Novel X-Linked Genes Revealed by Quantitative Polymerase Chain Reaction in the Green Anole, Anolis carolinensis

Czech Academy of Sciences Publication Activity Database

Rovatsos, M.; Altmanová, M.; Johnson Pokorná, Martina; Kratochvíl, L.

2014-01-01

Roč. 4, č. 11 (2014), s. 2107-2113 ISSN 2160-1836 R&D Projects: GA ČR GAP506/10/0718 Institutional support: RVO:67985904 Keywords : gene dosage * lizard * qPCR Subject RIV: EG - Zoology Impact factor: 3.198, year: 2014