WorldWideScience

Sample records for astatine 197

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  10. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  11. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  12. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  13. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  14. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  15. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  16. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  17. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  18. Contribution to the study of Pt197 and Au197 excited states

    International Nuclear Information System (INIS)

    Alves, S.M.C.

    1971-01-01

    The gamma transitions of the Ir 197β- → Pt 197β- → Au 197 decay chain were investigated using three Ge(Li) detectors of high resolution and spectroscopy techniques with one, two and three via of analysis. For the Ir 197β- →Pt 197 decay, four new gamma transitions with energy of 877.6; 938.7; 1049.6 and 1341.8 Kev were observed, presupposing to be energy levels in 877.6; 938.7; 1049.6 and 1347.8 Kev in the Ir 197 population by β- decay of Ir 197 . By the first time, the 299.5 Kev transition was observed, in the Pt 197 m (80min) decay, interpreted as a direct desexcitation of the 299.5Kev level in Pt 197 . A new scheme of Ir 197 β- → Au 197 decay based on the obtained results, is proposed. (M.C.K.) [pt

  19. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  20. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  3. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  4. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  5. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  6. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  7. Transverse expansion in 197 Au + 197 Au collisions at RHIC

    International Nuclear Information System (INIS)

    Cheng, Y.; Liu, F.; Liu, K.; Schweda, K.; Xu, N.

    2003-01-01

    Using the RQMD model, transverse momentum distributions and particle ratios are studied for 197 Au + 197 Au collisions at √s NN = 200 GeV. In particular, they present results on the mean transverse momentum of charged pions, charged kaons, protons and anti-protons and compare with experimental measurements. They discuss an approach to study early partonic collectivity in high energy nuclear collisions

  8. 46 CFR 197.550 - Respiratory protection.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Respiratory protection. 197.550 Section 197.550 Shipping... GENERAL PROVISIONS Benzene § 197.550 Respiratory protection. (a) General. When the use of respirators in... section that is appropriate for the exposure. Table 197.550(b)—Respiratory Protection for Benzene Airborne...

  9. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  10. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  11. Transverse velocity scaling in 197Au+197Au fragmentation

    International Nuclear Information System (INIS)

    Lukasik, J.; Hudan, S.; Lavaud, F.

    2002-07-01

    Invariant transverse-velocity spectra of intermediate-mass fragments were measured with the 4π multi-detector system INDRA for collisions of 197 Au on 197 Au at incident energies between 40 and 150 MeV per nucleon. Their scaling properties as a function of incident energy and atomic number Z are used to distinguish and characterize the emissions in (i) peripheral collisions at the projectile and target rapidities, and in (ii) central and (iii) peripheral collisions near mid-rapidity. The importance of dynamical effects is evident in all three cases and their origin is discussed. (orig.)

  12. Nuclear data sheets update for A = 197

    Energy Technology Data Exchange (ETDEWEB)

    Chunmei, Zhou [Chinese Nuclear Data Center, Beijing, BJ (China)

    1996-06-01

    The Nuclear Data Sheet for A = 197 has been carried out on the basis of the nuclear reaction and decay experiments leading to all the nuclei with mass number A = 197 since cutoff date of the last evaluation, December 1989. Most evaluation data have been updated or revised. The nuclei of updated data mainly are {sup 197}Hg, {sup 197}Pb, {sup 197}Bi and {sup 197}Po. The adopted levels and adopted gamma radiations for all nuclei are shown in the tables.

  13. 46 CFR 197.326 - Oxygen safety.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Oxygen safety. 197.326 Section 197.326 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.326 Oxygen safety. (a) Equipment used with...

  14. Excitation functions for 197Au (d, p)198Au, 197Au(d, 2n)197mHg, 197Au(d, 2n)197Hg and 197Au(d, p2n)196Au

    International Nuclear Information System (INIS)

    Long Xianguan; Peng Xiufeng; He Fuqing

    1987-01-01

    By using activation method and stack-foil technique, the excitation functions for d + 197 Au reaction in 6.6-13.1 MeV energy range are measured. The measured values are compared with previous results and theoretical calculations

  15. 46 CFR 197.340 - Breathing gas supply.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing gas supply. 197.340 Section 197.340 Shipping... GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.340 Breathing gas supply. (a) A primary breathing gas supply for surface-supplied diving must be sufficient to support the following for the...

  16. 12 CFR 19.7 - Good faith certification.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Good faith certification. 19.7 Section 19.7... PROCEDURE Uniform Rules of Practice and Procedure § 19.7 Good faith certification. (a) General requirement... warranted by existing law or a good faith argument for the extension, modification, or reversal of existing...

  17. 46 CFR 197.312 - Breathing supply hoses.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing supply hoses. 197.312 Section 197.312 Shipping... GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.312 Breathing supply hoses. (a) Each breathing supply hose must— (1) Have a maximum working pressure that is equal to or exceeds— (i) The maximum...

  18. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  19. Analysis of the intermediate stage in the heavy ion interactions of 208Pb+197Au and 197Au+197Au

    International Nuclear Information System (INIS)

    Nasir, Tabassum; Khan, E.U.; Baluch, J.J.; Qureshi, I.E.; Sajid, M.; Shahzad, M.I.

    2008-01-01

    Two different projectiles 208 Pb and 197 Au at the same energy (11.67MeV/u) have been bombarded on 197 Au target to study heavy ion interactions using mica as a passive detector. In this paper we present results on the study of energy damping and time scale of the existence of di-nuclear composite system in the intermediate reaction step. The plots of Q-values as well as reaction cross sections in various angular bins of scattering angles suggest that K.E. damping was complete and dynamic equilibrium was established between the first and second reaction steps. The time scale of this duration was also determined

  20. Selective Neoplasm Localization with Mercury-197 Neohydrin; Localisation Selective de Neoplasmes a l'aide de la Neohydrine Marquee avec {sup 197}hg; Obnaruzhenie opukholej s pomoshch'yu neogidrina, mechennogo rtut'yu-197; Localizacion Selectiva de Neoplasmas con Neohidrina - {sup 197}hg

    Energy Technology Data Exchange (ETDEWEB)

    Sodee, D. B. [Doctors Hospital and Renner Clinic Foundation, Cleveland Heights, OH (United States)

    1964-10-15

    Hg{sup 197} a low-energy X- and gamma- ray emitter (2.7-d half-life, 69-keV conversion X-rays, 77-keV gamma-rays) was tested as a scanning agent in a large series of patients. Five hundred patients suspected of neuro-surgical disease were scanned with Hg{sup 197}-Neohydrin. Utilizing photoscanning techniques that brought out vascular lesions as well as tumours, this procedure had a 96% correlation with the final diagnostic evaluation. This screening procedure was done before all other diagnostic tests. As an outgrowth of this brain-scanning procedure, we have found localization of Hg{sup 197}-Neohydrin in lymphomas as well as in carcinomas. There seems to be selective deposition of the radioactive substance intercellularly. Areas of increased uptake of radioactivity can easily be delineated with standard commercial scanners. Hg{sup 197}-Neohydrin was also found to be useful as a screening agent in thc differentiation of eye tumours in a series of 88 patients and recently this low-energy radiopharmaceutical was found to concentrate in naso- pharangeal tumours which could then be delineated by photoscanning. The diagnostic dose of Hg{sup 197}-Neohydrin for brain scanning delivers a radiation dose of 3 rad to the kidneys as compared to the 70 rad delivered to the kidneys by that of Hg{sup 203}-Neohydrin. The high counting efficiency and ease of collimation of Hg{sup 197} make this isotope far better for scanning purposes than all other standard diagnostic scanning agents. (author) [French] Le mercure-197, emetteur de rayons X et de rayons gamma de faible energie (periode de 65 h, rayons X de 69 keV, rayons gamma de 77 keV), a ete essaye comme agent d'exploration scintigraphique sur un grand nombre de patients. On a utilise la neohydrine marquee avec {sup 197}Hg pour la scintigraphie de 500 cas de neurochirurgie. Par des procedes de photoscintigraphie qui permettaient la visualisation des lesions vasculaires aussi bien que celle de tumeurs, on a obtenu des resultats

  1. Evaluation of cross sections for 197Au(n,3n) and 197Au(n,4n) reactions from threshold to 50 MeV

    International Nuclear Information System (INIS)

    Yu Baosheng; Shen Qingbiao; Cai Dunjiu

    1994-01-01

    The measured data of cross sections for 197 Au(n,3n) and 197 Au(n,4n) reactions were collected and analysed. The theoretical calculations of above mentioned reactions were carried out to predict the data in higher energy region. The sets of cross sections for 197 Au(n,3n) and 197 Au(n,4n) reactions from threshold to 50 MeV were recommended on the basis of the experimental and calculated data. (2 figs)

  2. Energy dependence of collective flow of neutrons and charged particles in 197Au+197Au collisions

    International Nuclear Information System (INIS)

    Blaich, T.; Freiesleben, H.; Holzmann, R.; Keller, J.G.; Prokopowicz, W.; Schuetter, C.; Wajda, E.; Zude, E.

    1994-01-01

    Our contribution focusses on one particular aspect of collective flow of nuclear matter: the so-called ''squeeze-out'', i.e. the preferential emission of mid-rapidity particles perpendicular to the reaction plane. The data were taken for the system 197 Au + 197 Au at 400, 600 and 800 MeV/u. We cover two topics, the comparison of neutrons and protons, and the bombarding energy dependence of the neutrons' squeeze-out. (orig.)

  3. 46 CFR 197.454 - First aid and treatment equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false First aid and treatment equipment. 197.454 Section 197.454 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND... Equipment § 197.454 First aid and treatment equipment. The diving supervisor shall ensure that medical kits...

  4. 46 CFR 197.314 - First aid and treatment equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false First aid and treatment equipment. 197.314 Section 197... HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.314 First aid and... consists of— (i) Basic first aid supplies; and (ii) Any additional supplies necessary to treat minor trauma...

  5. 46 CFR 197.456 - Breathing supply hoses.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing supply hoses. 197.456 Section 197.456 Shipping....456 Breathing supply hoses. (a) The diving supervisor shall insure that— (1) Each breathing supply....5 times its maximum working pressure; (2) Each breathing supply hose assembly, prior to being placed...

  6. NUHOMS registered - MP197 transport cask

    International Nuclear Information System (INIS)

    Shih, P.; Sicard, D.; Michels, L.

    2004-01-01

    The NUHOMS registered -MP197 cask is an optimized transport design which can be loaded in the spent fuel pool (wet loading) or loaded the canister from the NUHOMS concrete modules at the ISFSI site. With impact limiters attached, the package can be transported within the states or world-wide. The NUHOMS registered -MP197 packaging can be used to transport either BWR or PWR canisters. The NUHOMS registered -MP197 cask is designed to the ASME B and PV Code and meets the requirements of Section III, Division 3 for Transport Packaging. The cask with impact limiters has undergone drop testing to verify the calculated g loadings during the 9m drops. The test showed good correlation with analytical results and demonstrate that the impact limiters stay in place and protect the package and fuel during the hypothetical accidents

  7. Potential protective immunogenicity of tetanus toxoid, diphtheria toxoid and Cross Reacting Material 197 (CRM197) when used as carrier proteins in glycoconjugates.

    Science.gov (United States)

    Bröker, Michael

    2016-03-03

    When tetanus toxoid (TT), diphtheria toxoid (DT) or Cross Reacting Material 197 (CRM197), a non-toxic diphtheria toxin mutant protein, are used as carrier proteins in glycoconjugate vaccines, these carriers induce a protein specific antibody response as measured by in vitro assays. Here, it was evaluated whether or not glycoconjugates based on TT, DT or CRM197 can induce a protective immune response as measured by potency tests according to the European Pharmacopoeia. It could be shown, that the conjugate carriers TT and DT can induce a protective immune response against a lethal challenge by toxins in animals, while glycoconjugates based on CRM197 failed to induce a protective immune response. Opportunities for new applications of glycoconjugates are discussed.

  8. Analysis of the intermediate stage in the heavy ion interactions of {sup 208}Pb+{sup 197}Au and {sup 197}Au+{sup 197}Au

    Energy Technology Data Exchange (ETDEWEB)

    Nasir, Tabassum [Department of Physics, Gomal University D.I. Khan (Pakistan); Khan, E.U. [Department of Physics, CIIT, Islamabad (Pakistan)], E-mail: ehsan@comsats.edu.pk; Baluch, J J [Department of Environmental Sciences, CIIT, Abbottabad (Pakistan); Qureshi, I E [Pakistan Atomic Energy Commission, P.O. Box 1114, Islamabad (Pakistan); Sajid, M; Shahzad, M I [Physics Division, PINSTECH, P.O. Nilore, Islamabad (Pakistan)

    2008-08-15

    Two different projectiles {sup 208}Pb and {sup 197}Au at the same energy (11.67MeV/u) have been bombarded on {sup 197}Au target to study heavy ion interactions using mica as a passive detector. In this paper we present results on the study of energy damping and time scale of the existence of di-nuclear composite system in the intermediate reaction step. The plots of Q-values as well as reaction cross sections in various angular bins of scattering angles suggest that K.E. damping was complete and dynamic equilibrium was established between the first and second reaction steps. The time scale of this duration was also determined.

  9. 42 CFR 84.197 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.197... Cartridge Respirators § 84.197 Respirator containers; minimum requirements. Respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...

  10. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  11. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  12. 43 CFR 19.7 - Private contributions and gifts.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Private contributions and gifts. 19.7... National Wilderness Preservation System § 19.7 Private contributions and gifts. (a) The Secretary is... contributions and gifts to be used to further the purposes of the act. The Secretary, under the authorization of...

  13. A clinical trial examining the effect of increased total CRM(197) carrier protein dose on the antibody response to Haemophilus influenzae type b CRM(197) conjugate vaccine.

    Science.gov (United States)

    Usonis, Vytautas; Bakasenas, Vytautas; Lockhart, Stephen; Baker, Sherryl; Gruber, William; Laudat, France

    2008-08-18

    CRM(197) is a carrier protein in certain conjugate vaccines. When multiple conjugate vaccines with the same carrier protein are administered simultaneously, reduced response to vaccines and/or antigens related to the carrier protein may occur. This study examined responses of infants who, in addition to diphtheria toxoid/tetanus toxoid/acellular pertussis vaccine (DTaP) received either diphtheria CRM(197)-based Haemophilus influenzae type b conjugate vaccine (HbOC) or HbOC and a diphtheria CRM(197)-based combination 9-valent pneumococcal conjugate vaccine/meningococcal group C conjugate vaccine. Administration of conjugate vaccines with CRM(197) carrier protein load >50 microg did not reduce response to CRM(197) conjugate vaccines or immunogenicity to immunologically cross-reactive diphtheria toxoid.

  14. 37 CFR 1.97 - Filing of information disclosure statement.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Filing of information disclosure statement. 1.97 Section 1.97 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing...

  15. 15 CFR 19.7 - When will Commerce entities compromise a Commerce debt?

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities compromise a Commerce debt? 19.7 Section 19.7 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce Debts § 19.7 When will Commerce entities compromise...

  16. Possible Mechanisms of Ternary Fission in the 197Au+197 Au System at 15 AMeV

    International Nuclear Information System (INIS)

    Jun-Long, Tian; Xian, Li; Shi-Wei, Yan; Xi-Zhen, Wu; Zhu-Xia, Li

    2009-01-01

    Ternary fission in 197 Au+ 197 Au collisions at 15 A MeV is investigated by using the improved quantum molecular dynamical (ImQMD) model. The experimental mass distributions for each of the three fragments are reproduced for the first time without any freely adjusting parameters. The mechanisms of ternary fission in central and semi-central collisions are dynamically studied. In direct prolate ternary fission, two necks are found to be formed almost simultaneously and rupture sequentially in a very short time interval. Direct oblate ternary fission is a very rare fission event, in which three necks are formed and rupture simultaneously, forming three equally sized fragments along space-symmetric directions in the reaction plane. In sequential ternary fission a binary division is followed by another binary fission event after hundreds of fm/c. (nuclear physics)

  17. 40 CFR 197.2 - What definitions apply in subpart A?

    Science.gov (United States)

    2010-07-01

    ... appendix A of this part. EPA means the Environmental Protection Agency. General environment means... 40 Protection of Environment 24 2010-07-01 2010-07-01 false What definitions apply in subpart A? 197.2 Section 197.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION...

  18. 9 CFR 381.197 - Imported products; foreign inspection certificates required.

    Science.gov (United States)

    2010-01-01

    ... AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Imported Poultry... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Imported products; foreign inspection certificates required. 381.197 Section 381.197 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE...

  19. 33 CFR 110.197 - Galveston Harbor, Bolivar Roads Channel, Texas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Galveston Harbor, Bolivar Roads Channel, Texas. 110.197 Section 110.197 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Roads Channel, Texas. (a)(1) Anchorage area (A). The water bounded by a line connecting the following...

  20. 197 - 205 _Saeed and Oladeji

    African Journals Online (AJOL)

    User

    used as an oxidant for cleaning, bleachin disinfection purpose (US-EPA, 1984). the environment arises from both natura anthropogenic source. Manganese is pres drinking water, food, soil, air, dust and. (Catharine et al., 2011). It can be adsorbed on ber 1 June, 2016. Journal of Pure and Applied Sciences, 9(1): 197 - 205.

  1. 46 CFR 197.332 - PVHO-Decompression chambers.

    Science.gov (United States)

    2010-10-01

    .... Each decompression chamber must— (a) Meet the requirements of § 197.328; (b) Have internal dimensions... pressure; (d) Have a means of operating all installed man-way locking devices, except disabled shipping...

  2. Pulmonary scintigraphy using 197HgCl2 and pulmonary perfusion scintigraphy in bronchopulmonary diseases

    International Nuclear Information System (INIS)

    Fujii, Tadashige; Kanai, Hisakata; Handa, Kenjiro; Kusama, Shozo

    1981-01-01

    75 patients with pulmonary tuberculosis and 106 patients with bronchopulmonary diseases whose chest x-rays showed diffuse shadows were studied. Pulmonary scintigraphy using 197 HgCl 2 was useful for the diagnosis of the localization and the activity of pulmonary tuberculosis, because 197 HgCl 2 readily accumulated in the foci, and its accumulation rate was related to the activity of the foci. 197 HgCl 2 also accumulated markedly in foci of pneumoconiosis, especially, in areas showing large shadows and foci suspected to be tuberculosis. 197 HgCl 2 also accumulated in areas of chronic bronchitis, diffuse interstitial pneumonia and bronchiectasis. Its accumulation was considered to have a relation to the activity of inflammation. In primary pulmonary carcinoma, 197 HgCl 2 accumulated most markedly, in the primary lesions. 197 HgCl 2 also accumulated in metastatic or invasion areas of the hilus and the mediastinum. It accumulated in intrapulmonary metastatic foci of pulmonary carcinoma and multiple metastatic pulmonary tumors, but it was difficult to differentiate these diseases from other pulmonary diseases. In selected cases, it was useful to use pulmonary scintigraphy using 197 HgCl 2 together with pulmonary perfusion scintigraphy for the diagnosis of diffuse bronchopulmonary diseases. (Tsunoda, M.)

  3. Mechanism of ternary breakup in the reaction 197Au+197Au at 15A MeV

    International Nuclear Information System (INIS)

    Tian Junlong; Wu Xizhen; Li Zhuxia; Zhao Kai; Zhang Yingxun; Li Xian; Yan Shiwei

    2010-01-01

    The mechanism of the ternary breakup of the very heavy system 197 Au+ 197 Au at an energy of 15A MeV has been studied by using the improved quantum molecular dynamics model. The calculation results reproduce the characteristic features in ternary breakup events explored in a series of experiments; i.e., the masses of three fragments are comparable in size and the very fast, nearly collinear breakup of the colliding system is dominant in the ternary breakup events. Further, the evolution of the time scales of different ternary reaction modes and the behavior of mass distributions of three fragments with impact parameters are studied. The time evolution of the configurations of the composite reaction systems is also studied. We find that for most of the ternary breakup events with the features found in the experiments, the configuration of the composite system has two-preformed-neck shape. The study shows that those ternary breakup events having the characteristic features found in the experiments happen at relatively small impact parameter reactions, but not at peripheral reactions. The ternary breakup reaction at peripheral reactions belongs to binary breakup with a neck emission.

  4. Coulomb excitations of low lying levels in 127I and 197Au

    International Nuclear Information System (INIS)

    Singh, K.P.; Tayal, D.C.; Hans, H.S.

    1988-01-01

    The low-lying levels of 127 I and 197 Au were Coulomb excited with 3.54 to 4.2 MeV protons. The reduced quadrupole transition probabilities of the 203, 374.9, 418, 618.4, 628.7, 651.1 and 745.5 keV states of 127 I, and the 268.8, 278.9, 502, and 547.5 keV states of 197 Au was measured from Coulomb excitation by observing the de-excitation gamma rays with a high resolution Ge(Li) detector. The low-energy protons were used for the first time to Coulomb-excite the two levels at 618.4 and 651.1 keV of 127 I and one level at 502 keV of 197 Au. The present experimental results are found in agreement with the existing experimental data except the B(E2) value of the level at 268.8 keV of 197 Au. (author). 4 figs., 4 tabs., 32 refs

  5. Conformance to Regulatory Guide 1.97, Arkansas Nuclear One, Unit No. 1

    International Nuclear Information System (INIS)

    Stoffel, J.W.

    1985-08-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97 for Unit No. 1 of Arkansas Nuclear One and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  6. The decay of 399 KeV isomeric state in 197Pt

    International Nuclear Information System (INIS)

    Soares, J.C.; Melo, A.A.; Gil, F.B.; Dias, H.

    1981-02-01

    The nuclear levels in 197 Pt have been studied from decay of 95.4 min 197 (sup m)Pt. The isomeric state was produced by (n,#betta#) reaction on the enriched 196 Pt. The #betta#-ray spectra have been observed with a hyperpure Ge detector and a large volume Ge(Li) detector. The half lives of the 399 KeV and the 53 KeV states were determined with improved precision. The results are: T1/2 (399 KeV) = 95.41 +- 0.18 min and T1/2(53 KeV) = 16.58 +- 0.17 ns. The g-factor of the 53 Kev 5/2 - state has been measured by the gamma-gamma time differential perturbed angular correlation (TDPAC) method in an external magnetic field of 25,1 kG using the 346 - 53 KeV gamma cascade. The value of g-factor was obtained to be + 0.335 +- 0.010. This result is compared with the known g-factors of the similar states in 195 Pt, and in 197 Hg and 199 Hg and also with the theoretical calculations based on the quasiparticle-phonon coupling scheme. Possibility of using the 346 - 53 KeV gamma cascade in 197 Pt in the future TDPAC studies is discussed. (Author) [pt

  7. The new european standard on common cements specifications EN 197-1:2011

    Directory of Open Access Journals (Sweden)

    Sanjuán, M. A.

    2012-09-01

    Full Text Available In this paper, the novelties of European standard EN 197-1:2011 which has been aprobed on 6th August, 2011 are presented. The european standard EN 197-1:2011 has been published in the Official Journal of the European Union on 19th June, 2012 (C 176/1. The UNEEN 197-1:2011 will be published in Spain in the Official Journal of Spain (B.O.E.. The date of applicability (DAV of the standard as a harmonised European standard is on 1st of July, 2012 and the date of the end of the coexistence period is on 1st of July, 2013. The former EN 197-1:2000 has been the first European standard in the field of the Construction Products Directive (CPD and this first revision include the requirements needed for a common cement to be, in addition, sulphate resisting cement. Therefore, the mandate given by the European Commission to CEN to prepare harmonised standards in the cement field (mandate M114 has been fulfilled.En este artículo se presentan las novedades de la nueva norma europea de especificaciones de cementos comunes UNE-EN 197-1:2011 aprobada el 6 de agosto de 2011 como EN 197-1:2011 y publicada el 19 de junio de 2012 en el Diario Oficial de la Unión Europea (DOUE. Esta norma se publicará en el Boletín Oficial del Estado (BOE antes de final de año. La fecha de disponibilidad (date of applicability, DAV es el 1 de julio de 2012 y el periodo de coexistencia finalizará el 1 de julio de 2013. La UNE-EN 197-1:2000 fue la primera norma armonizada dentro del campo de la Directiva de Productos de la Construcción (DPC europea y esta primera revisión incorpora unos nuevos requisitos para establecer cuándo un cemento común, además, es resistente a la acción de los sulfatos. De esta forma, se completa el mandato dado por la Comisión Europea a CEN para la elaboración de normas armonizadas de cementos (mandato M114.

  8. 49 CFR 192.197 - Control of the pressure of gas delivered from high-pressure distribution systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Control of the pressure of gas delivered from high-pressure distribution systems. 192.197 Section 192.197 Transportation Other Regulations Relating to... STANDARDS Design of Pipeline Components § 192.197 Control of the pressure of gas delivered from high...

  9. MicroRNA-197 induces epithelial-mesenchymal transition and ...

    Indian Academy of Sciences (India)

    微软用户

    Background: The major cause of cancer-related deaths in patients with lung ... These observations suggest that miR-197 could be a therapeutic target for preventing ..... Ng C, et al. MicroRNA-antagonism regulates breast cancer stemness and ...

  10. Sequential and double sequential fission observed in heavy ion interaction of (11.67 MeV/u)197Au projectile with 197Au target

    International Nuclear Information System (INIS)

    Nasir, Tabassum; Khan, Ehsan Ullah; Baluch, Javaid Jahan; Shafi-Ur-Rehman; Matiullah; Rafique, Muhammad

    2009-01-01

    The heavy ion interaction of 11.67 MeV/u 197 Au+ 197 Au has been investigated using mica as a passive detector. By employing Solid State Nuclear Track Detection Technique the data of elastic scattering as well as inelastic reaction channel was collected. The off-line data analysis of multi-pronged events was performed by measuring the three-dimensional geometrical coordinates of correlated tracks on event-by-event basis. Multi pronged events observed in this reaction were due to sequential and double sequential fission. Using a computer code PRONGY based on the procedure of internal calibration, it was possible to derive quantities like mass transfer, total kinetic energy loss and scattering angles. (author)

  11. Vi-CRM 197 as a new conjugate vaccine against Salmonella Typhi.

    Science.gov (United States)

    Micoli, F; Rondini, S; Pisoni, I; Proietti, D; Berti, F; Costantino, P; Rappuoli, R; Szu, S; Saul, A; Martin, L B

    2011-01-17

    An efficacious, low cost vaccine against typhoid fever, especially for young children, would make a major impact on disease burden in developing countries. The virulence capsular polysaccharide of Salmonella Typhi (Vi) coupled to recombinant mutant Pseudomonas aeruginosa exoprotein A (Vi-rEPA) has been shown to be highly efficacious. We investigated the use of carrier proteins included in infant vaccines, standardized the conjugation process and developed key assays required for routine lot release at production scale. Vi from a BSL1 organism, Citrobacter freundii, strain WR7011, was used as an alternative to Vi from S. Typhi. We showed that Vi conjugated to CRM(197), a non-toxic mutant of diphtheria toxin, widely used in commercial vaccines, was produced at high yield. Vi-CRM(197) proved immunogenic in animal studies, even without adjuvant. Thus, Vi-CRM(197) appears to be a suitable candidate for the development of a commercially viable, effective typhoid vaccine for developing countries. Copyright © 2010 Elsevier Ltd. All rights reserved.

  12. Effects of miRNA-197 overexpression on proliferation, apoptosis and migration in levonorgestrel treated uterine leiomyoma cells.

    Science.gov (United States)

    Wu, Xiaoli; Ling, Jing; Fu, Ziyi; Ji, Chenbo; Wu, Jiangping; Xu, Qing

    2015-04-01

    Uterine leiomyoma is the ahead benign tumor of the female genital tract, which resulted in menstrual abnormalities, recurrent pregnancy loss, and other serious gynecological disorders in women. Recently, as the process of exploring the brief molecular mechanisms of tumorgenesis, microRNAs (miRNAs) have attracted much more attention. In this study, we first confirmed that microRNA-197 (miR-197) was down-regulated significantly in human uterus leiomyoma by quantity real-time polymerase chain reaction, compared to normal uterus myometrium. Then we observed the potential effects of miR-197 overexpression on human uterus leiomyoma cells by cell counting kit 8, wound healing assay, and flow cytometric assessment separately. The data showed that miR-197 could inhibit cell proliferation, induce cell apoptosis, and block cell migration in vitro. Coincidently, levonorgestrel (LNG), a well-known uterus leiomyoma therapy, could induce miR-197 expression in human uterus leiomyoma cells, and over-expression of miR-197 showed a synergy effect on human uterus leiomyoma cell proliferation and apoptosis with LNG. In this study, the data showed that miR-197 could play an anti-oncogenic role in human uterus leiomyoma cells, and cooperate with LNG on the cell proliferation and apoptosis, which suggested that miR-197 might be a potential target and provided database for clinical treatment. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  13. Complex fragment emission in the reaction 197Au → 197Au at an incident energy of 15 MeV/u

    International Nuclear Information System (INIS)

    Schmoll, R.

    1988-07-01

    For the study of the dominant decay processes in the reaction 15 MeV/u 197 Au → 197 Au in one-particle inclusive experiments the emission characteristics of all ejectiles in the mass range 24 ≤ A ≤ 197 were studied. The deflection function of the projectile-like fragments is for all energy losses at the grazing angle Θ cm gr =27.5 degrees peaked and in fact even for scattering events in which the whole available kinetic energy was dissipated in the collisions. The systematic analysis of the velocity spectra shows that the lightest fragments are formed in double-sequential fission of the highly excited gold-like fragments from the first deep inelastic reaction stage before reaching of a global equilibrium. On the other side symmetrical fission products, which are part of the narrow branch of the mass distribution, are emitted in simple-sequential non-equilibrium fission. This simple-sequential breakup is very closely limited to excitation energies of 75 ≤ E * ≤ 275 MeV of the primary, gold-like fragments, while the probability for double-sequential fission above E * ≅ 200 MeV increases very strongly. Contrarily to equilibrated compound-nucleus fission these processes are characterized by a in the source system strongly anisotropic angular distribution with distinct foreward/backward asymmetry and by an extremely asymmetric mass split. The study of the mass distribution shows that non-equilibrium fission at 15 MeV/u is both in view of the reaction cross section and regarding the creation of the complex fragments is the dominant decay process. The integral cross section of the broad four-body distribution corresponds to 60% of the total reaction cross section; the integral cross section of the narrow three-body distribution corresponds to 10%. (orig./HSI) [de

  14. Systematic analysis of gene expression pattern in has-miR-197 over-expressed human uterine leiomyoma cells.

    Science.gov (United States)

    Ling, Jing; Wu, Xiaoli; Fu, Ziyi; Tan, Jie; Xu, Qing

    2015-10-01

    Our previous study showed that the expression of miR-197 in leiomyoma was down-regulated compared with myometrium. Further, miR-197 has been identified to affect uterine leiomyoma cell proliferation, apoptosis, and metastasis ability, though the responsible molecular mechanism has not been well elucidated. In this study, we sought to determine the expression patterns of miR-197 targeted genes and to explore their potential functions, participating Pathways and the networks that are involved in the biological behavior of human uterine leiomyoma. After transfection of human uterine leiomyoma cells with miR-197, we confirmed the expression level of miR-197 using quantitative real-time PCR (qRT-PCR), and we detected the gene expression profiles after miR-197 over-expression through DNA microarray analysis. Further, we performed GO and Pathway analysis. The dominantly dys-regulated genes, which were up- or down-regulated by more than 10-fold, compared with parental cells, were confirmed using qRT-PCR technology. Compared with the control group, miR-197 was up-regulated by 30-fold after miR-197 lentiviral transfection. The microarray data showed that 872 genes were dys-regulated by more than 2-fold in human uterine leiomyoma cells after miR-197 overexpression, including 537 up-regulated and 335 down-regulated genes. The GO analysis indicated that the dys-regulated genes were primarily involved in response to stimuli, multicellular organ processes, and the signaling of biological progression. Further, Pathway analysis data showed that these genes participated in regulating several signaling Pathways, including the JAK/STAT signaling Pathway, the Toll-like receptor signaling Pathway, and cytokine-cytokine receptor interaction. The qRT-PCR results confirmed that 17 of the 66 selected genes, which were up- or down-regulated more than 10-fold by miR-197, were consistent with the microarray results, including tumorigenesis-related genes, such as DRT7, SLC549, SFMBT2, FLJ37956

  15. Sequential and double sequential fission observed in heavy ion interaction of (11.67 MeV/u){sup 197}Au projectile with {sup 197}Au target

    Energy Technology Data Exchange (ETDEWEB)

    Nasir, Tabassum [Gomal University, Dera Ismail Khan (Pakistan). Dept. of Physics; Khan, Ehsan Ullah [COMSATS Institute of Information Technology (CIIT), Islamabad (Pakistan). Dept. of Physics; Baluch, Javaid Jahan [COMSATS Institute of Information Technology (CIIT), Abbottabad, (Pakistan). Dept. of Environmental Sciences; Shafi-Ur-Rehman, [PAEC, Dera Ghazi Khan (Pakistan). ISL Project; Matiullah, [PINSTECH, Nilore, Islamabad (Pakistan). Physics Div.; Rafique, Muhammad [University of Azad Jammu and Kashmir, Muzaffarabad (Pakistan). Dept. of Physics

    2009-09-15

    The heavy ion interaction of 11.67 MeV/u {sup 197}Au+ {sup 197}Au has been investigated using mica as a passive detector. By employing Solid State Nuclear Track Detection Technique the data of elastic scattering as well as inelastic reaction channel was collected. The off-line data analysis of multi-pronged events was performed by measuring the three-dimensional geometrical coordinates of correlated tracks on event-by-event basis. Multi pronged events observed in this reaction were due to sequential and double sequential fission. Using a computer code PRONGY based on the procedure of internal calibration, it was possible to derive quantities like mass transfer, total kinetic energy loss and scattering angles. (author)

  16. Rapidity and centrality dependence of proton and anti-proton production from 197Au+197Au collisions at √(sNN) = 130 GeV

    International Nuclear Information System (INIS)

    Adams, J.; Adler, C.; Aggarwal, M.M.; Ahammed, Z.; Amonett, J.; Anderson, B.D.; Anderson, M.; Arkhipkin, D.; Averichev, G.S.; Badyal, S.K.; Balewski, J.; Barannikova, O.; Barnby, L.S.; Baudot, J.; Bekele, S.; Belaga, V.V.; Bellwied, R.; Berger, J.; Bezverkhny, B.I.; Bhardwaj, S.; Bhaskar, P.; Bhati, A.K.; Bichsel, H.; Billmeier, A.; Bland, L.C.; Blyth, C.O.; Bonner, B.E.; Botje, M.; Boucham, A.; Brandin, A.; Bravar, A.; Cadman, R.V.; Cai, X.Z.; Caines, H.; Calderon de la Barca Sanchez, M.; Cardenas, A.; Carroll, J.; Castillo, J.; Castro, M.; Cebra, D.; Chaloupka, P.; Chattopadhyay, S.; Chen, H.F.; Chen, Y.; Chernenko, S.P.; Cherney, M.; Chikanian, A.; Choi, B.; Christie, W.; Coffin, J.P.; Cormier, T.M.; Corral, M.M.; Cramer, J.G.; Crawford, H.J.; Das, D.; Das, S.; Derevschikov, A.A.; Didenko, L.; Dietel, T.; Dong, X.; Draper, J.E.; Du, F.; Dubey, A.K.; Dunin, V.B.; Dunlop, J.C.; Dutta Mazumdar, M.R.; Eckardt, V.; Efimov, L.G.; Emelianov, V.; Engelage, J.; Eppley, G.; Erazmus, B.; Fachini, P.; Faine, V.; Faivre, J.; Fatemi, R.; Filimonov, K.; Filip, P.; Finch, E.; Fisyak, Y.; Flierl, D.; Foley, K.J.; Fu, J.; Gagliardi, C.A.; Ganti, M.S.; Gutierrez, T.D.; Gagunashvili, N.; Gans, J.; Gaudichet, L.; Germain, M.; Geurts, F.; Ghazikhanian, V.; Ghosh, P.; Gonzalez, J.E.; Grachov, O.; Grigoriev, V.; Grosnick, D.; Guedon, M.; Guertin, S.M.; Gupta, A.; Gushin, E.; Hallman, T.J.; Hardtke, D.; Harris, J.W.; Heinz, M.; Henry, T.W.; Heppelmann, S.; Herston, T.; Hippolyte, B.; Hirsch, A.; Hjort, E.; Hoffmann, G.W.; Horsley, M.; Huang, H.Z.; Huang, S.L.; Humanic, T.J.; Igo, G.; Ishihara, A.; Jacobs, P.; Jacobs, W.W.; Janik, M.; Johnson, I.; Jones, P.G.; Judd, E.G.; Kabana, S.; Kaneta, M.; Kaplan, M.; Keane, D.; Kiryluk, J.; Kisiel, A.; Klay, J.; Klein, S.R.; Klyachko, A.; Koetke, D.D.; Kollegger, T.; Konstantinov, A.S.; Kopytine, M.; Kotchenda, L.; Kovalenko, A.D.; Kramer, M.; Kravtsov, P.; Krueger, K.; Kuhn, C.; Kulikov, A.I.; Kumar, A.

    2003-01-01

    We report on the rapidity and centrality dependence of proton and anti-proton transverse mass distributions from 197 Au + 197 Au collisions at √s NN = 130 GeV as measured by the STAR experiment at RHIC. Our results are from the rapidity and transverse momentum range of |y| t < 1.00 GeV/c. For both protons and anti-protons, transverse mass distributions become more convex from peripheral to central collisions demonstrating characteristics of collective expansion. The measured rapidity distributions and the mean transverse momenta versus rapidity are flat within |y| < 0.5. Comparisons of our data with results from model calculations indicate that in order to obtain a consistent picture of the proton(anti-proton) yields and transverse mass distributions the possibility of pre-hadronic collective expansion may have to be taken into account

  17. Novel methodology for the study of mercury methylation and reduction in sediments and water using 197Hg radiotracer.

    Science.gov (United States)

    Ribeiro Guevara, Sergio; Zizek, Suzana; Repinc, Urska; Pérez Catán, Soledad; Jaćimović, Radojko; Horvat, Milena

    2007-03-01

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H2SO4 or HCl were evaluated in freshwater sediments using 197Hg radiotracer. Values obtained for the 197Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197Hg2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H2SO4 method is recommended, since it is free from these interferences. 197Hg radiotracer (T1/2=2.673 d) has a production rate that is about 50 times higher than that of 203Hg (T1/2=46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203Hg when it is used it in short-term experiments and produced by the irradiation of 196Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196Hg isotope is increased, the specific activity of the 197Hg tracer can be significantly improved. In the present work, 197Hg tracer was produced from mercury 51.58% enriched in the 196Hg isotope, and a 340-fold

  18. 40 CFR 197.31 - What is a representative volume?

    Science.gov (United States)

    2010-07-01

    ... supply a given water demand. The DOE must project the concentration of radionuclides released from the... Public Health and Environmental Standards for Disposal Ground Water Protection Standards § 197.31 What is a representative volume? (a) It is the volume of ground water that would be withdrawn annually from...

  19. Sudden change of quadrupole moment between the first 5/2- states of 197Hg and 199Hg

    International Nuclear Information System (INIS)

    Herzog, P.; Krien, K.; Freitag, M.; Reuschenbach, M.; Walitzki, H.

    1980-01-01

    Low-temperature time differential perturbed angular correlation experiments with the 164 KeV-134 keV cascade of sup(197m)Hg in a zinc matrix give evidence that the hitherto accepted value of the quadrupole moment of the first 5/2 - state of 197 Hg is erroneous. A new value is derived from a time differential perturbed angular correlation experiment with the 374 keV-158 keV cascade of sup(199m)Hg implanted into a Be single crystal and comparison with an analogous experiment for sup(197m)Hg. Taking Q(5/2 - , 199 Hg) = +0.95(7) b we derive Q(5/2 - , 197 Hg) = 0.081(6) b. This change of quadrupole moment is discussed in the framework of the shell model. (orig.)

  20. Conformance to Regulatory Guide 1.97, River Bend Station, Unit No. 1 (Docket No. 50-458)

    International Nuclear Information System (INIS)

    Udy, A.C.

    1985-08-01

    This EG and G, Inc., report reviews the submittals for Regulatory Guide 1.97, Revision 3, for the River Bend Station, Unit No. 1. Any exception to Regulatory Guide 1.97 is evaluated and those areas where sufficient basis for acceptability is not provided are identified. 8 refs

  1. g-factor of the KeV 5/2- state in 197Pt measured by the TDPAC method

    International Nuclear Information System (INIS)

    Saxena, R.N.; Soares, J.C.

    1981-09-01

    The g-factor of the 53 keV state in 197 Pt has been measured using the gamma-gamma time differential perturbed angular correlation (TDPAC) method in an external magnetic field of 25.1 kG. The measurements were performed by utilizing the 346-53 keV gamma cascade in the decay of 95.4 min 197 Pt. The value of the g-factor was obtained to be + 0.335 +- 0.010. This result is compared with the g-factors of similar states in 195 Pt and sup(197,199)Hg. (Author) [pt

  2. O:2-CRM(197) conjugates against Salmonella Paratyphi A.

    Science.gov (United States)

    Micoli, Francesca; Rondini, Simona; Gavini, Massimiliano; Lanzilao, Luisa; Medaglini, Donata; Saul, Allan; Martin, Laura B

    2012-01-01

    Enteric fevers remain a common and serious disease, affecting mainly children and adolescents in developing countries. Salmonella enterica serovar Typhi was believed to cause most enteric fever episodes, but several recent reports have shown an increasing incidence of S. Paratyphi A, encouraging the development of a bivalent vaccine to protect against both serovars, especially considering that at present there is no vaccine against S. Paratyphi A. The O-specific polysaccharide (O:2) of S. Paratyphi A is a protective antigen and clinical data have previously demonstrated the potential of using O:2 conjugate vaccines. Here we describe a new conjugation chemistry to link O:2 and the carrier protein CRM(197), using the terminus 3-deoxy-D-manno-octulosonic acid (KDO), thus leaving the O:2 chain unmodified. The new conjugates were tested in mice and compared with other O:2-antigen conjugates, synthesized adopting previously described methods that use CRM(197) as carrier protein. The newly developed conjugation chemistry yielded immunogenic conjugates with strong serum bactericidal activity against S. Paratyphi A.

  3. O:2-CRM(197 conjugates against Salmonella Paratyphi A.

    Directory of Open Access Journals (Sweden)

    Francesca Micoli

    Full Text Available Enteric fevers remain a common and serious disease, affecting mainly children and adolescents in developing countries. Salmonella enterica serovar Typhi was believed to cause most enteric fever episodes, but several recent reports have shown an increasing incidence of S. Paratyphi A, encouraging the development of a bivalent vaccine to protect against both serovars, especially considering that at present there is no vaccine against S. Paratyphi A. The O-specific polysaccharide (O:2 of S. Paratyphi A is a protective antigen and clinical data have previously demonstrated the potential of using O:2 conjugate vaccines. Here we describe a new conjugation chemistry to link O:2 and the carrier protein CRM(197, using the terminus 3-deoxy-D-manno-octulosonic acid (KDO, thus leaving the O:2 chain unmodified. The new conjugates were tested in mice and compared with other O:2-antigen conjugates, synthesized adopting previously described methods that use CRM(197 as carrier protein. The newly developed conjugation chemistry yielded immunogenic conjugates with strong serum bactericidal activity against S. Paratyphi A.

  4. Association of Interleukin-17 polymorphism (-197G/A) in chronic and localized aggressive periodontitis.

    Science.gov (United States)

    Chaudhari, Harshal Liladhar; Warad, Shivaraj; Ashok, Nipun; Baroudi, Kusai; Tarakji, Bassel

    2016-01-01

    Interleukin 17(IL-17) is a pro-inflammatory cytokine produced mainly by Th17 cells. The present study was undertaken to investigate a possible association between IL-17 A genetic polymorphism at (-197A/G) and susceptibility to chronic and localized aggressive periodontitis (LAgP) in an Indian population. The study was carried out on 105 subjects, which included 35 LAgP patients, 35 chronic periodontitis patients and 35 healthy controls. Blood samples were drawn from the subjects and analyzed for IL-17 genetic polymorphism at (-197A/G), by using the polymerase chain reaction-restriction fragment length polymorphism method. A statistically significant difference was seen in the genotype distribution among chronic periodontitis patients, LAgP patients and healthy subjects. There was a significant difference in the distribution of alleles among chronic periodontitis patients, LAgP patients and healthy subjects. The odds ratio for A allele versus G allele was 5.1 between chronic periodontitis patients and healthy controls, and 5.1 between LAgp patients and healthy controls. Our study concluded that IL-17 A gene polymorphism at (-197A/G) is linked to chronic periodontitis and LAgP in Indian population. The presence of allele A in the IL-17 gene polymorphism (-197A/G) can be considered a risk factor for chronic periodontitis and LAgP.

  5. The Half Life of the 53 keV Level in {sup 197}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Malmskog, S G

    1967-02-15

    The half life of the recently proposed 53 keV level in {sup 197}Pt has been measured to 18.5 {+-} 1.5 nsec using the delayed coincidence technique. This level, which is identified with the f{sub 5/2} single particle state, decays directly to the p{sub 1/2} ground state in {sup 197}Pt. The reduced E2 transition probability for this 53 keV transition has been deduced and compared with the results obtained for the corresponding transitions in other Pt, Hg, and Pb isotopes and with the theoretical predictions by Sorensen and by Wahlborn and Martinson.

  6. Evaluation of [O-methyl-11C]RS-15385-197 as a positron emission tomography radioligand for central α2-adrenoceptors

    International Nuclear Information System (INIS)

    Hume, S.P.; Hirani, E.; Opacka-Juffry, J.; Osman, S.; Myers, R.; Gunn, R.N.; McCarron, J.A.; Pike, V.W.; Clark, R.D.; Melichar, J.; Nutt, D.J.

    2000-01-01

    Carbon-11 labelled RS-15385-197 and its ethylsulphonyl analogue, RS-79948-197, were evaluated in rats as potential radioligands to image central α 2 -adrenoceptors in vivo. The biodistributions of both compounds were comparable with that obtained in an earlier study using tritiated RS-79948-197 and were consistent with the known localisation of α 2 -adrenoceptors. The maximal signals (total to non-specific binding) were, however, reduced, in the order [ 11 C]RS-79948-197 11 C]RS-15385-197 3 H]RS-79948-197, primarily due to the difference in radiolabel position (O-methyl for carbon-11 compared with S-ethyl for tritium). This resulted in the in-growth of radiolabelled metabolites in plasma, which, in turn, contributed to the non-specific component of brain radioactivity. Nonetheless, the signal ratio of ∝5 for a receptor-dense tissue compared with the receptor-sparse cerebellum, at 90-120 min after radioligand injection, encouraged the development of [O-methyl- 11 C]RS-15385-197 for human positron emission tomography (PET). Unfortunately, in two human PET scans (each of 90 min), brain extraction of the radioligand was minimal, with volumes of distribution more than an order of magnitude lower than that measured in rats. Following intravenous injection, radioactivity was retained in plasma and metabolism of the radiolabelled compound was very low. Retrospective measurements of in vitro plasma protein binding and in vivo brain uptake index (BUI) in rats demonstrated a higher protein binding of the radioligand in human compared with rat plasma and a lower BUI in the presence of human plasma. It is feasible that a higher affinity of RS-15385-197 for human plasma protein compared with receptor limited the transport of the radioligand. Although one of the PET scans showed a slight heterogeneity in biodistribution of radioactivity which was consistent with the known localisation of α 2 -adrenoceptors in human brain, it was concluded that [O-methyl- 11 C]RS-15385-197

  7. Discovery of a Transient Magnetar: XTE J1810-197

    Science.gov (United States)

    Ibrahim, Alaa I.; Markwardt, Craig B.; Swank, Jean H.; Ransom, Scott; Roberts, Mallory; Kaspi, Victoria; Woods, Peter M.; Safi-Harb, Samar; Balman, Solen; Parke, William C.

    2004-01-01

    We report the discovery of a new X-ray pulsar, XTE J1810-197, that was serendipitously discovered on 2003 July 15 by the Rossi X-Ray Timing Explorer (RXTE) while observing the soft gamma repeater SGR 1806-20. The pulsar has a 5.54 s spin period, a soft X-ray spectrum (with a photon index of approx. = 4). and is detectable in earlier RXTE observations back to 2003 January but not before. These show that a transient outburst began between 2002 November 17 and 2003 January 23 and that the source's persistent X-ray flux has been declining since then. The pulsar exhibits a high spin-down rate P approx.= l0(exp -11) s/s with no evidence of Doppler shifts due to a binary companion. The rapid spin-down rate and slow spin period imply a supercritical characteristic magnetic field B approx. = 3 x l0(exp 14) G and a young age tau less than or = 7600 yr. Follow-up Chandra observations provided an accurate position of the source. Within its error radius, the 1.5 m Russian-Turkish Optical Telescope found a limiting magnitude R(sub c) = 21.5. All such properties are strikingly similar to those of anomalous X-ray pulsars ad soft gamma repeaters, providing strong evidence that the source is a new magnetar. However, archival ASCA and ROSAT observations found the source nearly 2 orders of magnitude fainter. This transient behavior and the observed long-term flux variability of the source in absence of an observed SGR-like burst activity make it the first confirmed transient magnetar and suggest that other neutron stars that share the properties of XTE 51810- 197 during its inactive phase may be unidentified transient magnetars awaiting detection via a similar activity. This implies a larger population of magnetars than previously surmised and a possible evolutionary connection between magnetars and other neutron star families. Subject headings: pulsars: general -pulsars: individual (XTE 51810- 197) - stars: magnetic fields -

  8. Conformance to Regulatory Guide 1.97, Beaver Valley Power Station, Unit No. 2 (Docket No. 50-412)

    International Nuclear Information System (INIS)

    Stoffel, J.W.; Udy, A.C.

    1985-11-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97 for Unit No. 2 of the Beaver Valley Power Station and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  9. Pershore made CR-39(DOP) as a 1.015 GeV/n 197Au-ion detector

    International Nuclear Information System (INIS)

    Bhattacharyya, D.P.; Chakrabarty, S.; Rakshit, R.; Basu, B.; Pal, P.; Biswas, S.

    1993-01-01

    Pershore made CR-39(DOP) stack was exposed at a zenith angle of 30deg by 197 Au-ions of energy 1.015 GeV/n using LBL BEVALAC beam. The top of the irradiated plate of the stack has been etched in 6.25N NaOH solution at 70degC for one hour. About 1202 cone lengths were optically measured. The estimated etch rate ratio of the incident 197 Au projectile beam in CR-39 has been found to be 27±2. The result has been compared with earlier observation. The charge resolution of the detector has been estimated from the average of double cone lengths and has been found to have a value of (0.58±0.03)e for 197 Au-ions. (orig.)

  10. Novel methodology for the study of mercury methylation and reduction in sediments and water using 197Hg radiotracer

    International Nuclear Information System (INIS)

    Ribeiro Guevara, Sergio; Perez Catan, Soledad; Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena

    2007-01-01

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H 2 SO 4 or HCl were evaluated in freshwater sediments using 197 Hg radiotracer. Values obtained for the 197 Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197 Hg 2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg 2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg 2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H 2 SO 4 method is recommended, since it is free from these interferences. 197 Hg radiotracer (T 1/2 = 2.673 d) has a production rate that is about 50 times higher than that of 203 Hg (T 1/2 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203 Hg when it is used it in short-term experiments and produced by the irradiation of 196 Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196 Hg isotope is increased, the specific activity of the 197 Hg tracer can be significantly improved. In the present work, 197 Hg tracer was produced from mercury 51.58% enriched in the 196 Hg

  11. Antigen processing of glycoconjugate vaccines; the polysaccharide portion of the pneumococcal CRM(197) conjugate vaccine co-localizes with MHC II on the antigen processing cell surface.

    Science.gov (United States)

    Lai, Zengzu; Schreiber, John R

    2009-05-21

    Pneumococcal (Pn) polysaccharides (PS) are T-independent (TI) antigens and do not induce immunological memory or antibodies in infants. Conjugation of PnPS to the carrier protein CRM(197) induces PS-specific antibody in infants, and memory similar to T-dependent (Td) antigens. Conjugates have improved immunogenicity via antigen processing and presentation of carrier protein with MHC II and recruitment of T cell help, but the fate of the PS attached to the carrier is unknown. To determine the location of the PS component of PnPS-CRM(197) in the APC, we separately labeled PS and protein and tracked their location. The PS of types 14-CRM(197) and 19F-CRM(197) was specifically labeled by Alexa Fluor 594 hydrazide (red). The CRM(197) was separately labeled red in a reaction that did not label PS. Labeled antigens were incubated with APC which were fixed, permeabilized and incubated with anti-MHC II antibody labeled green by Alexa Fluor 488, followed by confocal microscopy. Labeled CRM(197) was presented on APC surface and co-localized with MHC II (yellow). Labeled unconjugated 14 or 19F PS did not go to the APC surface, but PS labeled 14-CRM(197) and 19F-CRM(197) was internalized and co-localized with MHC II. Monoclonal antibody to type 14 PS bound to intracellular type 14 PS and PS-CRM(197). Brefeldin A and chloroquine blocked both CRM(197) and PS labeled 14-CRM(197) and 19F-CRM(197) from co-localizing with MHC II. These data suggest that the PS component of the CRM(197) glycoconjugate enters the endosome, travels with CRM(197) peptides to the APC surface and co-localizes with MHC II.

  12. Effect of skin barrier disruption on immune responses to topically applied cross-reacting material, CRM(197), of diphtheria toxin.

    Science.gov (United States)

    Godefroy, S; Peyre, M; Garcia, N; Muller, S; Sesardic, D; Partidos, C D

    2005-08-01

    The high accessibility of the skin and the presence of immunocompetent cells in the epidermis makes this surface an attractive route for needle-free administration of vaccines. However, the lining of the skin by the stratum corneum is a major obstacle to vaccine delivery. In this study we examined the effect of skin barrier disruption on the immune responses to the cross-reacting material CRM(197), a nontoxic mutant of diphtheria toxin (DTx) that is considered as a vaccine candidate. Application of CRM(197), together with cholera toxin (CT), onto the tape-stripped skin of mice elicited antibody responses that had anti-DTx neutralizing activity. Vaccine delivery onto mildly ablated skin or intact skin did not elicit any detectable anti-CRM(197) antibodies. Mice immunized with CRM(197) alone onto the tape-stripped skin mounted a vigorous antigen-specific proliferative response. In contrast, the induction of cellular immunity after CRM(197) deposition onto mildly ablated or intact skin was adjuvant dependent. Furthermore, epidermal cells were activated and underwent apoptosis that was more pronounced when the stratum corneum was removed by tape stripping. Overall, these findings highlight the potential for transcutaneous delivery of CRM(197) and establish a correlation between the degree of barrier disruption and levels of antigen-specific immune responses. Moreover, these results provide the first evidence that the development of a transcutaneous immunization strategy for diphtheria, based on simple and practical methods to disrupt the skin barrier, is feasible.

  13. Studies of {sup 194,195,197}Po

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others

    1995-08-01

    The energy systematics of low-lying polonium states show sudden changes near N = 114. The observed drops in the low-lying levels of {sup 196,198}Po relative to the heavier isotopes indicate significant changes in the underlying structure of these nuclei. It is thought that this change is due to the onset of vibrational collectivity brought about by the quadrupole interaction between neutron and proton-pairs. In order to extend the Po systematics even further, we measured, for the first time, states in {sup 194,195,197}Po using the {sup 28}Si + {sup 170}Yb reaction at a beam energy of 142 MeV. The beam was supplied by ATLAS, and the data were taken with 10 Compton-suppressed Ge detectors placed at the target position of the Fragment Mass Analyzer. Preliminary level schemes were constructed for {sup 194,195,197}Po based on {gamma}-{gamma} and {gamma}-FMA coincidences. The results for {sup 194}Po show that the 2{sup +} - 0{sup +} transition energy decreased in energy by 140 keV relative to {sup 196}Po suggesting that this nucleus moved beyond the vibrational limit to more collective motion. An extrapolation of the systematics predicts that the 2{sup +} energy could drop another 140 keV between {sup 194}Po and {sup 192}Po which would indicate the onset of rotational motion. Currently, we have an approved experiment to investigate the decay of yrast isomers in {sup 194}Po which will allow us to (1) confirm our earlier level scheme of {sup 194}Po, and (2) assess the experimental conditions needed for a future study of {sup 192}Po.

  14. Co-expression of sulphydryl oxidase and protein disulphide isomerase in Escherichia coli allows for production of soluble CRM197

    CSIR Research Space (South Africa)

    Roth, Robyn L

    2017-04-01

    Full Text Available The aim of this article is to investigate the production of soluble cross-reacting material 197 (CRM(sub197)) in Escherichia coli, a safe and effective T-cell-dependent protein carrier for polysaccharides used in the manufacture and application...

  15. Safety and immunogenicity of meningococcal ACWY CRM197-conjugate vaccine in children, adolescents and adults in Russia.

    Science.gov (United States)

    Ilyina, Natalia; Kharit, Susanna; Namazova-Baranova, Leila; Asatryan, Asmik; Benashvili, Mayya; Tkhostova, Elmira; Bhusal, Chiranjiwi; Arora, Ashwani Kumar

    2014-01-01

    Neisseria meningitidis is the leading cause of bacterial invasive infections in people aged safety of the quadrivalent meningococcal CRM197-conjugate vaccine MenACWY when administered to healthy Russian subjects aged 2 years and above. A total of 197 subjects were immunized with a single dose of the vaccine, and serogroup-specific serum bactericidal activity was measured pre and 1-month post-vaccination with human complement (hSBA) serum titers. Regardless of baseline serostatus, 1 month after a single dose of MenACWY-CRM197 85% (95%CI, 79-90%) of subjects showed serologic response against serogroup A, 74% (67-80%) against serogroup C, 60% (53-67%) against serogroup W, and 83% (77-88%) against serogroup Y. The percentage of subjects with hSBA titers ≥ 1:8 1 month after vaccination was 89% (83-93%) against serogroup A, 84% (78-89%) against serogroup C, 97% (93-99%) against serogroup W, and 88% (82-92%) against serogroup Y. Comparable results were obtained across all subjects: children (2 to 10 years), adolescents (11 to 17 years), and adults (≥18 years). The MenACWY-CRM197 vaccine showed an acceptable safety profile and was well tolerated across all age groups, with no serious adverse events or deaths reported during the study. In conclusion, a single dose of meningococcal MenACWY-CRM197 vaccine is immunogenic and has an acceptable safety profile, provides a broad protection against the most frequent epidemic serogroups, and is a suitable alternative to currently available unconjugated monovalent or bivalent polysaccharide vaccines in Russia.

  16. Carrier priming with CRM 197 or diphtheria toxoid has a different impact on the immunogenicity of the respective glycoconjugates: biophysical and immunochemical interpretation.

    Science.gov (United States)

    Pecetta, S; Lo Surdo, P; Tontini, M; Proietti, D; Zambonelli, C; Bottomley, M J; Biagini, M; Berti, F; Costantino, P; Romano, M R

    2015-01-03

    Glycoconjugate vaccines play an enormous role in preventing infectious diseases. The main carrier proteins used in commercial conjugate vaccines are the non-toxic mutant of diphtheria toxin (CRM197), diphtheria toxoid (DT) and tetanus toxoid (TT). Modern childhood routine vaccination schedules include the administration of several vaccines simultaneously or in close sequence, increasing the concern that the repeated exposure to conjugates based on these carrier proteins might interfere with the anti-polysaccharide response. Extending previous observations we show here that priming mice with CRM197 or DT does not suppress the response to the carbohydrate moiety of CRM197 meningococcal serogroup A (MenA) conjugates, while priming with DT can suppress the response to DT-MenA conjugates. To explain these findings we made use of biophysical and immunochemical techniques applied mainly to MenA conjugates. Differential scanning calorimetry and circular dichroism data revealed that the CRM197 structure was altered by the chemical conjugation, while DT and the formaldehyde-treated form of CRM197 were less impacted, depending on the degree of glycosylation. Investigating the binding and avidity properties of IgGs induced in mice by non-conjugated carriers, we found that CRM197 induced low levels of anti-carrier antibodies, with decreased avidity for its MenA conjugates and poor binding to DT and respective MenA conjugates. In contrast, DT induced high antibody titers able to bind with comparable avidity both the protein and its conjugates but showing very low avidity for CRM197 and related conjugates. The low intrinsic immunogenicity of CRM197 as compared to DT, the structural modifications induced by glycoconjugation and detoxification processes, resulting in conformational changes in CRM197 and DT epitopes with consequent alteration of the antibody recognition and avidity, might explain the different behavior of CRM197 and DT in a carrier priming context. Copyright © 2014

  17. Self-template synthesis of double shelled ZnS-NiS1.97 hollow spheres for electrochemical energy storage

    Science.gov (United States)

    Wei, Chengzhen; Ru, Qinglong; Kang, Xiaoting; Hou, Haiyan; Cheng, Cheng; Zhang, Daojun

    2018-03-01

    In this work, double shelled ZnS-NiS1.97 hollow spheres have been achieved via a simple self-template route, which involves the synthesis of Zn-Ni solid spheres precursors as the self-template and then transformation into double shelled ZnS-NiS1.97 hollow spheres by sulfidation treatment. The as-prepared double shelled ZnS-NiS1.97 hollow spheres possess a high surface area (105.26 m2 g-1) and porous structures. Benefiting from the combined characteristics of novel structures, multi-component, high surface area and porous. When applied as electrode materials for supercapacitors, the double shelled ZnS-NiS1.97hollow spheres deliver a large specific capacitance of 696.8C g-1 at 5.0 A g-1 and a remarkable long lifespan cycling stability (less 5.5% loss after 6000 cycles). Moreover, an asymmetric supercapacitor (ASC) was assembled by utilizing ZnS-NiS1.97 (positive electrode) and activated carbon (negative electrode) as electrode materials. The as-assembled device possesses an energy density of 36 W h kg-1, which can be yet retained 25.6 W h kg-1 even at a power density of 2173.8 W Kg-1, indicating its promising applications in electrochemical energy storage. More importantly, the self-template route is a simple and versatile strategy for the preparation of metal sulfides electrode materials with desired structures, chemical compositions and electrochemical performances.

  18. Resistance mutations of Pro197, Asp376 and Trp574 in the acetohydroxyacid synthase (AHAS) affect pigments, growths, and competitiveness of Descurainia sophia L.

    Science.gov (United States)

    Zhang, Yongzhi; Xu, Yufang; Wang, Shipeng; Li, Xuefeng; Zheng, Mingqi

    2017-11-27

    D. Sophia is one of the most problematic weed species infesting winter wheat in China, and has evolved high resistance to tribenuron-methyl. Amino acid substitutions at site of Pro197, Asp376 and Trp574 in acetohydroxyacid synthase (AHAS) were mainly responsible for D. sophia resistance to tribenuron-methyl. In this study, D. sophia plant individually homozygous for specific AHAS mutation (Pro197Leu, Pro197His, Pro197Ser, Pro197Thr, Asp376Glu and Trp574Leu) were generated. In addition, the effects of resistance mutations on pigments, growths and competitiveness of susceptible (S) and resistant (R) plants of D. sophia were investigated. The results indicated the R plants carrying Pro197Leu or Pro197His or Asp376Glu or Trp574Leu displayed stronger competitiveness than S plants. The adverse effects on R plants aggravated with the increase of R plants proportion, which made the R plants against domination the weed community in absent of herbicide selection. Therefore, these resistance mutation have no obvious adverse effects on the pigments (chlorophyll a, chlorophyll b and carotenoid), relative growth rates (RGR), leaf area ratio (LAR) and net assimilation rate (NAR) of R plants.

  19. Oblate collectivity in 197,198Pb

    International Nuclear Information System (INIS)

    Kuhnert, A.; Wang, T.F.; Stoyer, M.A.; Becker, J.A.; Henry, E.A.; Brinkman, M.J.; Yates, S.W.; Draper, J.E.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Machiavelli, A.O.; Kelly, W.H.; Korten, W.; Azaiez, F.; Cizewski, J.A.

    1993-01-01

    Evidence for collective behavior in the high-spin region of neutron deficient lead nuclei is provided by the observation of four collective structures in 197,198 Pb. These bands consist of strong dipole (M1) transitions with a few E2 crossover transitions observed. The transition energies of three of these bands show a rather regular behavior while those of one of them show an irregular behavior. We interpret the regular bands as oblate collective bands built on oblate proton and neutron states, whereas the irregular band might either be built on a state with very small oblate deformation, or be a triaxial rotational band. A lifetime measurement (DSAM) has been done for the regular bands in 198 Pb. Neutron and proton configurations for the bands are suggested from the results of quasi particle Routhians and total Routhian surface (TRS) calculations. (orig.)

  20. Oblate collectivity in 197,198Pb

    International Nuclear Information System (INIS)

    Kuhnert, A.; Wang, T.F.; Stoyer, M.A.; Becker, J.A.; Henry, E.A.; Brinkman, M.J.; Yates, S.W.; Draper, J.E.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Machiavelli, A.O.; Kelly, W.H.; Korten, W.; Azaiez, F.

    1992-07-01

    Evidence for collective behavior in the high-spin region of neutron deficient lead nuclei is provided by the observation of four collective structures in 197,198 Pb. These bands consist of strong dipole (M1) transitions with a few E2 crossover transitions observed. The transition energies of three of these bands show a rather regular behavior while those of one of them show an irregular behavior. We interpret the regular bands as oblate collective bands built on oblate proton and neutron states, whereas the irregular band might either be built on a state with very small oblate deformation, or be a triaxial rotational band. A lifetime measurement (DSAM) has been done for the regular bands in 198 Pb. Neutron and proton configurations for the bands are suggested from the results of quasi particle Routhians and total Routhian surface (TRS) calculations

  1. Negative Ion Source Development and Photodetachment Studies at ISOLDE

    CERN Document Server

    AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

    Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

  2. Neutral Hydrogen Absorption Toward XTE J1810-197: the Distance to a Radio-Emitting Magnetar

    OpenAIRE

    Minter, Anthony H.; Camilo, Fernando; Ransom, Scott M.; Halpern, Jules P.; Zimmerman, Neil

    2007-01-01

    We have used the Green Bank Telescope to measure HI absorption against the anomalous X-ray pulsar XTE J1810-197. Assuming a flat rotation curve, we find that XTE J1810-197 is located at a distance of 3.4(+0.5,-0.7) kpc. For a rotation curve that incorporates a model of the Galactic bar, we obtain a distance of 4.0(+0.3,-0.8) kpc. Using a rotation curve that incorporates a model of the Galactic bar and the spiral arms of the Galaxy, the distance is 3.7(+/-0.6) kpc. These values are consistent ...

  3. B(M1) values in the band-crossing of shears bands in 197Pb

    Science.gov (United States)

    Krücken, R.; Cooper, J. R.; Beausang, C. W.; Novak, J. R.; Dewald, A.; Klug, T.; Kemper, G.; von Brentano, P.; Carpenter, M.; Wiedenhöver, I.

    We present details of the band crossing mechanism of shears bands using the example of 197Pb. Absolute reduced matrix elements B(M1) were determined by means of a RDM lifetime measurement in one of the shears bands in 197Pb. The experiment was performed using the New Yale Plunger Device (NYPD) in conjunction with the Gammasphere array. Band mixing calculations on the basis of the semi-classical model of the shears mechanism are used to describe the transition matrix elements B(M1) and energies throughout the band-crossing regions. Good agreement with the data was obtained and the detailed composition of the states in the shears band are discussed.

  4. Novel methodology for the study of mercury methylation and reduction in sediments and water using {sup 197}Hg radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro Guevara, Sergio; Perez Catan, Soledad [Centro Atomico Bariloche, Laboratorio de Analisis por Activacion Neutronica, Bariloche (Argentina); Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena [Jozef Stefan Institute, Department of Environmental Sciences, Ljubljana (Slovenia)

    2007-03-15

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H{sub 2}SO{sub 4} or HCl were evaluated in freshwater sediments using {sup 197}Hg radiotracer. Values obtained for the {sup 197}Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of {sup 197}Hg{sup 2+} into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg{sup 2+} contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg{sup 2+} contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H{sub 2}SO{sub 4} method is recommended, since it is free from these interferences. {sup 197}Hg radiotracer (T{sub 1/2} = 2.673 d) has a production rate that is about 50 times higher than that of {sup 203}Hg (T{sub 1/2} = 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to {sup 203}Hg when it is used it in short-term experiments and produced by the irradiation of {sup 196}Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the {sup 196}Hg isotope is increased, the specific activity of the {sup 197}Hg tracer can be significantly improved. In

  5. Overexpression of long intergenic noncoding RNA LINC00312 inhibits the invasion and migration of thyroid cancer cells by down-regulating microRNA-197-3p.

    Science.gov (United States)

    Liu, Kai; Huang, Wen; Yan, Dan-Qing; Luo, Qing; Min, Xiang

    2017-08-31

    The study evaluated the ability of long intergenic noncoding RNA LINC00312 (LINC00312) to influence the proliferation, invasion, and migration of thyroid cancer (TC) cells by regulating miRNA-197-3p. TC tissues and adjacent normal tissues were collected from 211 TC patients. K1 (papillary TC), SW579 (squamous TC), and 8505C (anaplastic TC) cell lines were assigned into a blank, negative control (NC), LINC00312 overexpression, miR-197-3p inhibitors, and LINC00312 overexpression + miR-197-3p mimics group. The expression of LINC00312, miR-197-3p , and p120 were measured using quantitative real-time PCR (qRT-PCR) and Western blotting. Cell proliferation was assessed via CCK8 assay, cell invasion through the scratch test, and cell migration via Transwell assay. In comparison with adjacent normal tissues, the expression of LINC00312 is down-regulated and the expression of miR-197-3p is up-regulated in TC tissues. The dual luciferase reporter gene assay confirmed that P120 is a target of miR-197-3p The expression of LINC00312 and p120 was higher in the LINC00312 overexpression group than in the blank and NV groups. However, the expression of miR-197-3p was lower in the LINC00312 overexpression group than in the blank and NC groups. The miR-197-3p inhibitors group had a higher expression of miR-197-3p , but a lower expression of p120 than the blank and NC groups. The LINC00312 overexpression and miR-197-3p inhibitor groups had reduced cell proliferation, invasion and migration than the blank and NC groups. These results indicate that a LINC00312 overexpression inhibits the proliferation, invasion, and migration of TC cells and that this can be achieved by down-regulating miR-197-3p . © 2017 The Author(s).

  6. Research on the uptake of mercury 197 acetate in early bronchial cancers and on the variation of this uptake during drug therapy

    International Nuclear Information System (INIS)

    Gautier, H.M.

    1975-01-01

    Mercury 197 was proposed as a means to analyze the behavior of early bronchial cancers, especially during drug treatment. This choice was based on four facts: a hyperfixation of mercury has already been demonstrated in malignant intrathoracic tumors; the use of mercury 197 in acetate form gives higher uptake rates than those observed with bichloride; because of its properties mercury 197 is easy to use in routine radioisotopic practice; mercury toxicity is negligible with the preparation employed. The work was performed in two stages: analysis of the uptake conditions for mercury 197 in acetate form in order to detect the factors which influence this uptake and to define its limits and advantages; on the basis of the above notions, use of mercury 197 as tracer to follow the development of bronchial tumors, the aim being to observe the tumor volume variation under drug treatment (the changes in uptake rate are analyzed and the numerical results obtained used to estimate the degree of efficiency of the treatment proposed, the moment of maximum result and the start of a new tumoral growth) [fr

  7. Development and therapeutic application of internally emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Bloomer, W.D.

    1980-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

  8. Fission fragment angular distributions in proton-induced fission of 209Bi (p,f) and 197Au (p,f)

    International Nuclear Information System (INIS)

    Soheily, S.; Noshad, H.; Lamehi-Rashti, M.

    2002-01-01

    The fission fragment angular distributions have been measured for proton-induced fission of 209 B i and 197 A u nuclei using surface barrier detectors at several energies between 25 MeV and 30 MeV. The experimental anisotropies are found to be in agreement with the predictions of the Standard Saddle-Point Statistical Model. The fission cross sections of 209 B i and 197 A u nuclei were also measured and compared with the previous works

  9. 26 CFR 1.197-1T - Certain elections for intangible property (temporary).

    Science.gov (United States)

    2010-04-01

    ...) to apply prior law to property acquired pursuant to a written binding contract in effect on August 10... section 13261 of OBRA '93 (e.g., the amendment of section 1253 in the case of a franchise, trademark, or... section 197 intangible with an unadjusted basis of $180. Under prior law, no amortization or depreciation...

  10. Study of multi-quasiparticle band structures in 197Tl using α beam

    International Nuclear Information System (INIS)

    Mukherjee, G.; Nandi, S.; Pai, H.

    2016-01-01

    Study of the multi-quasiparticle (qp) states and the band structures built on them in the neutron deficient Tl nuclei in A ∼ 190 mass region provides useful information on particle-hole interaction in the heavy nuclei. In order to investigate the multi-qp band structures we have studied the excited states in 197 Tl by gamma ray spectroscopy

  11. Conformance to Regulatory Guide 1.97, Perry Nuclear Power Plant, Unit Nos. 1 and 2 (Docket Nos. 50-440 and 50-441)

    International Nuclear Information System (INIS)

    Udy, A.C.

    1985-03-01

    This EG and G Idaho, Inc., report provides a review of the submittals for Regulatory Guide 1.97, Revision 2, for the Perry Nuclear Power Plant, Unit Nos. 1 and 2. Any exception to the guidelines of Regulatory Guide 1.97 are evaluated

  12. Study of subthreshold pion mesons of 86Kr + 197Au reaction

    International Nuclear Information System (INIS)

    Ma Yugang; Shen Wenqing; Ge Lingxiao; Zhan Wenlong; Wang Bing; Zhu Yongtai; Feng Jun; Zeng Yaowu; Guo Zhongyan; Zhou Jianqun

    1991-01-01

    Authors investigated the subthreshold pions multiplicity for 86 Kr + 197 Au system in non-relativistic BUU frame. The aims were to obtain some qualitative conclusions about pions production and absorption process. Because the production of pions and other energetic particles are a very complicated problem in HIC, nowadays a full self-consistent and effective theoretical approach has not yet been presented, the more detail and further research work must be done

  13. Measurement of isotopic cross sections of spallation residues in 800 A MeV {sup 197}Au + p collisions

    Energy Technology Data Exchange (ETDEWEB)

    Rejmund, F.; Mustapha, B.; Bernas, M.; Stephan, C.; Taieb, J.; Tassan-Got, L. [Institut de Physique Nucleaire, (IN2P3/CNRS) 91 - Orsay (France); Armbruster, P.; Benlliure, J.; Enqvist, T.; Schmidt, K.H.; Taieb, J. [GSI, Planckstrasse, Darmstadt (Germany); Benlliure, J. [Universidad de Santiago de Compostela (Spain); Boudard, A.; Legrain, R.; Leray, S.; Volant, C. [CEA/Saclay, Dept. d' Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l' Instrumentation Associee (DAPNIA), 91 - Gif-sur-Yvette (France); Dufour, J.P. [CENBG, IN2P3, 33 - Gradignan (France)

    2000-07-01

    The spallation of {sup 197}Au by 800 MeV protons was investigated in inverse kinematics at GSI, Darmstadt, by use of a {sup 197}Au beam bombarding a liquid-hydrogen target. The fragment separator (FRS) was used to select and identify the reaction products prior to {beta} decay. The individual production cross sections and the kinematical properties of 396 isotopes for all elements between mercury (Z=80) and neodymium (Z=60) have been measured. A comparison with Monte Carlo calculations based on different two-step models of the spallation reaction is given. The shape of the isotopic distributions close to the projectile is found to differ strongly from that resulting from aluminium-induced fragmentation of {sup 197}Au. The mean kinetic energies of the fragments are deduced from the experimental data. The importance of the new data to improve our understanding of the spallation mechanism and the relevance for the design of accelerator-driven sub-critical reactors is discussed. (authors)

  14. Conformance to Regulatory Guide 1.97 Slurry Power Station, Unit Nos. 1 and 2 (Docket Nos. 50-280 and 50-281)

    International Nuclear Information System (INIS)

    Stoffel, J.W.

    1985-09-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97, Revision 3, for Unit Nos. 1 and 2 of the Surry Power Station and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  15. 197Au Moessbauer study of nano-sized gold catalysts supported on Mg(OH)2 and TiO2

    International Nuclear Information System (INIS)

    Kobayashi, Y.; Nasu, S.; Tsubota, S.; Haruta, M.

    2000-01-01

    We have studied nano-sized Au catalysts supported on Mg(OH) 2 and TiO 2 using 197 Au Moessbauer spectroscopy. 197 Au Moessbauer spectra observed for Au/Mg(OH) 2 catalysts can be decomposed into one singlet with zero isomer shift and several doublets. One of the doublets shows an isomer shift that is typical for Au I , and other doublets are due to Au III . The relative area of the Au I component shows the maximum value for a specimen calcined at 523 K, which also shows the highest catalytic activity

  16. 197Au(d,3He)196Pt reaction and the supersymmetry scheme

    International Nuclear Information System (INIS)

    Vergnes, M.; Berrier-Ronsin, G.; Rotbard, G.; Vernotte, J.; Langevin- Joliot, H.; Gerlic, E.; Wiele, J. van de; Guillot, J.

    1981-01-01

    The 197 Au(d, 3 He) 196 Pt reaction has been studied at Esub(d) = 108 MeV. An important breakdown of the selection rules of the supersymmetry scheme is observed for the 2 2 + level. The generally strong excitation of the 2 2 + level by transfer reactions in the Pt region leads to question the validity of the supersymmetry scheme at least for this level

  17. Conformance to Regulatory Guide 1.97, Joseph M. Farley Nuclear Plant, Unit Nos. 1 and 2 (Docket No. 50-348 and 50-364)

    International Nuclear Information System (INIS)

    Stoffel, J.W.

    1985-05-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97 for Unit Nos. 1 and 2 of the Joseph M. Farley Nuclear Plant and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  18. Some Peculiarities in the Interaction of $^{6}$He with $^{197}$Au and $^{206}$Pb

    CERN Document Server

    Penionzhkevich, Yu E; Demekhina, N A; Dlouhý, Z; Kalpakchieva, R; Kulko, A A; Lobastov, S P; Lukyanov, S M; Markaryan, E R; Maslov, V A; Muzycjka, Yu A; Oganessian, Yu T; Rassadov, D N; Skobelev, N K; Sobolev, Yu G; Ugryumov, V Yu; Vincour, J; Zholdybaev, T

    2005-01-01

    Excitation functions were measured for fusion followed by the evaporation of neutrons in the reactions $^{206}$Pb($^{6}$He, 2$n$)$^{210}$Po and $^{197}$Au($^{6}$He, $xn$)$^{203 - xn}$Tl, where $x$ = 2-7, as well as for the transfer reactions on a $^{197}$Au target with the formation of the $^{196}$Au, $^{198}$Au and $^{199}$Au isotopes. The experiment was carried out at the Dubna Radioactive Ion Beams (DRIBs) complex of FLNR, JINR. The $^{6}$He-beam intensity was about 5$\\cdot$10$^{6 }$ s$^{-1}$, the maximum energy being (60.3$\\pm $0.4) MeV. A significant increase in the cross section was observed below the Coulomb barrier for the fusion reaction with the evaporation of two neutrons compared to statistical model calculations. Unusual behaviour for the production of $^{198}$Au is observed, whereas the cross section for the formation of $^{199}$Au is very low. The analysis of the data in the framework of the statistical model for the decay of excited nuclei, which took into account the sequential fusion of $^{6...

  19. Conformance to Regulatory Guide 1.97, Shearon Harris Nuclear Power Plant, Unit Nos. 1 and 2 (Docket Nos. 50-400 and 50-401)

    International Nuclear Information System (INIS)

    Stoffel, J.W.

    1985-09-01

    This EG and G Idaho, Inc. report reviews the submittals for Regulatory Guide 1.97, Revision 3, for Unit Nos. 1 and 2 of the Shearon Harris Nuclear Power Plant and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified. 7 refs

  20. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  1. 100-MeV proton beam intensity measurement by Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Oh, Joo-Hee [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-05-15

    The proton beam intensity of a 100-MeV proton linac at the Korea Multi-purpose Accelerator Complex (KOMAC) was measured by an Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions to determine the accuracy and precision of beam intensity measurement using Gafchromic film dosimetry method. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of Au, Al foils and Pb plates. The yields of produced radio-nuclei in Au foils were obtained by gamma-ray spectroscopy. The FLUKA code was employed to calculate the energy spectrum of protons onto the front surface of Au foils located at three different depth points of the target and also to investigate the condition of incident beam on the target. A good agreement was found between the beam intensity measurements using the activation analysis method at three different depth points of the target. An excellent agreement was also observed between the beam intensity measurements using the Au activation analysis method and the dosimetry method using Gafchromic film.

  2. Analysis of manganese superoxide dismutase (MnSOD: Ala-9Val and glutathione peroxidase (GSH-Px: Pro 197 Leu gene polymorphisms in mood disorders.

    Directory of Open Access Journals (Sweden)

    Birgül Elbozan Cumurcu

    2013-05-01

    Full Text Available We investigated the etiopathogenetic role of manganese superoxide dismutase (MnSOD (Ala-9Val and glutathione peroxidase (GSH-Px (Pro 197 Leu gene polymorphisms in patients diagnosed with major depressive disorder (MDD and bipolar I disorder (BD. Eighty patients with MDD, 82 patients with BD (total 162 patients and 96 healthy controls were enrolled in this study and genotyped using a Real Time-Quantitative Polymer Chain Reaction (RT-qPCR-based method. The patients with BD and MDD and the controls had a similar distribution of the genotypes and alleles in the Ala-9Val MnSOD gene polymorphism. Comparison of the MDD group and control group regarding the Pro197 Leu GSH-Px gene polymorphism revealed similar genotype distribution but different allele distribution. The BD group and control group were similar both for genotypes and for alleles when compared regarding the Pro 197 Leu GSH-Px gene polymorphism. The combined analysis (MDD plus BD also failed to find any association between the Ala-9Val MnSOD and Pro 197 Leu GSH-Px gene polymorphism. Although small statistical power of the current study the significant difference between patients with depression and the control group for the Pro 197 Leu GSH-Px polymorphism indicates that the distribution of these alleles may have a contribution in the physiopathogenesis of depression. One of the limitation of the current study is that the sample size is too small. Understanding of the exact role of Pro 197 LeuGSH-Px polymorphism in the development of depression needs to further studies with more sample size and high statistical power.

  3. Deletion of a 197-Amino-Acid Region in the N-Terminal Domain of Spike Protein Attenuates Porcine Epidemic Diarrhea Virus in Piglets.

    Science.gov (United States)

    Hou, Yixuan; Lin, Chun-Ming; Yokoyama, Masaru; Yount, Boyd L; Marthaler, Douglas; Douglas, Arianna L; Ghimire, Shristi; Qin, Yibin; Baric, Ralph S; Saif, Linda J; Wang, Qiuhong

    2017-07-15

    We previously isolated a porcine epidemic diarrhea virus (PEDV) strain, PC177, by blind serial passaging of the intestinal contents of a diarrheic piglet in Vero cell culture. Compared with the highly virulent U.S. PEDV strain PC21A, the tissue culture-adapted PC177 (TC-PC177) contains a 197-amino-acid (aa) deletion in the N-terminal domain of the spike (S) protein. We orally inoculated neonatal, conventional suckling piglets with TC-PC177 or PC21A to compare their pathogenicities. Within 7 days postinoculation, TC-PC177 caused mild diarrhea and lower fecal viral RNA shedding, with no mortality, whereas PC21A caused severe clinical signs and 55% mortality. To investigate whether infection with TC-PC177 can induce cross-protection against challenge with a highly virulent PEDV strain, all the surviving piglets were challenged with PC21A at 3 weeks postinoculation. Compared with 100% protection in piglets initially inoculated with PC21A, 88% and 100% TC-PC177- and mock-inoculated piglets had diarrhea following challenge, respectively, indicating incomplete cross-protection. To investigate whether this 197-aa deletion was the determinant for the attenuation of TC-PC177, we generated a mutant (icPC22A-S1Δ197) bearing the 197-aa deletion from an infectious cDNA clone of the highly virulent PEDV PC22A strain (infectious clone PC22A, icPC22A). In neonatal gnotobiotic pigs, the icPC22A-S1Δ197 virus caused mild to moderate diarrhea, lower titers of viral shedding, and no mortality, whereas the icPC22A virus caused severe diarrhea and 100% mortality. Our data indicate that deletion of this 197-aa fragment in the spike protein can attenuate a highly virulent PEDV, but the virus may lose important epitopes for inducing robust protective immunity. IMPORTANCE The emerging, highly virulent PEDV strains have caused substantial economic losses worldwide. However, the virulence determinants are not established. In this study, we found that a 197-aa deletion in the N-terminal region

  4. Catalytic residues Lys197 and Arg199 of Bacillus subtilis phosphoribosyl diphosphate synthase. Alanine-scanning mutagenesis of the flexible catalytic loop

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne; Bentsen, Ann-Kristin K; Harlow, Kenneth W

    2005-01-01

    Eleven of the codons specifying the amino acids of the flexible catalytic loop [KRRPRPNVAEVM(197-208)] of Bacillus subtilis phosphoribosyl diphosphate synthase have been changed individually to specify alanine. The resulting variant enzyme forms, as well as the wildtype enzyme, were produced...... in an Escherichia coli strain lacking endogenous phosphoribosyl diphosphate synthase activity and purified to near homogeneity. The B. subtilis phosphoribosyl diphosphate synthase mutant variants K197A and R199A were studied in detail. The physical properties of the two enzymes were similar to those of the wildtype...

  5. Fission of {sup 209}Bi and {sup 197}Au nuclei induced by 30 MeV protons

    Energy Technology Data Exchange (ETDEWEB)

    Noshad, Houshyar; Soheyli, Saeed [Amir-Kabir University of Technology, Physics and Nuclear Science Department, Tehran (Iran); Lamehi-Rachti, Mohammad [Atomic Energy Organization of Iran (AEOI), Nuclear Research Center, Van de Graaff Laboratory, Tehran (Iran)

    2001-10-01

    Thin targets of {sup 209}Bi and {sup 197}Au were bombarded with 30 MeV protons at the Cyclotron Department of Nuclear Research Center for Agriculture and Medicine (NRCAM). Correlated measurements of kinetic energies of fission fragment pairs, and their time-of-flights were made using pair spectrometry. The fission cross sections, fragment mass distributions, and total kinetic energy distributions of the fragments were measured in our experiment. The accurate values of cross sections for fission of {sup 209}Bi and {sup 197}Au nuclei with 30 MeV protons were obtained to be 1,100{+-}100 and 62{+-}5.6 {mu}b, respectively. The cross section of {sup 209}Bi fission with its associated error, through using this method, has not been reported previously. The interpretation in terms of liquid-drop model of fissioning nucleus {sup 210}Po at the excitation energy of 35 MeV was confirmed by the dispersion of the distribution in fragment mass for bismuth fission. (author)

  6. Fast neutron capture in 197Au and the gamma-ray strength function

    International Nuclear Information System (INIS)

    Earle, E.D.; Bergqvist, I.; Nilsson, L.

    1977-08-01

    Gamma-ray spectra from the reaction 197 Au(n,γ) 198 Au have been measured at several incident energies between 30 keV and 2.5 MeV. The γ-ray detector was a NaI(Tl) scintillation detector and time-of-flight techniques were utilized to suppress background. A γ-ray strength function was deduced from the spectra by a spectrum fitting method. The strength function indicates a resonance-like structure at E(γ) approximately 5.5 MeV. Comparison is made with the γ-ray strength derived from photonuclear work.(author)

  7. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Koziorowski, J.

    1998-01-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

  8. Assessment of immunogenicity and safety following primary and booster immunisation with a CRM197 -conjugated Haemophilus influenzae type B vaccine in healthy Chinese infants.

    Science.gov (United States)

    Jun, L; Yuguo, C; Zhiguo, W; Jinfeng, L; Huawei, M; Xiuhua, L; Yonggui, Z; Yanhua, X; Kong, Y; Hongtao, L; Yuliang, Z

    2013-10-01

    Invasive meningitis and pneumonia caused by Haemophilus influenzae type b (Hib) is an important cause of childhood mortality in countries where Hib vaccination is not routine. We evaluated the non-inferiority of a licensed Hib vaccine, PRP-CRM(197) compared with a second licensed Hib vaccine, PRP-T, following the recommended Chinese immunisation schedule for infants between 6 months and 1 year of age. In the first study phase, 6-12 month-old infants received two primary doses of either PRP-CRM(197) (n = 335) or PRP-T (n = 335) vaccine administered 1 month apart. In the second study phase 8 months later, the same children received a single booster dose of vaccine identical to that use for priming (PRP-CRM(197), n = 327; PRP-T, n = 333). Serum levels of anti-polyribosylribitol phosphate (PRP) antibodies were measured using enzyme-linked immunosorbent assay (ELISA). Non-inferiority of primary and booster doses was assessed in terms of percentages of subjects with anti-PRP antibody levels associated with providing short-term (≥ 0.15 μg/ml) and long-term (≥ 1.0 μg/ml) protection; the non-inferiority margin was set at -5%. PRP-CRM(197) was demonstrated to be non-inferior to PRP-T. Anti-PRP antibodies levels ≥ 0.15 μg/ml and ≥ 1.0 μg/ml were achieved by 97% of infants in the PRP-CRM(197) group and 98% of infants in the PRP-T group 1 month after primary immunisation, and by all subjects (100%) in both vaccine groups 1 month after booster administration. Safety profiles for both vaccines were similar; no serious adverse events, deaths or adverse events leading to withdrawal occurred during the study. PRP-CRM(197) was well-tolerated and immunologically non-inferior to a licensed comparator Hib vaccine in Chinese infants (Clinicaltrials.gov: NCT01044316 & NCT01226953). © 2013 John Wiley & Sons Ltd.

  9. Methodological considerations regarding the use of inorganic 197Hg(II) radiotracer to assess mercury methylation potential rates in lake sediment

    International Nuclear Information System (INIS)

    Perez Catan, Soledad; Guevara, Sergio Ribeiro; Marvin-DiPasquale, Mark; Magnavacca, Cecilia; Cohen, Isaac Marcos; Arribere, Maria

    2007-01-01

    Methodological considerations on the determination of benthic methyl-mercury (CH 3 Hg) production potentials were investigated on lake sediment, using 197 Hg radiotracer. Three methods to arrest bacterial activity were compared: flash freezing, thermal sterilization, and γ-irradiation. Flash freezing showed similar CH 3 Hg recoveries as thermal sterilization, which was both 50% higher than the recoveries obtained with γ-ray irradiation. No additional radiolabel was recovered in kill-control samples after an additional 24 or 65 h of incubation, suggesting that all treatments were effective at arresting Hg(II)-methylating bacterial activity, and that the initial recoveries are likely due to non-methylated 197 Hg(II) carry-over in the organic extraction and/or [ 197 Hg]CH 3 Hg produced via abiotic reactions. Two CH 3 Hg extraction methods from sediment were compared: (a) direct extraction into toluene after sediment leaching with CuSO 4 and HCl and (b) the same extraction with an additional back-extraction step to thiosulphate. Similar information was obtained with both methods, but the low efficiency observed and the extra work associated with the back-extraction procedure represent significant disadvantages, even tough the direct extraction involves higher Hg(II) carry over

  10. Conformance to Regulatory Guide 1.97 Browns Ferry Nuclear Plant, Unit Nos. 1, 2 and 3 (Docket Nos. 50-259, 50-260, and 50-296)

    International Nuclear Information System (INIS)

    Udy, A.C.

    1985-07-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97, Revision 3, for Unit Nos. 1, 2 and 3 of the Browns Ferry Nuclear Plant and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  11. A new carbon additive compounded Li3V1.97Zn0.05(PO4)3/C cathode for plug-in hybrid electric vehicles

    International Nuclear Information System (INIS)

    Wang, Wenhui; Zhang, Jiaolong; Lin, Yue; Ding, Fei; Chen, Zhenyu; Dai, Changsong

    2015-01-01

    The application of lithium ion batteries in plug-in hybrid electric vehicles (PHEVs) requires safety, high energy density, high power density, excellent cyclability and good low temperature performance. On the basis of thermally stable Li 3 V 2 (PO 4 ) 3 /C and cost-effective performance carbon additives, we designed a Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) (PB stands for performance carbon additives PBX101) cathode that meets the above requirements for PHEVs battery. Firstly, its Ragone plot presents an excellent energy density retention at high power rates; secondly, the excellent capacity retention and high Coulombic efficiency of Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB)-Li half-cell clearly indicates a potential good cyclability of full cells based on Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) cathode. Finally, we believe the good low temperature performance of Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) (i.e. retains 91.6% and 76.3% of its capacity at ∼25 °C, when cycled at 0 and -15 °C) is also beneficial to its application in PHEVs

  12. 19 CFR 10.197 - Direct costs of processing operations performed in a beneficiary country or countries.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Direct costs of processing operations performed in... TO A REDUCED RATE, ETC. Caribbean Basin Initiative § 10.197 Direct costs of processing operations... operations. As used in § 10.195 and § 10.198, the words “direct costs of processing operations” mean those...

  13. The fragment ion C13H9O2 m/z 197 in the mass spectra of 2-(2'-R-phenyl)benzoic acids

    International Nuclear Information System (INIS)

    Gills, R.G.; Porter, Q.N.

    1990-01-01

    In the electron impact mass spectrum of 2-( ' -R-phenyl)benzoic acids where R = H, NO 2 , OCH 3 , COOH, or Br, and abundant fragment ion m/z 197 is formed by an ipso substitution in which R is expelled as a radical. The structure of the ion m/z 197 has been shown by collision-activated dissociation to be identical with that of the protonated molecule formed by methane chemical ionization of 6H-dibenzo[b,d]pyran-6-one. 11 refs., 1 fig., ills

  14. Biofilm formation and cellulose expression by Bordetella avium 197N, the causative agent of bordetellosis in birds and an opportunistic respiratory pathogen in humans.

    Science.gov (United States)

    McLaughlin, Kimberley; Folorunso, Ayorinde O; Deeni, Yusuf Y; Foster, Dona; Gorbatiuk, Oksana; Hapca, Simona M; Immoor, Corinna; Koza, Anna; Mohammed, Ibrahim U; Moshynets, Olena; Rogalsky, Sergii; Zawadzki, Kamil; Spiers, Andrew J

    2017-06-01

    Although bacterial cellulose synthase (bcs) operons are widespread within the Proteobacteria phylum, subunits required for the partial-acetylation of the polymer appear to be restricted to a few γ-group soil, plant-associated and phytopathogenic pseudomonads, including Pseudomonas fluorescens SBW25 and several Pseudomonas syringae pathovars. However, a bcs operon with acetylation subunits has also been annotated in the unrelated β-group respiratory pathogen, Bordetella avium 197N. Our comparison of subunit protein sequences and GC content analyses confirms the close similarity between the B. avium 197N and pseudomonad operons and suggests that, in both cases, the cellulose synthase and acetylation subunits were acquired as a single unit. Using static liquid microcosms, we can confirm that B. avium 197N expresses low levels of cellulose in air-liquid interface biofilms and that biofilm strength and attachment levels could be increased by elevating c-di-GMP levels like the pseudomonads, but cellulose was not required for biofilm formation itself. The finding that B. avium 197N is capable of producing cellulose from a highly-conserved, but relatively uncommon bcs operon raises the question of what functional role this modified polymer plays during the infection of the upper respiratory tract or survival between hosts, and what environmental signals control its production. Copyright © 2017 Institut Pasteur. All rights reserved.

  15. Immunogenicity and safety of a fully liquid aluminum phosphate adjuvanted Haemophilus influenzae type b PRP-CRM197-conjugate vaccine in healthy Japanese children: A phase III, randomized, observer-blind, multicenter, parallel-group study.

    Science.gov (United States)

    Togashi, Takehiro; Mitsuya, Nodoka; Kogawara, Osamu; Sumino, Shuji; Takanami, Yohei; Sugizaki, Kayoko

    2016-08-31

    Broad use of monovalent Haemophilus influenzae type b (Hib) conjugate vaccines based on the capsular polysaccharide polyribosyl-ribitol phosphate (PRP), has significantly reduced invasive Hib disease burden in children worldwide, particularly in children aged vaccine has been widely used since the initiation of public funding programs followed by a routine vaccination designation in 2013. We compared the immunogenicity and safety of PRP conjugated to a non-toxic diphtheria toxin mutant (PRP-CRM197) vaccine with the PRP-T vaccine when administered subcutaneously to healthy Japanese children in a phase III study. Additionally, we evaluated the immunogenicity and safety profiles of a diphtheria-tetanus acellular pertussis (DTaP) combination vaccine when concomitantly administered with either PRP-CRM197 or PRP-T vaccines. The primary endpoint was the "long-term seroprotection rate", defined as the group proportion with anti-PRP antibody titers ⩾1.0μg/mL, after the primary series. Long-term seroprotection rates were 99.3% in the PRP-CRM197 group and 95.6% in the PRP-T group. The intergroup difference (PRP-CRM197 group - PRP-T group) was 3.7% (95% confidence interval: 0.099-7.336), demonstrating that PRP-CRM197 vaccine was non-inferior to PRP-T vaccine (pvaccination was higher in the PRP-CRM197 group than in PRP-T. Concomitant administration of PRP-CRM197 vaccine with DTaP vaccine showed no differences in terms of immunogenicity compared with concomitant vaccination with PRP-T vaccine and DTaP vaccine. Although CRM197 vaccine had higher local reactogenicity, overall, both Hib vaccines had acceptable safety and tolerability profiles. The immunogenicity of PRP-CRM197 vaccine administered subcutaneously as a three-dose primary series in children followed by a booster vaccination 1year after the primary series induced protective levels of Hib antibodies with no safety or tolerability concerns. Registered on ClinicalTrials.gov: NCT01379846. Copyright © 2016 The Authors

  16. Bremsstrahlung properties in 129 Xe + 197 Au reactions at 44 MeV/Nucleon = setting of Taps

    International Nuclear Information System (INIS)

    Merrouch, R.; Delagrange, H.; Lefevre, F.; Mittig, W.; Ostendorf, R.; Schutz, Y.; Berg, F.D.; Kuhn, W.; Metag, V.; Novotny, R.; Pfeiffer, M.; Boonstra, A.L.; Loehner, H.; Venema, L.B.; Wilschut, H.W.; Ardouin, D.; Dabrowski, H.; Erazmus, B.; Lebrun, D.; Sezac, L.; Matulewicz, T.; Ballester, F.; Casal, E.; Diaz, J.; Ferrero, J.L.; Marques, M.; Martinez, G.; Sujkowski, Z.

    1991-01-01

    The start of operation, at GANIL, of the TAPS photon multidetector is described, as well as the various phases of data exploitation leading to pure photon events. Characteristics of the Bremstrahlung emission in 129 Xe + 197 Au at 44 MeV per nucleon are presented. The good agreement between our results and similar data confirms the good operation of TAPS [fr

  17. Notes on the dosimetry and toxicity of 197HgCl2

    International Nuclear Information System (INIS)

    Valeyre, J.

    1976-01-01

    The interest raised by quantitative kidney scintigraphy lies to a large extent in the fact that the renal cortex fixes mercury very strongly. Under these conditions it is logical to evaluate as accurately as possible the dose absorbed not only by the kidneys but also by the ovaries, situated near-by. The different calculations presented show a total absorbed dose of 32 to 98mrads/μCi in the kidney. The average total dose absorbed by each ovary varies from 0.038 in adults to 0.136mrad/μCi in young children. Recent preparations of 197 HgCl 2 contain 2 to 5μg mercury per 150μCi. The toxicity of mercury should in no case be considered a problem [fr

  18. Conjugation of the CRM197-inulin conjugate significantly increases the immunogenicity of Mycobacterium tuberculosis CFP10-TB10.4 fusion protein.

    Science.gov (United States)

    Hu, Shun; Yu, Weili; Hu, Chunyang; Wei, Dong; Shen, Lijuan; Hu, Tao; Yi, Youjin

    2017-11-01

    Mycobacterium tuberculosis (Mtb) is a serious fatal pathogen that causes tuberculosis (TB). Effective vaccination is urgently needed to deal with the serious threat from TB. Mtb-secreted protein antigens are important virulence determinants of Mtb with poor immunogenicity. Adjuvants and antigen delivery systems are thus highly desired to improve the immunogenicity of protein antigens. Inulin is a biocompatible polysaccharide (PS) adjuvant that can stimulate a strong cellular and humoral immunity. Bacterial capsular PS and haptens have been conjugated with cross-reacting material 197 (CRM 197 ) to improve their immunogenicity. CFP10 and TB10.4 were two Mtb-secreted immunodominant protein antigens. A CFP10-TB10.4 fusion protein (CT) was used as the antigen for covalent conjugation with the CRM 197 -inulin conjugate (CRM-inu). The resultant conjugate (CT-CRM-inu) elicited high CT-specific IgG titers, stimulated splenocyte proliferation and provoked the secretion of Th1-type and Th2-type cytokines. Conjugation with CRM-inu significantly prolonged the systemic circulation of CT and exposure to the immune system. Moreover, CT-CRM-inu showed no apparent toxicity to cardiac, hepatic and renal functions. Thus, conjugation of CT with CRM-inu provided an effective strategy for development of protein-based vaccines against Mtb infection. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Methodological considerations regarding the use of inorganic {sup 197}Hg(II) radiotracer to assess mercury methylation potential rates in lake sediment

    Energy Technology Data Exchange (ETDEWEB)

    Perez Catan, Soledad [Laboratorio de Analisis por Activacion Neutronica, Comision Nacional de Energia Atomica, Centro Atomico Bariloche, 8400 Bariloche (Argentina); Guevara, Sergio Ribeiro [Laboratorio de Analisis por Activacion Neutronica, Comision Nacional de Energia Atomica, Centro Atomico Bariloche, 8400 Bariloche (Argentina)], E-mail: ribeiro@cab.cnea.gov.ar; Marvin-DiPasquale, Mark [US Geological Survey, 345 Middlefield Rd./MS 480, Menlo Park, CA 94025 (United States); Magnavacca, Cecilia [Centro Atomico Ezeiza, Comision Nacional de Energia Atomica, Presbitero Gonzalez y Aragon No. 15, B1802AYA, Ezeiza, Buenos Aires (Argentina); Cohen, Isaac Marcos [Departamento de Ingenieria Quimica, Facultad Regional Buenos Aires, Universidad Tecnologica Nacional, Medrano 951 (C1179AAQ) Buenos Aires (Argentina); Arribere, Maria [Laboratorio de Analisis por Activacion Neutronica, Comision Nacional de Energia Atomica, Centro Atomico Bariloche, 8400 Bariloche (Argentina)

    2007-09-15

    Methodological considerations on the determination of benthic methyl-mercury (CH{sub 3}Hg) production potentials were investigated on lake sediment, using {sup 197}Hg radiotracer. Three methods to arrest bacterial activity were compared: flash freezing, thermal sterilization, and {gamma}-irradiation. Flash freezing showed similar CH{sub 3}Hg recoveries as thermal sterilization, which was both 50% higher than the recoveries obtained with {gamma}-ray irradiation. No additional radiolabel was recovered in kill-control samples after an additional 24 or 65 h of incubation, suggesting that all treatments were effective at arresting Hg(II)-methylating bacterial activity, and that the initial recoveries are likely due to non-methylated {sup 197}Hg(II) carry-over in the organic extraction and/or [{sup 197}Hg]CH{sub 3}Hg produced via abiotic reactions. Two CH{sub 3}Hg extraction methods from sediment were compared: (a) direct extraction into toluene after sediment leaching with CuSO{sub 4} and HCl and (b) the same extraction with an additional back-extraction step to thiosulphate. Similar information was obtained with both methods, but the low efficiency observed and the extra work associated with the back-extraction procedure represent significant disadvantages, even tough the direct extraction involves higher Hg(II) carry over.

  20. Gold nanoparticles production using reactor and cyclotron based methods in assessment of {sup 196,198}Au production yields by {sup 197}Au neutron absorption for therapeutic purposes

    Energy Technology Data Exchange (ETDEWEB)

    Khorshidi, Abdollah, E-mail: abkhorshidi@yahoo.com

    2016-11-01

    Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of {sup 197}Au(n,γ){sup 196,198}Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. {sup 197}Au nano-solution, including 20 nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E + 13 n/cm{sup 2}/s for {sup 196,198}Au activity and production yield estimations. Meanwhile, the yield was examined using 30 MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF{sub 2} reflector enclosed the moderator region. Transmutation in {sup 197}Au nano-solution samples were explored at 15 and 25 cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. - Graphical abstract: This figure describes gold nanoparticles production via cyclotron based method. The aim of investigating is to estimate activity and saturation yield of {sup 197}Au(n,γ){sup 198}Au and {sup 197}Au(n,2n){sup 196}Au reactions using Karaj cyclotron available in Iran. The feasibility of a cyclotron-driven production of βeta-emitting radioisotopes was investigated for therapeutic applications via a new neutron activator design. - Highlights: • Nano-gold radioisotope production

  1. Spallation of 197Au with 4.4-GeV deuterons

    Directory of Open Access Journals (Sweden)

    Karapetyan G. S.

    2014-04-01

    Full Text Available A comprehensive set of 110 radioactive nuclide cross sections with mass numbers 22 ≤ A ≤ 198 amu in the interaction of 4.4-GeV deuterons with 197Au have been measured for the first time. The results including charge distributions have been parameterized in term of a 3-parameter equation in order to reproduces the isobaric distributions. Using data from the charge distributions, the total mass-yield distribution was obtained. The new experimental data of the recoil properties of reaction products were also obtained. Kinematical characteristics of the reaction products obtained from measurements of the residuals emitted in the forward and backward directions exhibit different behavior depending on the mass region. The kinematical features of reaction products have been analyzed on the basis of the two-step model of high-energy nuclear reactions and discussed in terms of the different reaction mechanisms.

  2. Recent origin and spread of a common Lithuanian mutation, G197del LDLR, causing familial hypercholesterolemia: positive selection is not always necessary to account for disease incidence among Ashkenazi Jews

    NARCIS (Netherlands)

    Durst, R.; Colombo, R.; Shpitzen, S.; Avi, L. B.; Friedlander, Y.; Wexler, R.; Raal, F. J.; Marais, D. A.; Defesche, J. C.; Mandelshtam, M. Y.; Kotze, M. J.; Leitersdorf, E.; Meiner, V.

    2001-01-01

    G197del is the most prevalent LDL receptor (LDLR) mutation causing familial hypercholesterolemia (FH) in Ashkenazi Jew (AJ) individuals. The purpose of this study was to determine the origin, age, and population distribution of G197del, as well as to explore environmental and genetic effects on

  3. Photon and Neutral π0197Au + 197Au collisions at √sNN = 130 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Ian Jeffrey [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2002-09-01

    Inclusive transverse momentum spectra of photons and π0s at mid-rapidity are studied as a function of collision centrality for 197Au+ 197Au collisions at √sNN = 130 GeV. Photon pair conversions have been reconstructed from charged tracks measured by the main Time Project Chamber of the STAR experiment at the RHIC heavy ion facility. The transverse momentum resolution of photons with this method is estimated to be Δpt/pt = 2% at 0.125 GeV/c and 5% at 2.5 GeV/c. Photon spectra were measured up to a transverse momentum of 2.4 GeV/c between ± 0.5 units of rapidity. The dominant photon production mechanism, the π0 → γγ decay, was measured between 0.25-2.5 GeV/c and ± 1 units of rapidity. Spectra are reported for the top 11%, 11-34% and 34-85% centrality classes. It was observed that in mid-central and central collisions the relative contribution of the π0 → γγ decay to the inclusive photon spectrum decreases above a transverse momentum of 1.65 GeV/c. In central collisions the magnitude of the decrease from pt = 1.65 GeV/c to 2.4 GeV/c is 20%. It is unlikely that contributions from other π0 decay channels and other particle decays fully explain this decrease. The centrality dependence on the shapes of the π0 spectra was analyzed with Boltmann and Bose-Einstein functions. In the transverse momentum windows of the spectra, the extracted temperatures are near 0.295 GeV. These temperatures are substantially higher than those extracted from π± spectra in a lower range of transverse momentum. This is an indication that the shapes of the pion spectra deviate from purely exponential shapes.

  4. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  5. Position calibration of silicon strip detector using quasi-elastic scattering of 16O+197Au

    International Nuclear Information System (INIS)

    Yan Wenqi; Hu Hailong; Zhang Gaolong

    2013-01-01

    Background: Elastic scattering is induced by weakly unstable nuclei. Generally, a good angular resolution for angular distribution of elastic scattering is needed. The silicon strip detector is often used for this kind of experiment. Purpose: In order to use silicon strip detector to study the elastic scattering of weakly unbound nuclei, it is important to get the information of its position calibration. It is well known that the elastic scattering of stable nuclei has a good angular distribution and many experimental data have been obtained. Methods: So the scattering of stable nuclei can be used to calibrate the position information of silicon strip detector. In this experiment, the positions of silicon strip detectors are calibrated using 101 MeV and 59 MeV 16 O scattering on the 197 Au target. Results: The quasi-elastic peaks can be observed in the silicon strip detectors and the counts of quasi-elastic 16 O can be obtained. The solid angles of the silicon strip detectors are calibrated by using alpha source which has three alpha energy values. The angular distribution of quasi-elastic scattering of 16 O+ 197 Au is obtained at these two energy values. Conclusions: The experimental data of angular distribution are reasonable and fit for the principle of angular distribution of elastic scattering. It is concluded that in the experiment these silicon strip detectors can accurately give the position information and can be used for the elastic scattering experiment. (authors)

  6. Spallation of {sup 197}Au with 4.4-GeV deuterons

    Energy Technology Data Exchange (ETDEWEB)

    Karapetyan, G.S. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Balabekyan, A.R. [Yerevan State University (Armenia); Demekhina, N.A. [Yerevan Physics Institute, Alikhanyan Brothers 2, Yerevan (Armenia); Joint Institute for Nuclear Research (JINR), Flerov Laboratory of Nuclear Reactions (LNR), Dubna, Moscow (Russian Federation)

    2014-07-01

    A comprehensive set of 110 radioactive nuclide cross sections with mass numbers 22 ≤ A ≤ 198 amu in the interaction of 4.4-GeV deuterons with {sup 197}Au have been measured for the first time. The results including charge distributions have been parameterized in term of a 3-parameter equation in order to reproduces the isobaric distributions. Using data from the charge distributions, the total mass-yield distribution was obtained. The new experimental data of the recoil properties of reaction products were also obtained. Kinematical characteristics of the reaction products obtained from measurements of the residuals emitted in the forward and backward directions exhibit different behavior depending on the mass region. The kinematical features of reaction products have been analyzed on the basis of the two-step model of high-energy nuclear reactions and discussed in terms of the different reaction mechanisms. (author)

  7. 2.4-197 mu m spectroscopy of OH/IR stars : the IR characteristics of circumstellar dust in O-rich environments

    NARCIS (Netherlands)

    Sylvester, RJ; Kemper, F; Barlow, MJ; de Jong, T; Waters, LBFM; Tielens, AGGM; Omont, A

    1999-01-01

    Infrared spectra of a number of evolved O-rich stars have been obtained with the Short- and Long-Wavelength spectrometers on board the Infrared Space Observatory. The very broad wavelength coverage (2.4-197 mu m) obtained by combining observations made with the two spectrometers includes practically

  8. Capture reactions of 40Ca and 48Ca with targets of 197Au and 208Pb

    International Nuclear Information System (INIS)

    Stokstad, R.; Chan, Y.; Chavez, E.

    1988-03-01

    The reactions of 40 Ca and 48 Ca with targets of 197 Au and 208 Pb have been measured in the region from below the interaction barrier to about twice the barrier energy. The fission-like fragments were detected in a pair of position-sensitive, multi-wire proportional counters and were identified from measurements of position and time using two-body kinematics. In the region above the barrier the cross sections for capture are less than those given by the touching condition, indicating that an /open quotes/extra push/close quotes/ is required to induce capture. The observations for 40 Ca and 48 Ca show different fissilities for the onset of the extra push and indicate that charge equilibration may be an important factor governing capture reactions. Below the barrier the cross sections show an enhancement relative to the prediction for a one dimensional barrier. The enhancements are larger for 40 Ca than for 48 Ca (for both targets) and this is in qualitative agreement with predictions based on the coupling of the relative motion to low-lying collective states. Both above and below the barrier, we find that the change in the light partner, from 48 Ca to 40 Ca, has a larger effect on the cross sections than the change from 208 Pb to 197 Au, after correction for the change in the Coulomb barrier. 16 refs., 7 figs

  9. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  10. Dependence of spleen sequestration on erythrocytes following administration of various concentrations of BMHP-197Hg

    International Nuclear Information System (INIS)

    Kapff, S. v.

    1980-01-01

    In the course of routine splenic scintiscanning, the effects of BMHP-Hg 197 concentrations on the kinetics of damaged erythrocytes and on image quality have been investigated. The following findings were obtained: 1. Significant displacement of the Price-Jones curve in dependence of BMHP concentrations. 2. No significant enzymatic changes 3. An enhanced labelling index at high concentrations and a higher spleen sequestration rate 4. A significant improvement of scintiscan quality at higher concentrations 5. Erythrocyte washing before incubation with BMHP was unnecessary as it does not improve the results to an extent that would warrant the tedious procedure. (orig.) [de

  11. Analysis of complete fusion excitation functions for 7Li+152Sm, 197Au and 209Bi reactions at around barrier energies

    International Nuclear Information System (INIS)

    Kharab, Rajesh; Chahal, Rajiv; Kumar, Rajiv

    2017-01-01

    In the present work we have analyzed the fusion excitation function for CF process using the simple Wong’s formula in conjunction with the energy dependent Woods-Saxon potential (EDWSP) in near barrier energy region for 7 Li+ 152 Sm, 197 Au and 209 Bi reactions

  12. Breakup mechanisms for 7Li + 197Au, 204Pb systems at sub-barrier energies

    Directory of Open Access Journals (Sweden)

    Luong D.H.

    2013-12-01

    Full Text Available Coincidence measurements of breakup fragments were carried out for the 7Li + 197Au and 204Pb systems at sub-barrier energies. The mechanisms triggering breakup, and time-scales of each process, were identified through the reaction Q-values and the relative energy of the breakup fragments. Binary breakup of 7Li were found to be predominantly triggered by nucleon transfer, with p-pickup leading to 8Be → α + α decay being the preferred breakup mode. From the time-scales of each process, the coincidence yields were separated into prompt and delayed components, allowing the identification of breakup process important in the suppression of complete fusion of 7Li at above-barrier energies.

  13. Measurement of {sup 197}Au(n,γ){sup 198g}Au reaction cross-section at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Vansola, Vibha [M.S. Univ., Baroda (India). Dept. of Physics; Ghosh, Reetuparna; Badwar, Sylvia [North Eastern Hill Univ., Meghalaya (India). Dept. of Physics; and others

    2015-07-01

    The {sup 197}Au(n,γ){sup 198}Au reaction cross-sections at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV were determined by using activation and off-line γ-ray spectrometric technique. The mono-energetic neutron energies of 1.12-4.12 MeV were generated from the {sup 7}Li(p,n) reaction by using the proton energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at BARC as well as 5 and 6 MeV from the Pelletron facility at TIFR, Mumbai. The {sup 115}In(n,γ){sup 116m}In reaction cross-section was used as the neutron flux monitor. The {sup 197}Au(n,γ){sup 198}Au reaction cross-section at the neutron energies of 3.12 and 4.12 MeV are reported for the first time. The {sup 197}Au(n,γ){sup 198}Au reaction cross-sections at 1.12 and 2.12 MeV are close to the literature data of in between neutron energies. The {sup 197}Au(n,γ){sup 198}Au cross-section was also calculated theoretically by using the computer code TALYS 1.6 and found to be higher than the experimental data of present work and literature data within the neutron energies of 0.8 to 4 MeV.

  14. Intranuclear cascade+percolation+evaporation model applied to the {sup 12}C+{sup 197}Au system at 1 GeV/nucleon

    Energy Technology Data Exchange (ETDEWEB)

    Volant, C.; Turzo, K.; Trautmann, W.; Auger, G.; Begemann-Blaich, M.-L.; Bittiger, R.; Borderie, B.; Botvina, A.S.; Bougault, R.; Bouriquet, B.; Charvet, J.-L.; Chbihi, A.; Dayras, R.; Dore, D.; Durand, D.; Frankland, J.D.; Galichet, E.; Gourio, D.; Guinet, D.; Hudan, S.; Imme, G.; Lautesse, Ph.; Lavaud, F.; Le Fevre, A.; Lopez, O.; Lukasik, J.; Lynen, U.; Mueller, W.F.J.; Nalpas, L.; Orth, H.; Plagnol, E.; Raciti, G.; Rosato, E.; Saija, A.; Schwarz, C.; Seidel, W.; Sfienti, C.; Steckmeyer, J.C.; Tamain, B.; Trzcinski, A.; Vient, E.; Vigilante, M.; Zwieglinski, B

    2004-04-05

    The nucleus-nucleus Liege intranuclear-cascade+percolation+evaporation model has been applied to the {sup 12}C+{sup 197}Au data measured by the INDRA-ALADIN collaboration at GSI. After the intranuclear cascade stage, the data are better reproduced when using the Statistical Multiframentation Model as afterburner. Further checks of the model are done on data from the EOS and KAOS collaborations.

  15. Test of Magnetic Rotation near the band head in ^197,198Pb

    Science.gov (United States)

    Krücken, R.; Clark, R. M.; Deleplanque, M. A.; Diamond, R. M.; Fallon, P.; Macchiavelli, A. O.; Lee, I. Y.; Schmid, G. J.; Stephens, F. S.; Vetter, K.; Dewald, A.; Peusquens, R.; von Brentano, P.; Baldsiefen, G.; Chmel, S.; Hübel, H.; Becker, J. A.; Bernstein, L. A.; Hauschild, K.

    1998-04-01

    The concept of magnetic rotation is tested near the band head of shears-bands in ^197,198Pb by means of a lifetime experiment with the recoil distance method (RDM). The experiment was performed using the Gammasphere array in conjunction with the Cologne Plunger. The B(M1) values extracted from the measured lifetimes can prove the applicability of the concept of magnetic rotation for the states near the band head of these shears bands. The RDM results are compared with tilted axis cranking and shell model calculations. Furthermore the results will be used to test earlier DSAM lifetime measurements for states at higher spins. Preliminary results of this topic will be presented. This work is supported by DOE grant numbers DE-AC03-76SF00098 (LBNL), DE-FG02-91ER40609 (Yale), W-7405-ENG-48 (LLNL) and by the German BMBF for Cologne (No. 06 OK 668) and Bonn.

  16. Isotopic production cross sections of fission residues in 197Au-on-proton collisions at 800 A MeV

    International Nuclear Information System (INIS)

    Benlliure, J.; Armbruster, P.; Bernas, M.

    2000-02-01

    Interactions of 197 Au projectiles at 800 A MeV with protons leading to fission are investigated. We measured the production cross sections and velocities of all fission residues which are fully identified in atomic and mass number by using the in-flight separator FRS at GSI. The new data are compared with partial measurements of the characteristics of fission in similar reactions. Both the production cross sections and the recoil energies are relevant for a better understanding of spallation reactions. (orig.)

  17. A cross-reacting material CRM197 conjugate vaccine induces diphtheria toxin neutralizing antibody response in children and adolescents infected or not with HIV.

    Science.gov (United States)

    Silva, Giselle P; Santos, Rafaela S; Pereira-Manfro, Wânia F; Ferreira, Bianca; Barreto, Daniella M; Frota, Ana Cristina C; Hofer, Cristina B; Milagres, Lucimar G

    2017-07-05

    Anti-diphtheria antibody levels decrease with aging, and frequent booster vaccinations are required to maintain herd immunity. We analyzed the diphtheria toxin neutralizing antibody (DT-Nab) response induced by a conjugate vaccine (meningococcal C polysaccharide-CRM 197 ) in HIV-vertically infected (HI) children and adolescents and healthy controls (HC) with matched age. We report the association of DT-Nab with the bactericidal antibodies to serogroup C meningococcus (MenC). Before vaccination, 21 HI patients (50%) had no protection against diphtheria (≤0.01IU/ml of antibody) and only 8 (19%) showed complete protection (≥0.1IU/ml). About half of the HC (56%) had complete protection before immunization and 6 subjects (12%) had no protection against diphtheria. After one and two vaccine injections, 96% of HC and 64% of HI vaccinees, respectively, showed full protection against diphtheria. These data indicate that CRM 197 was able to induce primary and/or booster response in both groups of individuals. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Meningitis in Children: Evaluation of 197 Patients

    Directory of Open Access Journals (Sweden)

    Ali Gunes

    2016-01-01

    Full Text Available Aim: The aim of our study was to evaluate the epidemiologic, clinic and laboratory results and the answers to treatment of meningitis cases. Material and Method: In this study, the epidemiologic, clinic and laboratory results of 197 patients hospitalized with central nervous system infection diagnosis in the Department of Pediatric Health and Diseases of the Faculty of Medicine of Dicle University between 1st of January 2003 and 1st of January 2006 have been studied retrospectively. The files have been studied in details for age, sex, complaints, and results of physical examination, laboratory results, radiological results and treatments applied. Results: 118 of the patients were male, 79 were women and the mean age calculated was 62,2±47,3 months.137, 27 and 33 patients have been respectively considered as ABM, AM and TM. The most frequent complaints of application to hospital were fever (95,4%, vomiting (82,7%, headache (45,6% and change of consciousness (21,3%. The presence of many risks about meningitis has been observed. The most frequent risk factors were head trauma history, parenchymal lung tuberculosis, military tuberculosis, presence of V-P shunt, meningocele, varicella history, having mumps, and the presence of purulent ear discharge. BOS has developed in 7 patients and for five patients, reproduction occurred in blood culture. The most important central nervous system sequels or complications were in order of frequency hydrocephalies requiring the installation of V-P shunt, brain edema, epilepsies, subdural effusions, tuberculoma, retention of head pair, and brain apses. The rate of mortality was (% 13,1. Discussion: During the period of execution of the study, the mortality and morbidity of central nervous system diseases were still at high risk. But this may be associated to the absence of vaccination programs for frequent meningitis factors such as pneumococcus and H. influenza were not in routine vaccination program in our

  19. The 4-fold fission in 40Ar + 209Bi, 197Au and 159Tb reactions at 25MeV/u

    International Nuclear Information System (INIS)

    Dai, G.X.; Wu, H.Y.; He, Z.Y.; Luo, Q.Z.; Duan, L.M.; Zhang, B.G.; Qi, Y.J.; Li, Z.Y.; Jin, G.M.; Wen, W.X.

    1995-01-01

    The paper presents the 4-fold fission or fragmentation of hot nuclei produced in 25MeV/u 40 Ar+ 209 Bi, 197 Au and 159 Tb reactions. The events with 4 massive fragments emitted with angles larger than 36 were detected by 8 PPACs with area of 25x20cm 2 . The TKE, distributions of mass and velocity for the four fragments have been obtained. ((orig.))

  20. Cross section of the 197Au(n,2n196Au reaction

    Directory of Open Access Journals (Sweden)

    Kalamara A.

    2017-01-01

    Full Text Available The 197Au(n,2n196Au reaction cross section has been measured at two energies, namely at 17.1 MeV and 20.9 MeV, by means of the activation technique, relative to the 27Al(n,α24Na reference reaction cross section. Quasi-monoenergetic neutron beams were produced at the 5.5 MV Tandem T11/25 accelerator laboratory of NCSR “Demokritos”, by means of the 3H(d,n4He reaction, implementing a new Ti-tritiated target of ∼ 400 GBq activity. The induced γ-ray activity at the targets and reference foils has been measured with HPGe detectors. The cross section for the population of the second isomeric (12− state m2 of 196Au was independently determined. Auxiliary Monte Carlo simulations were performed using the MCNP code. The present results are in agreement with previous experimental data and with theoretical calculations of the measured reaction cross sections, which were carried out with the use of the EMPIRE code.

  1. Pre-scission 4He multiplicity in the 19F+197Au reaction

    International Nuclear Information System (INIS)

    Ikezoe, H.; Shikazono, N.; Nagame, Y.; Sugiyama, Y.; Tomita, Y.; Ideno, K.; Iwamoto, A.; Ohtsuki, T.

    1990-01-01

    Pre- and post-scission 4 He particle multiplicities for the 19 F+ 197 Au reaction in the excitation energy range of 43 to 90 MeV have been measured in coincidence with fission fragments. The coincident 4 He particles measured at backward angles are accounted for by evaporation from a compound nucleus and fission fragments. The most probable center-of-mass energy of the 4 He particles measured at backward angles is shifted towards lower energies by ∼2 MeV compared to a statistical model calculation performed by assuming 4 He emission from a spherical compound nucleus. The observed pre-scission 4 He multiplicity as a function of excitation energy is compared to a set of statistical-model calculations which also included the delayed onset of fission. The comparison shows that the observed energy dependence of the pre-scission 4 He multiplicity is reproduced by the calculation without taking into account the delayed onset of fission if the reduced emission barrier for 4 He is assumed in the calculation. The emission mechanism of the pre-scission 4 He is discussed

  2. An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

    Science.gov (United States)

    1991-12-01

    d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

  3. The Intermediate Velocity Source in the 40Ca + 197Au Reaction at 35 AMeV

    International Nuclear Information System (INIS)

    Planeta, R.; Sosin, Z.; Hachaj, P.

    2001-01-01

    The creation of hot Ca-like fragments and the emission of intermediate velocity particles was studied in the 40 Ca+ 197 Au reaction at 35 AMeV. For peripheral collisions the primary projectile-like fragment was reconstructed using the AMPHORA 4π detector system. The particle distributions are compared with the predictions of a Monte Carlo code which calculates the nucleon transfer and clustering probabilities according to the system density of states. The velocity distributions of charged particles projected on the beam direction can be explained if emissions from the hot projectile-like fragment and the target-like fragment are supplemented by an emission from an intermediate velocity source located between them. The properties of the intermediate velocity source are properly described, including the 2 D/ 3 T/ 3 He effect. (author)

  4. Fusion hindrance at deep sub-barrier energies for the 11B+197Au system

    Science.gov (United States)

    Shrivastava, A.; Mahata, K.; Nanal, V.; Pandit, S. K.; Parkar, V. V.; Rout, P. C.; Dokania, N.; Ramachandran, K.; Kumar, A.; Chatterjee, A.; Kailas, S.

    2017-09-01

    Fusion cross sections for the 11B+197Au system have been measured at energies around and deep below the Coulomb barrier, to probe the occurrence of fusion hindrance in case of asymmetric systems. A deviation with respect to the standard coupled channels calculations has been observed at the lowest energy. The results have been compared with an adiabatic model calculation that considers a damping of the coupling strength for a gradual transition from sudden to adiabatic regime at very low energies. The data could be explained without inclusion of the damping factor. This implies that the influence of fusion hindrance is not significant within the measured energy range for this system. The present result is consistent with the observed trend between the degree of fusion hindrance and the charge product that reveals a weaker influence of hindrance on fusion involving lighter projectiles on heavy targets.

  5. Production below the threshold and reabsorption of neutral pions in the system 129Xe+197Au at 44 MeV/u

    International Nuclear Information System (INIS)

    Mayer, R.S.

    1992-11-01

    In the framework of the TAPS collaboration at GANIL an experiment for the production of neutral pions in 129 Xe+ 197 Au collisions below the threshold for the production in the free nucleon-nucleon collision was performed. Both for π 0 and for hard photons from the data the inclusive cross sections for the production, energy and angular distributions as well as the velocity of the emitting source were derived. (orig./HSI) [de

  6. Long range absorption in the scattering of 6He on 208Pb and 197Au at 27 MeV

    International Nuclear Information System (INIS)

    Kakuee, O.R.; Alvarez, M.A.G.; Andres, M.V.; Cherubini, S.; Davinson, T.; Di Pietro, A.; Galster, W.; Gomez-Camacho, J.; Laird, A.M.; Lamehi-Rachti, M.; Martel, I.; Moro, A.M.; Rahighi, J.; Sanchez-Benitez, A.M.; Shotter, A.C.; Smith, W.B.; Vervier, J.; Woods, P.J.

    2006-01-01

    Quasi-elastic scattering of 6 He at E lab =27 MeV from 197 Au has been measured in the angular range of 6 o -72 o in the laboratory system employing LEDA and LAMP detection systems. These data, along previously analysed data of 6 He+ 208 Pb at the same energy, are analysed using optical model calculations. The role of Coulomb dipole polarizability has been investigated. Large imaginary diffuseness parameters are required to fit the data. This result is an evidence for long range absorption mechanisms in 6 He induced reactions

  7. The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis

    Directory of Open Access Journals (Sweden)

    Wang H

    2015-09-01

    Full Text Available Huifen Wang,1,* Yanli Zhang,1,* Zhaolan Liu,2 Yin Zhang,3 Hongchuan Zhao,1 Shiyu Du1 1Department of Gastroenterology, China-Japan Friendship Hospital, 2Center for Evidence-Based Chinese Medicine, Beijing University of Chinese Medicine, 3Institute of Basic Research in Clinical Medicine, China Academy of Chinese Medical Sciences, Beijing, People’s Republic of China *These authors contributed equally to this work Background: Interleukin-17 (IL-17 is a family of emerged pro-inflammatory cytokines. The IL-17A and IL-17F are two important members of IL-17 family. Previous studies have shown that the functional IL-17A G-197A and IL-17F 7488T/C polymorphisms may contribute to susceptibility to cancer but the results were inconclusive. This meta-analysis was performed to determine the exact association between IL-17 polymorphisms and cancer risk.Methods: Online databases were searched to identify eligible case–control studies. Pooled odds ratios (ORs and confidence intervals (CIs were calculated by fixed-effect models or random-effect models. Publication bias was detected by Egger’s test and Begg’s test.Results: Nine eligible case–control studies of IL-17A G-197A and seven studies of IL-17F 7488T/C, including 3,181 cases and 4,005 controls, were identified. Pooled analysis suggested the variant IL-17A-197A allele was associated with increased risk cancer (GA/AA vs GG, OR =1.27, 95% CI: 1.15, 1.41, Pheterogeneity =0.374; and A vs G, OR =1.30, 95% CI: 1.17, 1.45, Pheterogeneity =0.021. For IL-17F 7488T/C, the homozygote 7488CC genotype significantly increased risk of cancer (CC vs TC/TT, OR =1.36, 95% CI: 0.97, 1.91, Pheterogeneity =0.875; and CC vs TT, OR =1.39, 95% CI: 1.03, 1.88, Pheterogeneity =0.979, especially for gastric cancer.Conclusion: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer. Keywords: interleukin-17, gene polymorphism, gastric cancer, risk

  8. Mercury methylation and reduction potentials in marine water: An improved methodology using {sup 197}Hg radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Koron, Neza [National Institute of Biology, Marine Biology Station, Fornace 41, 6330 Piran (Slovenia); Bratkic, Arne [Department of Environmental Sciences, ' Jozef Stefan' Institute, Jamova 39, 1000 Ljubljana (Slovenia); Ribeiro Guevara, Sergio, E-mail: ribeiro@cab.cnea.gov.ar [Laboratorio de Analisis por Activacion Neutronica, Centro Atomico Bariloche, Av. Bustillo km 9.5, 8400 Bariloche (Argentina); Vahcic, Mitja; Horvat, Milena [Department of Environmental Sciences, ' Jozef Stefan' Institute, Jamova 39, 1000 Ljubljana (Slovenia)

    2012-01-15

    A highly sensitive laboratory methodology for simultaneous determination of methylation and reduction of spiked inorganic mercury (Hg{sup 2+}) in marine water labelled with high specific activity radiotracer ({sup 197}Hg prepared from enriched {sup 196}Hg stable isotope) was developed. A conventional extraction protocol for methylmercury (CH{sub 3}Hg{sup +}) was modified in order to significantly reduce the partitioning of interfering labelled Hg{sup 2+} into the final extract, thus allowing the detection of as little as 0.1% of the Hg{sup 2+} spike transformed to labelled CH{sub 3}Hg{sup +}. The efficiency of the modified CH{sub 3}Hg{sup +} extraction procedure was assessed by radiolabelled CH{sub 3}Hg{sup +} spikes corresponding to concentrations of methylmercury between 0.05 and 4 ng L{sup -1}. The recoveries were 73.0{+-}6.0% and 77.5{+-}3.9% for marine and MilliQ water, respectively. The reduction potential was assessed by purging and trapping the radiolabelled elemental Hg in a permanganate solution. The method allows detection of the reduction of as little as 0.001% of labelled Hg{sup 2+} spiked to natural waters. To our knowledge, the optimised methodology is among the most sensitive available to study the Hg methylation and reduction potential, therefore allowing experiments to be done at spikes close to natural levels (1-10 ng L{sup -1}). - Highlights: Black-Right-Pointing-Pointer Inorganic mercury methylation and reduction in marine water were studied. Black-Right-Pointing-Pointer High specific activity {sup 197}Hg was used to label Hg{sup 2+} spikes at natural levels. Black-Right-Pointing-Pointer Methylmercury extraction had 73% efficiency for 0.05-4 ng L{sup -1} levels. Black-Right-Pointing-Pointer High sensibility to assess methylation potentials, below 0.1% of the spike. Black-Right-Pointing-Pointer High sensibility also for reduction potentials, as low as 0.001% of the spike.

  9. Charge radii and electromagnetic moments of At-211195

    Science.gov (United States)

    Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

    2018-05-01

    Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

  10. Target-fragment angular distributions for the interaction of 86 MeV/A 12C with 197Au

    International Nuclear Information System (INIS)

    Kraus, R.H. Jr.; Loveland, W.; McGaughey, P.L.; Seaborg, G.T.; Morita, Y.; Hageboe, E.; Haldorsen, I.R.; Sugihara, T.T.

    1985-01-01

    Target-fragment angular distributions were measured using radiochemical techniques for 69 different fragments (44 12 C with 197 Au. The angular distributions in the laboratory system are forward-peaked with some distributions also showing a backward peaking. The shapes of the laboratory system distributions were compared with the predictions of the nuclear firestreak model. The measured angular distributions differed markedly from the predictions of the firestreak model in most cases. This discrepancy could be due, in part, to overestimation of the transferred longitudinal momentum by the firestreak model, the assumption of isotropic angular distributions for fission and particle emission in the moving frame and incorrect assumptions about how the lightest (A 145) fragment distributions were symmetric about 90 0 . (orig.)

  11. Anthropometry, DXA and leptin reflect subcutaneous but not visceral abdominal adipose tissue by MRI in 197 healthy adolescents

    DEFF Research Database (Denmark)

    Tinggaard, Jeanette; Hagen, Casper P; Christensen, Anders Nymark

    2017-01-01

    Background Abdominal fat distribution is associated with the development of cardio-metabolic disease independently of body mass index (BMI). We assessed anthropometry, serum adipokines, and DXA as markers of abdominal subcutaneous adipose tissue (SAT) and visceral adipose tissue (VAT) using...... to total abdominal volume. Results Girls had a higher SAT% than did boys in early and late puberty (16 vs. 13%, Pfat% (standard deviation score (SDS)), suprailiac skinfold...... magnetic resonance imaging (MRI). Methods We performed a cross-sectional study that included 197 healthy adolescents (114 boys) aged 10–15 years nested within a longitudinal population-based cohort. Clinical examination, blood sampling, DXA, and abdominal MRI were performed. SAT% and VAT% were adjusted...

  12. Quantitative renal scintigraphy: anatomo-clinical and biological correlation (concerning 51 mercury 197 renal scintigraphs)

    International Nuclear Information System (INIS)

    Pinganaud, J.-M.

    1976-01-01

    To find out whether the renal mercury uptake measurement in urology is a satisfactory way to judge the separate functional value of the kidneys the records of 51 patients were examined. The exploration took place as follows: - injection of 300 μCi 197 HgCl 2 , - measurement of the radioactivity fixed on each kidney, three days later, by means of a gamma camera. Of these 51 uptake measurements only one result appears inconsistent by excess. All the others agree perfectly with comparative observations. On the whole a close correlation is found between the renal mercury uptake measurement and the various clinical, urographic and anatomical data obtained on this group of patients. The method seems to be ideal because reliable, harmless and repeatable. Where dosimetry is concerned an injected dose of 300μCi delivers 9mrad to each kidney, 6mrad to the ovaries. By way of comparison it is interesting to note that an intraveinous urograph with 5 exposures delivers 500mrad to the ovaries. It is considered safe to repeat the examination 3 to 4 times on one patient [fr

  13. A 197Au and 57Fe Moessbauer study of the roasting of refractory gold ores

    International Nuclear Information System (INIS)

    Wagner, F.E.; Marion, P.

    1989-01-01

    The transformation of chemically bound gold into metallic gold during industrial scale roasting of an arsenical gold ore concentrate from the Fairview Mine, Eastern Transvaal, has been studied quantitatively by 197 Au Moessbauer spectroscopy. The iron compounds in the concentrate, mainly FeAsS and FeS 2 , and their transformations during roasting have been studied by 57 Fe Moessbauer spectroscopy. The bound gold is found to convert into the metal in parallel to the decomposition of FeAsS and the increase in cyanide leachability. This shows that the refractory character of the ore is caused by the chemical bonding of the gold rather than by the physical inclusion of small, discrete metallic particles in the matrix of FeAsS or FeS 2 . The ratio of the f-factors of gold bound in the FeAsS component of a refractory ore and of metallic gold was determined to be f(Au:FeAsS)/f(Au)=1.48 ± 0.09. (orig.)

  14. The use of 197HgCl2 in the study of pseudo-tumoral pulmonary afflictions

    International Nuclear Information System (INIS)

    Biagini, C.; Centi Colella, A.; Pigorini, F.

    1975-01-01

    The utility of examinations with 197 HgCl 2 has been shown in the study of pseudo-tumoral pulmonary afflictions. The following points seem to be the most important. The real possibility of differential diagnosis between benign and malignant tumors if the uptake of radio-mercury is related to the volume of the lesion. The possibility of differential diagnosis between cancers and the after-effects of more inflammatory TBC and non-TBC processes (inactive tuberculomas, fibroses). In sub-acute and chronic inflammatory lesions, some indication is furnished by the behavior of the uptake ratio at 24 and 72 hours. The topographical definition of the tumoral lesion in the case where there are associated secondary phenomena (atelectasis, a small quantity of pleural effusion). Individualization of extrapulmonary metastases which are situated at the level of the brain and the thoracic skeleton. Evaluation of the modifications of proliferative activities of cancers during radiologic or medical treatment [fr

  15. Signatures of fission dynamics in highly excited nuclei produced in 197AU(800 A MeV) on proton collisions

    International Nuclear Information System (INIS)

    Benlliure, J.; Armbruster, P.; Bernas, M.

    2001-09-01

    197 Au(800 A MeV)-on-proton collisions are used to investigate the fission dynamics at high excitation energy. The kinematic properties together with the isotopic identification of the fission fragments allow to determine the mass, charge and excitation energy of the fissioning nucleus at saddle. The comparison of these observables and the measured total fission cross section with model calculations evidences a clear hindrance of fission at high excitation energy that can be explained in terms of nuclear dissipation. Assuming a statistical evaporation for other de-excitation channels than fission, an estimated value of the transient time of fission of (3 ± 1) . 10 -21 s is obtained. (orig.)

  16. Workshop on selected aspects of radiochemistry

    International Nuclear Information System (INIS)

    1991-11-01

    The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

  17. Immunogenicity and safety of the Vi-CRM197 conjugate vaccine against typhoid fever in adults, children, and infants in south and southeast Asia: results from two randomised, observer-blind, age de-escalation, phase 2 trials.

    Science.gov (United States)

    Bhutta, Zulfiqar A; Capeding, Maria Rosario; Bavdekar, Ashish; Marchetti, Elisa; Ariff, Shabina; Soofi, Sajid B; Anemona, Alessandra; Habib, Muhammad A; Alberto, Edison; Juvekar, Sanjay; Khan, Rana M Qasim; Marhaba, Rachid; Ali, Noshad; Malubay, Nelia; Kawade, Anand; Saul, Allan; Martin, Laura B; Podda, Audino

    2014-02-01

    Typhoid vaccination is a public health priority in developing countries where young children are greatly affected by typhoid fever. Because present vaccines are not recommended for children younger than 2 years, the Novartis Vaccines Institute for Global Health developed a conjugate vaccine (Vi-CRM197) for infant immunisation. We aimed to assess the immunogenicity and safety of Vi-CRM197 in participants of various ages in endemic countries in south and southeast Asia. We did two randomised, observer-blind, age de-escalation, phase 2 trials at two sites in Pakistan and India (study A), and at one site in the Philippines (study B), between March 2, 2011, and Aug 9, 2012. Adults aged 18-45 years, children aged 24-59 months, older infants aged 9-12 months, and infants aged 6-8 weeks were randomly assigned (1:1) with a computer-generated randomisation list (block size of four) to receive either 5 μg Vi-CRM197 or 25 μg Vi-polysaccharide vaccine (or 13-valent pneumococcal conjugate vaccine in children younger than 2 years). Both infant populations received Vi-CRM197 concomitantly with vaccines of the Expanded Programme on Immunization (EPI), according to WHO schedule. With the exception of designated study site personnel responsible for vaccine preparation, study investigators, those assessing outcomes, and data analysts were masked to treatment allocation. We specified no a-priori null hypothesis for the immunogenicity or safety objectives and all analyses were descriptive. Analyses were by modified intention-to-treat. These studies are registered with ClinicalTrials.gov, numbers NCT01229176 and NCT01437267. 320 participants were enrolled and vaccinated in the two trials: 200 in study A (all age groups) and 120 in study B (children and infants only), of whom 317 (99%) were included in the modified intention-to-treat analysis. One dose of Vi-CRM197 significantly increased concentrations of anti-Vi antibody in adults (from 113 U/mL [95% CI 67-190] to 208 U/mL [117

  18. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  19. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  20. Radiotoxicological properties of neohydrin, labelled with Hg/sup 197/,/sup 203/ in quantities used for diagnostic purposes

    Energy Technology Data Exchange (ETDEWEB)

    Karklinskaya, O N [Tsentral' nyj Inst. Usovershenstvovaniya Vrachej, Moscow (USSR)

    1975-07-01

    Experiments on rats showed that the chief place of accumulation of mercury isotopes is the kidney (specific activity in the kidneys was 25 to 30 times that in other organs). Doses due to labelled Neohydrin in kidney tissue, calculated by generally accepted formulas were: 20.1 rad for Neohydrin-Hg/sup 203/ and 0.08 rad for Neohydrin-Hg/sup 197/. Histological studies did not indicate any morphological changes in the kidneys. However, nonhomogeneous, focal granular dystrophy was noted, and in some places, vacuolar dystrophy. In the descending portion of the distal canals and the Henle lemniscus there was an expansion of the lumen, with places of heavy thickening of the epithelium. An unequal plethora of vessels, sometimes with small hemorrhages and of edema, was observed. Specific reactions to mercury were negative. Morphological studies did not show any blood changes.

  1. submitter Scattering of halo nuclei on heavy targets at energies around the Coulomb barrier: The case of $^{11}$Be on $^{197}$Au

    CERN Document Server

    Pesudo, V; Moro, A M; Lay, J A; Nácher, E; Gómez-Camacho, J; Tengblad, O; Acosta, L; Alcorta, M; Alvarez, M A G; Andreoiu, C; Bender, P C; Braid, R; Cubero, M; Di Pietro, A; Fernández-García, J P; Figuera, P; Fisichella, M; Fulton, B R; Garnsworthy, A B; Hackman, G; Hager, U; Kirsebom, O S; Kuhn, K; Lattuada, M; Marquínez-Durán, G; Martel, I; Miller, D; Moukaddam, M; O'Malley, P D; Perea, A; Rajabali, M M; Sánchez-Benítez, A M; Sarazin, F; Scuderi, V; Svensson, C E; Unsworth, C; Wang, Z M

    2017-01-01

    This work reports on the scattering of $^{11}$Be on $^{197}$Au at energies around and below the Coulomb barrier. By experimentally identifying the elastic scattering, inelastic scattering and breakup channels, and comparing them with different calculations, valuable information on the $^{11}$Be structure and its $B(E1$) distribution to the continuum are obtained. On top of that, a deeper understanding of the scattering process at low energies is achieved for reactions of this kind, making these studies extendable to other loosely-bound systems like $^{17,19}$C.

  2. Use of /sup 197/HgCl/sub 2/ in the study of pseudo-tumoral pulmonary afflictions

    Energy Technology Data Exchange (ETDEWEB)

    Biagini, C; Centi Colella, A; Pigorini, F [Rome Univ. (Italy)

    1975-01-01

    The utility of examinations with /sup 197/HgCl/sub 2/ has been shown in the study of pseudo-tumoral pulmonary afflictions. The following points seem to be the most important. The real possibility of differential diagnosis between benign and malignant tumors if the uptake of radio-mercury is related to the volume of the lesion. The possibility of differential diagnosis between cancers and the after-effects of more inflammatory TBC and non-TBC processes (inactive tuberculomas, fibroses). In sub-acute and chronic inflammatory lesions, some indication is furnished by the behavior of the uptake ratio at 24 and 72 hours. The topographical definition of the tumoral lesion in the case where there are associated secondary phenomena (atelectasis, a small quantity of pleural effusion). Individualization of extrapulmonary metastases which are situated at the level of the brain and the thoracic skeleton. Evaluation of the modifications of proliferative activities of cancers during radiologic or medical treatment.

  3. 197 Au Mössbauer study of the gold species adsorbed on carbon from cyanide solutions

    Science.gov (United States)

    Kongolo, K.; Bahr, A.; Friedl, J.; Wagner, F. E.

    1990-04-01

    The gold species present on activated carbon after adsorption from solutions of Au(CN)2 - have been studied by197Au Mössbauer spectroscopy as a function of the pH value of the solution, the loading of the carbon, the coadsorption of polyvalent cations, and the treatment of the samples after adsorption. The gold was found to be adsorbed mainly as Au(CN)2 -. Coadsorbed polyvalent cations (Ca²+, Gd³+) have no influence on the Mössbauer parameters of the adsorbed gold complex. After adsorption from acidic solutions (pH ≲ 4), one finds a substantial amount of adsorbed gold with Mössbauer parameters similar to those of crystalline AuCN. Presumably, this gold is bound in Aux(CN)x+1 oligomers which form during drying. An additional product with Mössbauer parameters close to those of KAu(CN)2Cl2 was observed on dried samples after adsorption at pH 1. A minor gold species with an uncommonly small electric quadrupole splitting was found on wet carbons but disappeared on drying.

  4. Decay patterns of target-like and projectile-like nuclei in 84Kr+197Au, natU reactions at E/A=150 MeV

    International Nuclear Information System (INIS)

    Quednau, B.M.; Galin, J.; Ledoux, X.; Crema, E.; Gebauer, B.; Hilscher, D.; Jahnke, U.; Jacquet, D.; Leray, S.; and others.

    1996-01-01

    The reactions 84 Kr+ 197 Au and 84 Kr+ nat U were studied at E/A=150 MeV employing the large-volume neutron multiplicity filter ORION at SATURNE. The observed correlations between the atomic number of projectile-like nuclei and neutron multiplicity indicate large excitation energies in the primary projectile- and target-like fragments. Angular correlations between the fission fragments of the U-like nucleus and the projectile-like fragments show a memory of the reaction plane, however no indications of spin effects are found. (author)

  5. Impact parameter selected nuclear temperatures of hot nuclei from excited state populations for 40Ar+197Au reactions at E/A=25MeV

    International Nuclear Information System (INIS)

    Li Zuyu; He Zhiyong; Duan Limin; Jin Genming; Wu Heyu; Zhang Baoguo; Wen Wanxin; Qi Yujin; Luo Qingzheng; Dai Guangxi; Wang Hongwei

    1997-01-01

    Nuclear temperatures extracted from excited state populations were measured as a function of linear momentum transfer (LMT) for 40 Ar+ 197 Au reactions at 25MeV/nucleon. The emission temperatures increased slightly with increasing linear momentum transfer or decreasing impact parameter. Taking into account the corrections of detection efficiency and sequential feeding from higher-lying states, a temperature of T∼4MeV was deduced for central collisions. For peripheral collisions the extracted temperatures increased with the energy of the particles. (orig.)

  6. Long range absorption in the scattering of {sup 6}He on {sup 208}Pb and {sup 197}Au at 27 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Kakuee, O.R. [Van De Graaf Laboratory, Nuclear Research Centre, AEOI, P.O. Box 14155-1339, Tehran (Iran, Islamic Republic of)]|[Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Alvarez, M.A.G. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Andres, M.V. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Cherubini, S. [Department de Physique Nucleaire, Universite Catholique, Louvain-la-Neuve (Belgium)]|[Institut fuer Experimentalphysik III, Ruhr-Universitaet Bochum (Germany); Davinson, T.; Di Pietro, A.; Laird, A.M.; Shotter, A.C.; Smith, W.B.; Woods, P.J. [Department of Physics and Astronomy, Edinburgh University, EH9 3JZ (United Kingdom); Galster, W. [Department de Physique Nucleaire, Universite Catholique, Louvain-la-Neuve (Belgium); Gomez-Camacho, J. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain)]. E-mail: gomez@us.es; Lamehi-Rachti, M. [Van De Graaf Laboratory, Nuclear Research Centre, AEOI, P.O. Box 14155-1339, Tehran (Iran, Islamic Republic of); Martel, I. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21819 Huelva (Spain); Moro, A.M. [Departamento de Fisica Atomica, Molecular y Nuclear, Apartado 1065, Universidad de Sevilla, E-41080 Sevilla (Spain); Rahighi, J. [Van De Graaf Laboratory, Nuclear Research Centre, AEOI, P.O. Box 14155-1339, Tehran (Iran, Islamic Republic of)]|[Department of Physics and Astronomy, Edinburgh University, EH9 3JZ (United Kingdom); Sanchez-Benitez, A.M. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21819 Huelva (Spain); Vervier, J. [Department de Physique Nucleaire, Universite Catholique, Louvain-la-Neuve (Belgium)

    2006-02-06

    Quasi-elastic scattering of {sup 6}He at E{sub lab}=27 MeV from {sup 197}Au has been measured in the angular range of 6{sup o}-72{sup o} in the laboratory system employing LEDA and LAMP detection systems. These data, along previously analysed data of {sup 6}He+{sup 208}Pb at the same energy, are analysed using optical model calculations. The role of Coulomb dipole polarizability has been investigated. Large imaginary diffuseness parameters are required to fit the data. This result is an evidence for long range absorption mechanisms in {sup 6}He induced reactions.

  7. Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.

    Directory of Open Access Journals (Sweden)

    Deutschmann, Eike Hellmut

    2012-01-01

    Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.

  8. NiCo2O4 surface coating Li[Ni0.03Mn1.97]O4 micro-/nano- spheres as cathode material for high-performance lithium ion battery

    Science.gov (United States)

    Ye, Pan; Dong, Hui; Xu, Yunlong; Zhao, Chongjun; Liu, Dong

    2018-01-01

    Here we report a novel transitional metal oxide (NiCo2O4) coated Li[Ni0.03Mn1.97]O4 micro-/nano- spheres as high-performance Li-ion battery cathode material. A thin layer of ∼10 nm NiCo2O4 was formed by simple wet-chemistry approach adjacent to the surface of Li[Ni0.03Mn1.97]O4 micro-/nano- spheres, leading to significantly enhanced battery electrochemical performance. The optimized sample(1 wt%) not only delivers excellent discharge capacity and cycling stability improvement at both room temperature and elevated temperatures, but also effectively prevents Mn dissolution while retaining its coating structure intact according to XRF and TEM results. The CV and EIS break-down analysis indicated a much faster electrochemical reaction kinetics, more reversible electrode process and greatly reduced charge transfer and Warburg resistance, clearly illustrating the dual role of NiCo2O4 coating to boost electron transport and Li+ diffusion, and alleviation of manganese dissolving. This approach may render as an efficient technique to realize high-performance lithium ion battery cathode material.

  9. Comparative study of fixation of Co57 labelled bleomycin, labelled gallium citrate and Hg197 labelled mercury chloride, benign or malignant pulmonary lesions

    International Nuclear Information System (INIS)

    Bertrand, A.; Vaillant, G.; Robert, J.; Vaillant, D.; Nouel, J.P.; Delorme, J.; Lamy, P.

    1975-01-01

    Over the last ten years, numerous labelled molecules have been used in lung diseases, in order to attempt definite localisation of primary or secondary carcinoma. Three of these substances are now used: cobalt 57-labelled bleomycin, Hg 197 Cl 2 and Ga 67 citrate. A study of 34 patient with malignant or tuberculous lung disease with definite diagnosis, permitted demonstration of the fact that the highest uptake, or the best images, were obtained with labelled bleomycin. However, the long period of Co 57 limits its indications in young subjects and, in these cases, HgCl 2 is indicated [fr

  10. The Installation Restoration Program Toxicology Guide. Volume 2

    Science.gov (United States)

    1987-05-01

    Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

  11. Determining conductivity and mobility values of individual components in multiphase composite Cu1.97Ag0.03Se

    International Nuclear Information System (INIS)

    Day, Tristan W.; Brown, David R.; Snyder, G. Jeffrey; Zeier, Wolfgang G.; Melot, Brent C.

    2014-01-01

    The intense interest in phase segregation in thermoelectrics as a means to reduce the lattice thermal conductivity and to modify the electronic properties from nanoscale size effects has not been met with a method for separately measuring the properties of each phase assuming a classical mixture. Here, we apply effective medium theory for measurements of the in-line and Hall resistivity of a multiphase composite, in this case Cu 1.97 Ag 0.03 Se. The behavior of these properties with magnetic field as analyzed by effective medium theory allows us to separate the conductivity and charge carrier mobility of each phase. This powerful technique can be used to determine the matrix properties in the presence of an unwanted impurity phase, to control each phase in an engineered composite, and to determine the maximum carrier concentration change by a given dopant, making it the first step toward a full optimization of a multiphase thermoelectric material and distinguishing nanoscale effects from those of a classical mixture.

  12. Measured lifetimes of states in 197Au and a critical comparison with the weak-coupling core-excitation model

    International Nuclear Information System (INIS)

    Bolotin, H.H.; Kennedy, D.L.; Linard, B.J.; Stuchbery, A.E.

    1979-01-01

    The lifetimes of five excited states in 197 Au up to an excitation energy of 885 keV were measured by the recoil-distance method (RDM). These levels were populated by Coulomb excitation using both 90 MeV 20 Ne and 120 MeV 35 Cl ion beams. The experimentally determined spectroscopy of the low-lying levels 3/2 + (ground state) and 1/2 + , (3/2) + 2 , 5/2 + and 7/2 + at 77.3, 268.8, 278.9, and 547.5 keV excitation energy, respectively, has been critically compared with the detailed predictions of the de-Shalit weak-coupling core-excitation model. When the model is taken to represent the case of a dsub(3/2) proton hole coupled to a 198 Hg core, the model parameters obtained are in accord with the criteria implicit for weak core coupling and, at the same time, are in remarkably good agreement with virtually all measured E2 and M1 transition rates. (Auth.)

  13. {sup 197}Au irradiation study of phase-change memory cell with GeSbTe alloy

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Liangcai; Song, Zhitang; Lian, Jie; Rao, Feng; Liu, Bo; Song, Sannian; Liu, Weili; Feng, Songlin [State Key Laboratory of Functional Materials for Informatics, Laboratory of Nanotechnology, Shanghai Institute of Micro-system and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Zhou, Xilin; Liu, Xuyan [State Key Laboratory of Functional Materials for Informatics, Laboratory of Nanotechnology, Shanghai Institute of Micro-system and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100080 (China)

    2010-10-15

    A {sup 197}Au ion source was used to irradiate a Ge{sub 2}Sb{sub 2}Te{sub 5}-alloy-based phase-change memory (PCM) cell to study the ion-irradiation effect on the properties of the cell. The PCM devices with the tungsten (W) heating electrode of 260 nm diameter were fabricated by 0.18 {mu}m complementary metal-oxide-semiconductor (CMOS) technology. Four different doses (10{sup 10}, 10{sup 11}, 10{sup 12}, and 5 x 10{sup 12} ions/cm{sup 2}, respectively) were applied to irradiate the PCM cell. The samples before and after irradiation were characterized by current-voltage and resistance measurements at room temperature. It is found that the cell properties (resistance value of the amorphous and crystalline states, threshold voltage, and current for phase transition, etc.) have hardly changed, even for the sample irradiated up to 10{sup 12} ions/cm{sup 2} dose, and the cell still has good set-reset operation ability (above 10{sup 5} cycles). Furthermore, the resistance ratio remains at 1000 even after 10{sup 5} cycles of the set-reset operation. The results show the PCM cell with Ge{sub 2}Sb{sub 2}Te{sub 5} alloy has a strong ion-irradiation tolerance. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  14. Equilibration in the reaction of 175 and 252 MeV 20Ne with 197Au

    International Nuclear Information System (INIS)

    Moulton, J.B.

    1978-06-01

    The highly inelastic nuclear reaction of 197 Au with 20 Ne at 175 and 252 MeV laboratory energies is studied. Energy-, elemental-, and angular- distributions for atomic numbers 5 to 30 (175 MeV) or 34 (252 MeV) are presented. The means and widths of the kinetic energy spectra for detected elements are compared with a theoretical calculation. The calculation postulates thermalization of the incident projectile kinetic energy, and includes one sha(e-vibrational degree of freedom and rigid rotation of the reaction complex. The effect of particle evaporation is considered. Good agreement of the expurimental mean energies with the theory is obtained. Poorer agreement of the kinetic energy widths with the theory may be due to a low-temperature quantal effect. The relative elemental yields are analyzed for their degree of equilibration, based on a model of diffusive nucleon exchange as described by the master equation. A similar degree of equilibration is observed for both reaction energies. The absolute elemental yields are reproduced qualitatively by employing an advanced diffusion code, coupled with calculation of the subsequent fission of heavy reaction products, including the compound nucleus. The angular distributions are analyzed with a simple model, to estimate the reaction lifetime of selected elements

  15. Measurement of excitation functions and isomeric ratios of the 197Au(3He,xn)200- sup(x)Tl reactions, where x=2,3 and 4

    International Nuclear Information System (INIS)

    Vinagre Filho, U.M.

    1983-01-01

    The excitation functions and isomer ratios of the 197 Au( 3 He,xn) 200- sup(x)Tl reactions, with x = 2, 3 and 4, were measured at bombarding energies in the range from 15 to 36 MeV. The measured values were compared to those obtained with the use of the statistical an hybrid modeles, calculated by the ALICE code. Best fit was achieved using the simple statistical model. The results were also compared to those found in literature for the ( 3 He,xn) and ( 4 He,xn) reactions in gold. (Author) [pt

  16. Cross-sections of 197Au(n,α)198Au and 63Cu(n,α)64Cu induced by 252Cf neutrons

    International Nuclear Information System (INIS)

    Mandal, Ranjita; Sengupta, D.; Roy, Malobika; Naik, Mamta; Bhoraskar, V.N.

    2014-01-01

    Analytical work, employing nuclear techniques, is normally carried out through (n,α) reaction because of the availability of neutrons either from reactors or laboratory sources such as Sb-Be, Am-Be, Ra-Be, Po-Be, 252 Cf, etc. The laboratory neutron sources are though portable and adaptable to a particular experimental arrangement, suffer from the disadvantage of slow neutron yield (except 252 Cf). In this set up since the neutrons available are monoenergetic, it was thought appropriate to initiate a program to measure cross-sections of a few nuclear reactions which have practical applications. Earlier studies on cross-section measurement of the reaction 197 Au(n,α) 198 Au and 63 Cu(n,α) 64 Cu has been carried out using different sources, monitors and techniques

  17. Gamma rays as probe of fission and quasi-fission dynamics in the reaction 32S + 197Au near the Coulomb barrier

    Science.gov (United States)

    Pulcini, A.; Vardaci, E.; Kozulin, E.; Ashaduzzaman, M.; Borcea, C.; Bracco, A.; Brambilla, S.; Calinescu, S.; Camera, F.; Ciemala, M.; de Canditiis, B.; Dorvaux, O.; Harca, I. M.; Itkis, I.; Kirakosyan, V. V.; Knyazheva, G.; Kozulina, N.; Kolesov, I. V.; La Rana, G.; Maj, A.; Matea, I.; Novikov, K.; Petrone, C.; Quero, D.; Rath, P.; Saveleva, E.; Schmitt, C.; Sposito, G.; Stezowski, O.; Trzaska, W. H.; Wilson, J.

    2018-05-01

    Compound nucleus fission and quasi-fission are both binary decay channels whose common properties make the experimental separation between them difficult. A way to achieve this separation could be to probe the angular momentum of the binary fragments. This can be done detecting gamma rays in coincidence with the two fragments. As a case study, the reaction 32S + 197Au near the Coulomb barrier has been performed at the Tandem ALTO facility at IPN ORSAY. ORGAM and PARIS, two different gamma detectors arrays, are coupled with the CORSET detector, a two-arm time-of-flight spectrometer. TOF-TOF data were analyzed to reconstruct the mass-energy distribution of the primary fragments coupled with gamma multiplicity and spectroscopic analysis. Preliminary results of will be shown.

  18. A Phase-1b study of tivantinib (ARQ 197) in adult patients with hepatocellular carcinoma and cirrhosis

    Science.gov (United States)

    Santoro, A; Simonelli, M; Rodriguez-Lope, C; Zucali, P; Camacho, L H; Granito, A; Senzer, N; Rimassa, L; Abbadessa, G; Schwartz, B; Lamar, M; Savage, R E; Bruix, J

    2013-01-01

    Background: The mesenchymal-epithelial transition factor (MET) receptor is dysregulated in hepatocellular carcinoma (HCC), and tivantinib (ARQ 197) is an oral, selective, MET inhibitor. Methods: This Phase-1b study assessed tivantinib safety as primary objective in patients with previously treated HCC and Child-Pugh A or B liver cirrhosis. Patients received oral tivantinib 360 mg twice daily until disease progression or unacceptable toxicity. Results: Among 21 HCC patients, common drug-related adverse events (AEs) were neutropaenia, anaemia, asthenia, leucopaenia, anorexia, diarrhoea, and fatigue. No drug-related worsening of liver function or performance status occurred, but one Child-Pugh B patient experienced drug-related bilirubin increase. Four patients had drug-related serious AEs, including one neutropaenia-related death. Haematologic toxicities were more frequent than in previous tivantinib studies but were manageable with prompt therapy. Best response was stable disease (median, 5.3 months) in 9 of 16 evaluable patients (56%). Median time to progression was 3.3 months. Conclusion: Tivantinib demonstrated a manageable safety profile and preliminary antitumour activity in patients with HCC and Child-Pugh A or B cirrhosis. PMID:23287988

  19. Multiplicity correlations of intermediate-mass fragments with pions and fast protons in 12C + 197AU

    International Nuclear Information System (INIS)

    Turzo, K.; Begemann-Blaich, M.L.; Auger, G.

    2003-12-01

    Low-energy π + (E π 12 C+ 197 Au collisions at incident energies from 300 to 1800 MeV per nucleon were detected with the Si-Si(Li)-CsI(Tl) calibration telescopes of the INDRA multidetector. The inclusive angular distributions are approximately isotropic, consistent with multiple rescattering in the target spectator. The multiplicity correlations of the low-energy pions and of energetic protons (E p >or ≤ 150 MeV) with intermediate-mass fragments were determined from the measured coincidence data. The deduced correlation functions 1 + R ∼ 1.3 for inclusive event samples reflect the strong correlations evident from the common impact-parameter dependence of the considered multiplicities. For narrow impact-parameter bins (based on charged-particle multiplicity), the correlation functions are close to unity and do not indicate strong additional correlations. Only for pions at high particle multiplicities (central collisions) a weak anticorrelation is observed, probably due to a limited competition between these emissions. Overall, the results are consistent with the equilibrium assumption made in statistical multifragmentation scenarios. Predictions obtained with intranuclear cascade models coupled to the statistical multifragmentation model are in good agreement with the experimental data. (orig.)

  20. Studies of highly ionized atoms using internal conversion: 197Au, 57Fe; electric monopole transitions in 40Ca, 42Ca, and 44Ca

    International Nuclear Information System (INIS)

    Ulrickson, M.A.

    1975-01-01

    By using heavy-ion reactions, highly ionized electronic states of atoms may be produced. The interaction between excited nuclear levels and the surrounding atomic electrons via internal conversion allows the nucleus to be used as a probe of the electronic structure of the highly ionized atoms. Studies of such atoms were undertaken for strongly internally converted nuclear levels in 197 Au and 57 Fe. The nuclear levels were Coulomb excited by using 16 O and 32 S beams. Simultaneous measurement of the lifetime of the 77-keV state of 197 Au in both neutral gold atoms and gold atoms with mean charge +10 resulted in a measured change in the internal conversion coefficient of Δalpha/alpha equals - 1.7 +- 3.0)10 -3 . This result is consistent with calculations using a Hartree-Fock--Slater program. Measurements of the electric monopole strengths for 0 + → 0 + transitions were undertaken to determine the amount of core-deformation in calcium nuclei. The E0 strengths for the decays of the 0 + states at 5.21 MeV in 40 C, 1.84 MeV in 42 Ca, and 1.88 MeV in 44 Ca were observed. The branching ratios for the subsequent E0 pair decays were measured by observing the coincident annihilation radiation from the e + member of the pair in coincidence with protons feeding the state in the cases of 42 Ca and 44 Ca, and by observing the actual coincident e + --e - pair together with protons feeding the state in the case of 40 Ca. The resulting E0 strengths (rho less than or equal to 0.06, rho = 0.34 +- 0.03, rho = 0.30 +- 0.10 for 40 Ca, 42 Ca, and 44 Ca respectively) agree with theoretical descriptions

  1. Studying Angular Distribution of Neutron for (p,n) Reaction from 0.5 GeV to 1.5 GeV on some Heavy Targets 238U, 206Pb, 197Au, 186W

    International Nuclear Information System (INIS)

    Nguyen Mong Giao; Tran Thanh Dung; Nguyen Thi Ai Thu; Huynh Thi Xuan Tham

    2010-08-01

    The angular distributions of neutron are calculated for a spallation reaction induced by proton energy from 0.5 GeV to 1.5 GeV on target nuclei 206 Pb, 197 Au, 238 U, 186 W. In this report, we use nuclear data of JENDL-HE with evaluated proton induced cross-sections up to 3 GeV. The obtained results have been discussed in detail. (author)

  2. Cross-resistance patterns to acetolactate synthase (ALS)-inhibiting herbicides of flixweed (Descurainia sophia L.) conferred by different combinations of ALS isozymes with a Pro-197-Thr mutation or a novel Trp-574-Leu mutation.

    Science.gov (United States)

    Deng, Wei; Yang, Qian; Zhang, Yongzhi; Jiao, Hongtao; Mei, Yu; Li, Xuefeng; Zheng, Mingqi

    2017-03-01

    Acetolactate synthase (ALS) is the common target of ALS-inhibiting herbicides, and target-site ALS mutations are the main mechanism of resistance to ALS-inhibiting herbicides. In this study, ALS1 and ALS2 genes with full lengths of 2004bp and 1998bp respectively were cloned in individual plants of susceptible (S) or resistant (R) flixweed (Descurainia sophia L.) populations. Two ALS mutations of Pro-197-Thr and/or Trp-574-Leu were identified in plants of three R biotypes (HB24, HB30 and HB42). In order to investigate the function of ALS isozymes in ALS-inhibiting herbicide resistance, pHB24 (a Pro-197-Thr mutation in ALS1 and a wild type ALS2), pHB42 (a Trp-574-Leu mutation in ALS1 and a wild type ALS2) and pHB30 (a Trp-574-Leu mutation in ALS1 and a Pro-197-Thr mutation in ALS2) subpopulations individually homozygous for different ALS mutations were generated. Individuals of pHB30 had mutations in each isozyme of ALS and had higher resistance than pHB24 and pHB42 populations containing mutations in only one ALS isozyme. Moreover, the pHB24 had resistance to SU, TP and SCT herbicides, whereas pHB24 and pHB42 had resistance to these classes of herbicides as well as IMI and PTB herbicides. The sensitivity of isolated ALS enzyme to inhibition by herbicides in these populations correlated with whole plant resistance levels. Therefore, reduced ALS sensitivity resulting from the mutations in ALS was responsible for resistance to ALS-inhibiting herbicides in flixweed. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Separation of {sup 195(m,g),197m}Hg from bulk gold target by liquid-liquid extraction using hydrophobic ionic liquids

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Kaustab; Lahiri, Susanta [Saha Institute of Nuclear Physics, Kolkata (India). Chemical Sciences Div.; Maiti, Moumita [Indian Institute of Technology Roorkee, Roorkee (India). Dept. of Physics

    2017-07-01

    The {sup 195(m,g),197m}Hg radionuclides were produced in accelerator when natural Au foil was irradiated with 23 MeV protons. The no-carrier-added (NCA) Hg radioisotopes were separated from the bulk Au target by liquid-liquid extraction (LLX) employing hydrophobic RTILs 1-butyl-3-methylimidazolium hexafluorophosphate([C{sub 4}mim][PF{sub 6}]) and 1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide([bmim][Tf{sub 2}N]) as extractant with HNO{sub 3} and HCl. In each case, bulk Au was extracted into the RTIL phase leaving NCA Hg-radionuclides in the aqueous phase. The RTILs were recovered by washing with 1 M K{sub 2}S{sub 2}O{sub 5} and freshly prepared 1 M FeSO{sub 4}. The reported separation methods follow green chemistry approach as it does not involve any volatile reagents.

  4. Validation of absolute axial neutron flux distribution calculations with MCNP with 197Au(n,γ)198Au reaction rate distribution measurements at the JSI TRIGA Mark II reactor.

    Science.gov (United States)

    Radulović, Vladimir; Štancar, Žiga; Snoj, Luka; Trkov, Andrej

    2014-02-01

    The calculation of axial neutron flux distributions with the MCNP code at the JSI TRIGA Mark II reactor has been validated with experimental measurements of the (197)Au(n,γ)(198)Au reaction rate. The calculated absolute reaction rate values, scaled according to the reactor power and corrected for the flux redistribution effect, are in good agreement with the experimental results. The effect of different cross-section libraries on the calculations has been investigated and shown to be minor. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Determining conductivity and mobility values of individual components in multiphase composite Cu{sub 1.97}Ag{sub 0.03}Se

    Energy Technology Data Exchange (ETDEWEB)

    Day, Tristan W.; Brown, David R.; Snyder, G. Jeffrey, E-mail: jsnyder@caltech.edu [Department of Materials Science, California Institute of Technology, MC 309-81, Pasadena, California 91106 (United States); Zeier, Wolfgang G. [Department of Materials Science, California Institute of Technology, MC 309-81, Pasadena, California 91106 (United States); Department of Chemistry, University of Southern California, Seeley G. Mudd Bldg., 3620 McClintock Ave., Los Angeles, California 90089-1062 (United States); Melot, Brent C. [Department of Chemistry, University of Southern California, Seeley G. Mudd Bldg., 3620 McClintock Ave., Los Angeles, California 90089-1062 (United States)

    2014-10-27

    The intense interest in phase segregation in thermoelectrics as a means to reduce the lattice thermal conductivity and to modify the electronic properties from nanoscale size effects has not been met with a method for separately measuring the properties of each phase assuming a classical mixture. Here, we apply effective medium theory for measurements of the in-line and Hall resistivity of a multiphase composite, in this case Cu{sub 1.97}Ag{sub 0.03}Se. The behavior of these properties with magnetic field as analyzed by effective medium theory allows us to separate the conductivity and charge carrier mobility of each phase. This powerful technique can be used to determine the matrix properties in the presence of an unwanted impurity phase, to control each phase in an engineered composite, and to determine the maximum carrier concentration change by a given dopant, making it the first step toward a full optimization of a multiphase thermoelectric material and distinguishing nanoscale effects from those of a classical mixture.

  6. A simple method for labelling proteins with 211At via diazotized aromatic diamine

    International Nuclear Information System (INIS)

    Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

    1987-01-01

    A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

  7. Temperature and excitation energy of hot nuclei in the reaction of 40Ar+197Au at 25 MeV/nucleon

    International Nuclear Information System (INIS)

    Wu, H.; Jin, G.; Li, Z.; Dai, G.; Qi, Y.; He, Z.; Luo, Q.; Duan, L.; Wen, W.; Zhang, B.

    1997-01-01

    The coincidence measurements between heavy fission fragments and light charged particles with Z ≤2 were carried out for the 40 Ar+ 197 Au reaction at 25 MeV/nucleon, to study the properties of hot nuclei in heavy ion induced reactions. The linear momentum transfers (LMTs) were deduced from the folding angle and the time-of-flight difference between two fission fragments of heavy residues. The relationship of the nuclear temperature (slope parameter of the energy spectrum) and the excitation energy was determined independently from the measurement of the kinetic energy spectra in the frames of the emitting sources and from the LMT analysis. Both the temperature and the excitation energy increase with decreasing impact parameter, which suggests that a plateau temperature of 5.5 MeV is reached at an excitation energy of 3.1 MeV/nucleon. The result was also compared with various statistical models that explain the plateau by the multifragmentation process, where the excitation energy is assumed to be stored in compression and expansion effects. (orig.)

  8. Thermal neutron calibration of a tritium extraction facility using the 6Li(n,t)4He/197Au(n,γ)198Au cross section ratio for standardization

    International Nuclear Information System (INIS)

    Bretscher, M.M.; Smith, D.L.

    1980-08-01

    Absolute tritium activities in a neutron-activated metallic lithium samples have been measured by liquid scintillation methods to provide data needed for the determination of capture-to-fission ratios in fast breeder reactor spectra and for recent measurements of the 7 Li(n,n't) 4 He cross section. The tritium extraction facility used for all these experiments has now been calibrated by measuring the 6 Li(n,t) 4 He/ 197 Au/n,γ) 198 Au activity ratio for thermal neutrons and comparing the result with the well-known cross sections. The calculated-to-measured activity ratio was found to be 1.033 +- 0.018. 2 figures, 20 tables

  9. Structural, (197)Au Mössbauer and solid state (31)P CP/MAS NMR studies on bis (cis-bis(diphenylphosphino)ethylene) gold(I) complexes [Au(dppey)(2)]X for X = PF(6), I.

    Science.gov (United States)

    Healy, Peter C; Loughrey, Bradley T; Bowmaker, Graham A; Hanna, John V

    2008-07-28

    (197)Au Mössbauer spectra for the d(10) gold(i) phosphine complexes, [Au(dppey)(2)]X (X = PF(6), I; dppey = (cis-bis(diphenylphosphino)ethylene), and the single crystal X-ray structure and solid state (31)P CPMAS NMR spectrum of [Au(dppey)(2)]I are reported here. In [Au(dppey)(2)]I the AuP(4) coordination geometry is distorted from the approximately D(2) symmetry observed for the PF(6)(-) complex with Au-P bond lengths 2.380(2)-2.426(2) A and inter-ligand P-Au-P angles 110.63(5)-137.71(8) degrees . Quadrupole splitting parameters derived from the Mössbauer spectra are consistent with the increased distortion of the AuP(4) coordination sphere with values of 1.22 and 1.46 mm s(-1) for the PF(6)(-) and I(-) complexes respectively. In the solid state (31)P CP MAS NMR spectrum of [Au(dppey)(2)]I, signals for each of the four crystallographically independent phosphorus nuclei are observed, with the magnitude of the (197)Au quadrupole coupling being sufficiently large to produce a collapse of (1)J(Au-P) splitting from quartets to doublets. The results highlight the important role played by the counter anion in the determination of the structural and spectroscopic properties of these sterically crowded d(10) complexes.

  10. Interferometry of light particles with a CsI(Tl) multi-detector in the collision: 16O(93.6 MeV/A) + 197Au

    International Nuclear Information System (INIS)

    Goujdami, D.

    1987-01-01

    Back angle emissions of light particles have been studied by interferometry in the 16 0 + 197 Au reaction. The experiment was performed at GANIL at 93,6 MeV/A. To achieve the correlation functions in the average backward direction we built entirely a compact multi-detector of Csl scintillators which was set up at 115 degrees to the beam direction. This work describes the relevant tests of the detector, data taking and data processing. The p-p, α-α, d-d, α-d, α-t correlations that we studied exhibit a complete damping of two body resonant nuclear effects. The most surprising result concerns the p-p correlation which, by its new shape, could be the signature of a de-excitation process in two steps. The ordering time of the 2 proton cascade would be of the order of 1.5*10 -21 s. (author) [fr

  11. Study of correlations between light particles in 16O + 197Au reaction at 94 MeV/u

    International Nuclear Information System (INIS)

    Ferragut, A.

    1990-11-01

    Heavy ions collisions produce particles sources for which it is possible to determine the spatial and temporal extent by constructing the correlation functions of the emitted particles pairs. The first part of this work composed of four parts, describes the theoretical models required for the extraction of the size and lifetime of the source. The second part presents the set-up of the 16 O + 197 Au at 94 MeV/u experiment. The set-up was constituted by a correlator to measure correlation functions and by a 2 π multidetector to detect light charged particles. We show the experimental technics we have used for the correction from the background coincidences in a multidetector, the experimental correlation functions determination and also, the speed spectra construction for particles which are detected in the multidetector. The third part exhibits our experimental results and shows that the multidetector allows to select different physical events classes according to which we can study the evolution of the sources sizes. The fourth part is a discussion about results coming from the previous part. On the one hand we show that the light charged particles multiplicity between 30 0 and 90 0 is a good filter for the violence of the collision and on the other hand, remarks are made on the validity of the theoretical models. We propose also a different construction technics for the correlation functions. The necessity to calculate correlation functions by considering the statistical model is also mentioned [fr

  12. Central collisions between 28Si nuclei at 12.4, 19.7 and 30.0 MeV per nucleon

    International Nuclear Information System (INIS)

    Meijer, R.J.

    1989-01-01

    The formation and decay of nuclei in central collisions of the 28 Si + 28 Si system at bombarding energies of 12.4, 19.7 and 30.0 MeV per nucleon is studied by analysis of the light particle (LP) spectra measured in coincidence with evaporation residues (ER) and measurements of the inclusive velocity distribution of ER's. From the last set of measurements a strong reduction of the ER cross section at increasing incident energy was observed and especially the relation to a possible vanishing fusion cross section is discussed. The coincidence measurements determines the LP pre-equilibrium contribution and the LP decay modes of highly excited systems. The ER's produced in fusion reactions between 28 Si nuclei were detected with a simple ionization chamber ΔE detector and a surface barrier E detector. For the LP detection multidetector systems consisting of CsI(TL) detectors were used. In this thesis the developments that have led to the construction of a CsI(TL) charged particle detector and of the Utrecht multidetector system, the experimental setup and the methods used in the acquisition, processing and analysis of the data, are described. The results of the heavy-ion velocity measurements are presented and conclusions are drawn about equilibrium and pre-equilibrium processes from the analysis. (H.W.). 124 refs.; 44 figs.; 24 tabs

  13. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  14. Experimental study of the fusion dynamics of 32,34S + 197Au with quasi-elastic scattering

    International Nuclear Information System (INIS)

    Schuck, T.J.; Dasgupta, M.; Timmers, H.

    2000-01-01

    Full text: The fusion dynamics of heavy systems, such as 64 Ni + 208 Pb, leading to the synthesis of super-heavy elements is presently not fully understood. Typical beam energies in such reactions are of the order or smaller than the Coulomb barrier height to minimize the excitation energy of the compound system and increase the survival probability of evaporation residues. It is known that at such energies the relative motion of projectile and target couples to internal degrees of freedom of the system, such as collective motion and particle transfer. This can give rise to a distribution of fusion barriers, which generally leads to an enhancement of the fusion cross-section below the Coulomb barrier. The important role of the individual degrees of freedom can be identified by extracting representations of the barrier distribution from fusion excitation functions. Complementary representations can be obtained from measurements of the quasi-elastic or elastic scattering excitation functions at backward angles. The sensitivity of the representations from scattering is limited to the lower energy part of the barrier distribution, which, however, may contain important signatures of positive Q-value neutron transfer channels. Neutron transfer may be a precursor of neutron flow and neck-formation, which are considered in macroscopic models of the fusion of heavy systems. In order to study the influence of neutron transfer in heavy fusion reactions, quasielastic scattering has been measured for 32 , 34 S + 197 Au at energies spanning the Coulomb barrier. The quasi-elastic yield, including inelastic and transfer reactions, was detected at 165 deg with a Si-surface barrier detector. The excitation functions have been normalized to Rutherford scattering, detected at 30 deg using an existing gas ionisation detector. Representations of the barrier distributions have been extracted and are compared with earlier measurements for 32 S + 208 Pb

  15. Absolute measurement of the cross sections of neutron radiative capture for 23Na, Cr, 55Mn, Fe, Ni, 103Rh, Ta, 197Au and 238U in the 10-600keV energy range

    International Nuclear Information System (INIS)

    Le Rigoleur, Claude; Arnaud, Andre; Taste, Jean.

    1976-10-01

    The total energy weighting technique has been applied to measuring absolute neutron capture cross sections for 23 Na, Cr, 55 Mn, Fe, Ni, 103 Rh, Ta, 197 Au, 238 U in the 10-600keV energy range. A non hydrogeneous liquid scintillator was used to detect the gamma from the cascade. The neutron flux was measured with a 10 B INa(Tl) detector or a 6 Li glass scintillator of well known efficiency. The fast time-of-flight technique was used with on line digital computer data processing [fr

  16. Semisynthetic prion protein (PrP) variants carrying glycan mimics at position 181 and 197 do not form fibrils.

    Science.gov (United States)

    Araman, Can; Thompson, Robert E; Wang, Siyao; Hackl, Stefanie; Payne, Richard J; Becker, Christian F W

    2017-09-01

    The prion protein (PrP) is an N -glycosylated protein attached to the outer leaflet of eukaryotic cell membranes via a glycosylphosphatidylinositol (GPI) anchor. Different prion strains have distinct glycosylation patterns and the extent of glycosylation of potentially pathogenic misfolded prion protein (PrP Sc ) has a major impact on several prion-related diseases (transmissible spongiform encephalopathies, TSEs). Based on these findings it is hypothesized that posttranslational modifications (PTMs) of PrP influence conversion of cellular prion protein (PrP C ) into PrP Sc and, as such, modified PrP variants are critical tools needed to investigate the impact of PTMs on the pathogenesis of TSEs. Here we report a semisynthetic approach to generate PrP variants modified with monodisperse polyethyleneglycol (PEG) units as mimics of N-glycans. Incorporating PEG at glycosylation sites 181 and 197 in PrP induced only small changes to the secondary structure when compared to unmodified, wildtype PrP. More importantly, in vitro aggregation was abrogated for all PEGylated PrP variants under conditions at which wildtype PrP aggregated. Furthermore, the addition of PEGylated PrP as low as 10 mol% to wildtype PrP completely blocked aggregation. A similar effect was observed for synthetic PEGylated PrP segments comprising amino acids 179-231 alone if these were added to wildtype PrP in aggregation assays. This behavior raises the question if large N-glycans interfere with aggregation in vivo and if PEGylated PrP peptides could serve as potential therapeutics.

  17. Measurement of 197Au(tau,xnyp) excitation functions for 15 MeV <= Esub(tau) <= 135 MeV and analysis in the framework of the hybrid model

    International Nuclear Information System (INIS)

    Bousshid, O.

    1981-01-01

    The (tau,xnyp)-reactions on 197 Au were measured. The 3 He incident energy was between 15 MeV and 135 MeV. The experiments were carried out using the stacked-foils technique. Cross sections were determind from the activity of the residual nuclei. The (tau,xn)-excitation functions were measured for 2 = 70 MeV as well as x >= 7 were measured for the first time. Further the (tau,pxn)- and (tau,2pxn)-excitation functions, which were not known so far, have now been measured. The analysis within the framework of the hybrid model for precompound-nuclear-reactions followed by an evaporation cascade, resulted in the best agreement between experimental data and theoretical model calculation using an initial exciton number nsub(o) = 5 (1n+3p+1h). The region of validity of the hybrid model for complex projectiles is discussed. (orig.) [de

  18. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  19. The diversity of the effects of sulfur mustard gas inhalation on respiratory system 10 years after a single, heavy exposure: analysis of 197 cases.

    Science.gov (United States)

    Emad, A; Rezaian, G R

    1997-09-01

    To find out the late pulmonary sequelae of sulfur mustard gas inhalation in 197 veterans, 10 years after their exposure. Cross-sectional clinical study. University hospital. One hundred ninety-seven veterans with a single, heavy exposure to sulfur mustard gas in 1986 and 86 nonexposed veterans as their control group. Pulmonary function tests, carbon monoxide diffusion capacity, bronchoscopy, and high-resolution CT of the chest were performed in all patients. Transbronchial lung biopsy was done in 24 suspected cases of pulmonary fibrosis. Asthma was diagnosed in 21 (10.65%), chronic bronchitis in 116 (58.88%), bronchiectasis in 17 (8.62%), airway narrowing due to searing or granulation tissue in 19 (9.64%), and pulmonary fibrosis in 24 (12.18%) cases. None of these were found among the control group except for a single case of chronic bronchitis. Although the respiratory symptoms of an acute sulfur mustard gas inhalation are usually transient and nonspecific, it can lead to the development of a series of chronic destructive pulmonary sequelae in such cases.

  20. Measurement of Fragment Production Cross Sections in the $^{12}$C+$^{12}$C and $^{12}$C+$^{197}$Au Reactions at 62 $A$ MeV for Hadrontherapy and Space Radiation Protection

    CERN Document Server

    Tropea, S; Agodi, C; Blancato, A A; Bondì, M; Cappuzzello, F; Carbone, D; Cavallaro, M; Cirrone, G A P; Cuttone, G; Giacoppo, F; Nicolosi, D; Pandola, L; Raciti, G; Rapisarda, E; Romano, F; Sardina, D; Scuderi, V; Sfienti, C

    2014-01-01

    Over the last twenty years, there has been a renewed interest in nuclear fragmentation studies for both hadrontherapy applications and space radiation protection. In both fields, fragmentation cross sections are needed to predict the effects of the ions nuclear interactions within the patient’s and the astronaut’s body. Indeed, the Monte Carlo codes used in planning tumor treatments and space missions must be tuned and validated by experimental data. However, only a limited set of fragmentation cross sections are available in literature, especially at Fermi energies. Therefore, we have studied the production of secondary fragments in the 12 C+ 12 C and 12 C+ 197 Au reactions at 62 A MeV. In this work, the measured 4 He cross sections angular distributions at four selected angles are presented and compared.

  1. Experimental study of the A(e,e'π+) reaction on 1H, 2H, 12C, 27Al, 63Cu, and 197Au

    International Nuclear Information System (INIS)

    Qian, X.; Gao, H.; Kramer, K.; Horn, T.; Clasie, B.; Seely, J.; Arrington, J.; El Fassi, L.; Zheng, X.; Asaturyan, R.; Mkrtchyan, H.; Navasardyan, T.; Tadevosyan, V.; Benmokhtar, F.; Boeglin, W.; Markowitz, P.; Bosted, P.; Bruell, A.; Chudakov, E.; Ent, R.

    2010-01-01

    Cross sections for the 1 H(e,e ' π + )n process on 1 H, 2 H, 12 C, 27 Al, 63 Cu, and 197 Au targets were measured at the Thomas Jefferson National Accelerator Facility (Jefferson Lab) to extract nuclear transparencies. Data were taken from Q 2 =1.1-4.7 GeV 2 for a fixed center-of-mass energy of W=2.14 GeV. The ratio of σ L and σ T was extracted from the measured cross sections for 1 H, 2 H, 12 C, and 63 Cu targets at Q 2 =2.15 and 4.0 GeV 2 , allowing for additional studies of the reaction mechanism. In this article, we present the experimental setup and the analysis of the data in detail, including systematic uncertainty studies. Differential cross sections and nuclear transparencies as a function of the pion momentum at different values of Q 2 are presented. Our results are consistent with the predicted early onset of color transparency in mesons. Global features of the data are discussed and the data are compared with model calculations for the 1 H(e,e ' π + )n reaction from nuclear targets.

  2. Triple differential cross section for angle, atomic number and energy (or angular momentum transfer) calculated for the 280MeV 40Ar+58Ni (or 365 MeV 63Cu+197Au) system in a simple model

    International Nuclear Information System (INIS)

    Berlanger, M.; Grange, P.; Richert, J.; Hofmann, H.; Ngo, C.

    1978-01-01

    A dynamical model including both dissipation and statistical fluctuations is applied to the computation of triple differential cross sections for deep inelastic reactions. It is seen that for different Z values the overall pattern of the cross section (calculated, for the 280 MeV 40 Ar+ 58 Ni system) as a function of E and theta is fairly well reproduced - the mean angular momentum transfer for the 365MeV 63 Cu+ 197 Au system is calculated and compared with γ-multiplicity measurements. In both applications, possible implications of the remaining discrepancies are discussed

  3. 197 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Methods: A randomized open label study with participants allocated into three ... La division des Sciences Clinique et Laboratoire de Virologie Humaine, l'Institut nigérian de Recherche Médicale, ... Mots clés : La co - infection VIH/HBV, complément de Sélénium, HAART. .... monitor version 1.5 (Roche Diagnostic Systems,.

  4. Real-world data of 197 patients treated with ulipristal acetate for uterine fibroids: PREMYA study French population main outcomes.

    Science.gov (United States)

    Fernandez, H; Descamps, P; Koskas, M; Lopès, P; Brun, J L; Darai, E; Agostini, A

    2017-09-01

    To characterize and describe treatment with ulipristal acetate (UPA) in a preoperative setting and to evaluate the safety, effectiveness, and Health Related Quality of Life (HRQoL) outcomes in a French population treated according to standard clinical practice. Multicentre, prospective, non-interventional study (PREMYA) of patients diagnosed with moderate to severe symptoms of uterine fibroids and undergoing a preoperative treatment with UPA 5mg (Esmya ® ). Patients were followed for a total of 15months (3months UPA treatment and 12months after). Data were collected approximatively every 3months according to centre usual visit schedule. A total of 206 women were enrolled in France, of whom 197 were found to be eligible for data analysis. Physicians' assessments of patients' overall symptomatic changes, as measured on the Clinical Global Impression-Improvement (CGI-I) scale, indicated that 83.7% of patients were improved at end of treatment (month 3). On the patients' treatment benefit scale (PTBS), 94.7% of patients reported an improvement. These 2 measurements, pain and quality of life, remained improved after treatment cessation and during the entire period of follow-up. Only 58.4% of patients underwent surgery within the timeframe of the study follow-up of which the majority were of a conservative/minimal invasive nature. Many patients did not undergo surgery during the planned 12months follow-up period after treatment whereas all patients had an indication of surgery. All measurements of treatment outcome were markedly improved by 3 months of UPA 5mg treatment. NCT01635452. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  5. The Drosophila genome nexus: a population genomic resource of 623 Drosophila melanogaster genomes, including 197 from a single ancestral range population.

    Science.gov (United States)

    Lack, Justin B; Cardeno, Charis M; Crepeau, Marc W; Taylor, William; Corbett-Detig, Russell B; Stevens, Kristian A; Langley, Charles H; Pool, John E

    2015-04-01

    Hundreds of wild-derived Drosophila melanogaster genomes have been published, but rigorous comparisons across data sets are precluded by differences in alignment methodology. The most common approach to reference-based genome assembly is a single round of alignment followed by quality filtering and variant detection. We evaluated variations and extensions of this approach and settled on an assembly strategy that utilizes two alignment programs and incorporates both substitutions and short indels to construct an updated reference for a second round of mapping prior to final variant detection. Utilizing this approach, we reassembled published D. melanogaster population genomic data sets and added unpublished genomes from several sub-Saharan populations. Most notably, we present aligned data from phase 3 of the Drosophila Population Genomics Project (DPGP3), which provides 197 genomes from a single ancestral range population of D. melanogaster (from Zambia). The large sample size, high genetic diversity, and potentially simpler demographic history of the DPGP3 sample will make this a highly valuable resource for fundamental population genetic research. The complete set of assemblies described here, termed the Drosophila Genome Nexus, presently comprises 623 consistently aligned genomes and is publicly available in multiple formats with supporting documentation and bioinformatic tools. This resource will greatly facilitate population genomic analysis in this model species by reducing the methodological differences between data sets. Copyright © 2015 by the Genetics Society of America.

  6. Structure and Properties of Ti-19.7Nb-5.8Ta Shape Memory Alloy Subjected to Thermomechanical Processing Including Aging

    Science.gov (United States)

    Dubinskiy, S.; Brailovski, Vladimir; Prokoshkin, S.; Pushin, V.; Inaekyan, K.; Sheremetyev, V.; Petrzhik, M.; Filonov, M.

    2013-09-01

    In this work, the ternary Ti-19.7Nb-5.8Ta (at.%) alloy for biomedical applications was studied. The ingot was manufactured by vacuum arc melting with a consumable electrode and then subjected to hot forging. Specimens were cut from the ingot and processed by cold rolling with e = 0.37 of logarithmic thickness reduction and post-deformation annealing (PDA) between 400 and 750 °C (1 h). Selected samples were subjected to aging at 300 °C (10 min to 3 h). The influence of the thermomechanical processing on the alloy's structure, phase composition, and mechanical and functional properties was studied. It was shown that thermomechanical processing leads to the formation of a nanosubgrained structure (polygonized with subgrains below 100 nm) in the 500-600 °C PDA range, which transforms to a recrystallized structure of β-phase when PDA temperature increases. Simultaneously, the phase composition and the β → α″ transformation kinetics vary. It was found that after conventional cold rolling and PDA, Ti-Nb-Ta alloy manifests superelastic and shape memory behaviors. During aging at 300 °C (1 h), an important quantity of randomly scattered equiaxed ω-precipitates forms, which results in improved superelastic cyclic properties. On the other hand, aging at 300 °C (3 h) changes the ω-precipitates' particle morphology from equiaxed to elongated and leads to their coarsening, which negatively affects the superelastic and shape memory functional properties of Ti-Nb-Ta alloy.

  7. Potential energy effects and diffusion in the relaxed components of the reaction 197Au + 40Ar at 288 and 340 MeV bombarding energies

    International Nuclear Information System (INIS)

    Moretto, L.G.; Galin, J.; Babinet, R.; Fraenkel, Z.; Schmitt, R.; Jared, R.; Thompson, S.G.

    1976-01-01

    The fragments emitted in the reaction between 197 Au and 40 Ar at 288 and 340 MeV bombarding energies have been studied. The fragments have been identified in atomic number up to Z = 32 by means of an E-ΔE telescope. The kinetic energy distributions, the cross sections and the angular distributions have been measured for each Z. The kinetic energy distributions show the typical quasielastic and relaxed components; the Z-distributions show a smooth increase in the cross section with increasing Z, interrupted at relatively forward angles by a fairly sharp peak close to Z = 18. The angular distributions are forward peaked in excess of 1/sin theta for atomic numbers as large as Z approximately 30, as far as twelve atomic number units above the projectile; this is at variance with other reactions like Ag+ 20 Ne, where the angular distributions become 1/sin(theta) four or five atomic number units above the projectile. This is interpreted in terms of an enhanced diffusion towards symmetry, possibly promoted by the potential energy in the intermediate complex corresponding to two fragments in contact. (Auth.)

  8. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    1995-07-01

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  9. Plasma and memory B-cell kinetics in infants following a primary schedule of CRM 197-conjugated serogroup C meningococcal polysaccharide vaccine.

    Science.gov (United States)

    Kelly, Dominic F; Snape, Matthew D; Perrett, Kirsten P; Clutterbuck, Elizabeth A; Lewis, Susan; Blanchard Rohner, Geraldine; Jones, Meryl; Yu, Ly-Mee; Pollard, Andrew J

    2009-05-01

    The induction of persistent protective levels of pathogen-specific antibody is an important goal of immunization against childhood infections. However, antibody persistence is poor after immunization in infancy versus later in life. Serogroup C meningococci (MenC) are an important cause of bacteraemia and meningitis in children. The use of protein-polysaccharide conjugate vaccines against MenC has been associated with a significant decline in the incidence of invasive disease. However, vaccine effectiveness is negligible by more than 1 year after a three-dose priming series in infancy and corresponds to a rapid decline in antibody following an initial immune response. The cellular mechanisms underlying the generation of persistent antibody in this age group are unclear. An essential prelude to larger studies of peripheral blood B cells is an understanding of B-cell kinetics following immunization. We measured MenC- and diphtheria-specific plasma and memory B-cell kinetics in infants receiving a CRM(197) (cross-reactive material; mutant diphtheria toxoid)-conjugated MenC vaccine at 2, 3 and 4 months of age. Plasma cell responses were more delayed after the first dose when compared with the rapid appearance of plasma cells after the third dose. Memory B cells were detectable at all time-points following the third dose as opposed to the low frequency seen following a first dose. This study provides data on B-cell kinetics following a primary schedule of immunization in young infants upon which to base further studies of the underlying cellular mechanism of humoral immunity.

  10. Correlations of light particles in the reaction 40Ar on 197Au at E/A=200 MeV

    International Nuclear Information System (INIS)

    Kunde, G.J.

    1990-08-01

    For the study of small-angle correlations of light particles an experiment at the SATURNE synchrotron with 40 Ar on 197 Au at an incident energy of E/A=200 MeV was performed. A hodoscope consisting of an 8x8 matrix of silicon-cesium iodide detectors was applied under a mean angle of 40 degrees. The evaluation of the coincident particle information was performed via correlation functions, which were determined for systems with Z ≤ = 3. For three different fragments emission temperatures were measured via the determination of population ratios for particle-unstable states. Furthermore by means of p-p correlations the reaction volume was studied. The results are: For 5 Li a mean emission temperature of 6.4 -1.0 1.1 MeV resulted, for 4 He a mean emission temperature of 5.4 -1.2 +1.8 MeV was found. The temperature of 2.3 -0.2 0.6 MeV determined for 8 Be is strongly influenced by feeding. For the states at 21.1 and 22.1 MeV in 4 He a dependence of the temperature on the kinetic sum energy of the coincident particles was found, a temperature growth with increasing sum energy of about 3 MeV over the measured range of the sum energies resulted. Via p-p correlations a source radius of 5.8 ± 0.3 fm was determined. The correction for protons from sequential decays leads to radii, which are about 1 fm smaller. The radii and radius ratios for different ranges of the sum energy of the protons were analyzed. The measured emission temperatures are about 1 MeV higher than the values for the same system at E/A = 60 MeV. The temperatures correspond in the model of the statistical multifragmentation to an excitation energy of about 2 GeV, while they follow in the model of the sequential fragment emission for an excitation energy of about 1 GeV. (orig.) [de

  11. Angular distributions of target fragments from the reactions of 292 MeV - 25.2 GeV 12C with 197Au and 238U

    International Nuclear Information System (INIS)

    Morita, Y.

    1983-01-01

    The angular distributions of the 197 Au target fragments were all forwardly peaked. Extensively forward peaked angular distributions were observed at the non-relativistic projectile energies (292 MeV, 1.0 GeV). No obvious differences were observed in the angular distributions at the different relativistic projectile energies of 3.0 GeV, 12.0 GeV and 25.2 GeV. The characteristic angular distribution pattern from the relativistic projectile energy experiments was also observed in the non-relativistic energy experiments. Maximum degree of forward-peaking in the angular distributions at each projectile energy was observed at the product mass number (A) around 190 from the 292 MeV projectile energy, at A = 180 from 1.0 GeV and at A =175 from 3.0 GeV and 12.0 GeV. In general, two different types of angular distributions were observed in the relativistic projectile energy experiments with the 238 U target. Isotropic angular distributions were observed for the fission product nuclides. The angular distributions of the fission products at the intermediate (292 MeV) energy showed slightly forward peaked angular distributions. Because of the long projectile-target interaction time in the primary nuclear reaction, larger momentum was transferred from the projectile to the target nucleus. Steep forward-peaked angular distributions were also observed with the 238 U target

  12. Pages 193 - 197.pmd

    African Journals Online (AJOL)

    Administrator

    Results: Age >60 years, female sex, presence of diabetic retinopathy (DR), proliferative DR, shorter DM duration, glaucoma, macular ... visual disability was significantly associated with female sex and diabetic retinopathy. .... Only older age,.

  13. In-situ petrophysical properties of hotspot volcanoes. Results from ODP Leg 197, Detroit Seamount and HSDP II borehole, Hawaii

    Science.gov (United States)

    Kock, I.; Pechnig, R.; Buysch, A.; Clauser, C.

    2003-04-01

    During ODP Leg 197 an extensive logging program was run on Site 1203, Detroit Seamount. This seamount is part of the Emperor seamount chain, a continuation of the Hawaiian volcanic chain. Standard ODP/LDEO logging tool strings were used to measure porosity, density, resistivity, p- and s-wave velocities and gamma ray activity. The FMS-tool yielded detailed high resolution resistivity images of the borehole wall. By interpretation and statistical analysis of the logging parameters a petrophysical classification of the drilled rock content could be derived. The pillow lava recovered in the cores exhibits low porosity, low resistivity and high density. This indicates no or very little vesicles in the non-fractured rock unit. Compared to the pillow basalts, subaerial basalts show increasing porosity, gamma ray and potassium content and decreasing density, resistivity and velocity. A basalt with no or little vesicles and a basalt with average or many vesicles can clearly be distinguished. The volcaniclastics show lower resistivity, lower sonic velocities, higher porosities and lower densities than the basalts. Three different rock types can be distinguished within the volcaniclastics: Tuffs, resedimented tephra and breccia. The tuff shows medium porosity and density, low gamma ray and potassium content. The log responses from the resedimented tephra suggest that the tephra is more easily altered than the tuff. The log responses from the breccia lie between the tuff and tephra log responses, but the breccia can clearly be identified in the FMS borehole images. A similar rock content was found in the Hawaiian Scientific Drilling Project borehole. Gamma ray activity, electrical resistivity and sonic velocity were measured down to 2700 mbsl.. Compared to the 72-76 Ma old Detroit seamount basalts, the HSDP subaerial and submarine lava flows show a significant lower gamma ray activity, while sonic velocity and electrical resistivity are comparable. Deviations between the

  14. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  15. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  16. 46 CFR 197.204 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... the diver access to the surrounding environment, and is capable of being used as a refuge during... supervisor. Diver means a person working beneath the surface, exposed to hyperbaric conditions, and using.... Injurious corrosion means an advanced state of corrosion which may impair the structural integrity or safe...

  17. Intermittency in 197Au fragmentation

    International Nuclear Information System (INIS)

    Dabrowska, A.; Holynski, R.; Olszewski, A.; Szarska, M.; Wilczynska, B.; Wolter, W.; Wosiek, B.; Cherry, M.L.; Deines-Jones, P.; Jones, W.V.; Sengupta, K.; Wefel, B.

    1995-07-01

    The concept of factorial moments was applied to an analysis of the dynamical fluctuations in the charge distributions of the fragments emitted from gold nuclei with energies 10.6 and < 1.0 GeV/n interacting with emulsion nuclei. Clear evidence for intermittent fluctuations has been found in an analysis using all the particles released from the gold projectile, with a stronger effect observed below 1 GeV/n than at 10.6 GeV/n. For the full data sets, however, the intermittency effect was found to be very sensitive to the singly charged particles, and neglecting these particles strongly reduces the intermittency signal. When the analysis is restricted to the multiply charged fragments, an intermittency effect is revealed only for multifragmentation events, although one that is enhanced as compared to the analysis of all, singly and multiply charged, particles. The properties of the anomalous fractal dimensions suggest a sequential decay mechanism, rather than the existence of possible critical behaviour in the process of nuclear fragmentation. The likely influence of the charge conservation effects and the finite size of decaying systems on the observed intermittency signals was pointed out. (author). 37 refs, 9 figs, 5 tabs

  18. BDML Metadata: 197 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available -NC-SA 0.180 19e4a6ac-4740-4cd8-a577-4a045dd28636 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_T10F2.1_040909_02.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_T10F2.1_040909_02.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK..._P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/19e4a6ac-4740-4cd8-a577-4a045dd28636/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-99 ...

  19. 21 CFR 1.97 - Bonds.

    Science.gov (United States)

    2010-04-01

    ... the relabeling or other action necessary to bring the article into compliance with the act or rendering it other than a food, drug, device, or cosmetic, in such manner as is prescribed for such bond in...

  20. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  1. Analysis of photofission reactions of 235U, 238U, 232Th, 209Bi, natPb, 197Au, natPt, natW, 181Ta, and 27Al by photons of 69 MeV

    International Nuclear Information System (INIS)

    Paiva, Eduardo de

    1997-04-01

    Fission reactions induced in 235 U, 238 U, 232 Th, 209 Bi nat Pb, 197 Au, nat Pt, nat W, 181 Ta. and 27 Al nuclei by monochromatic photons of 69 MeV produced at the LADON facility of the Frascati National Laboratories (INFN-LNF, Frascati, Italy) have been analyzed on the basis of a simplified two-step model. In the first step of the reaction the incoming photon is considered to be absorbed by a neutron-proton pair ('quasi-deuteron') leading to excitation of the nucleus, followed, in the second step, by a mechanism of particle evaporation-fission competition for the excited residual nucleus. Estimates of nuclear fissility at 69 MeV show to be critically dependent on the parameter r (ratio of the level-density parameter at the fission saddle point to the level-density parameter of the residual nucleus after neutron evaporation), which can be determined in a semiempirical way from induced fission reaction data for various nuclei obtained at 60 - 80 MeV of excitation energy. Fissilities calculated by means of the simplified photofission reactions model are then compared with experimental data available in the literature. (author)

  2. Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

    International Nuclear Information System (INIS)

    Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

    1982-01-01

    The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

  3. Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

    International Nuclear Information System (INIS)

    Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

    2011-01-01

    Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

  4. Network of vascular diseases, death and biochemical characteristics in a set of 4,197 patients with type 1 diabetes (The FinnDiane Study

    Directory of Open Access Journals (Sweden)

    Wadén Johan

    2009-10-01

    Full Text Available Background Cardiovascular disease is the main cause of premature death in patients with type 1 diabetes. Patients with diabetic kidney disease have an increased risk of heart attack or stroke. Accurate knowledge of the complex inter-dependencies between the risk factors is critical for pinpointing the best targets for research and treatment. Therefore, the aim of this study was to describe the association patterns between clinical and biochemical features of diabetic complications. Methods Medical records and serum and urine samples of 4,197 patients with type 1 diabetes were collected from health care centers in Finland. At baseline, the mean diabetes duration was 22 years, 52% were male, 23% had kidney disease (urine albumin excretion over 300 mg/24 h or end-stage renal disease and 8% had a history of macrovascular events. All-cause mortality was evaluated after an average of 6.5 years of follow-up (25,714 patient years. The dataset comprised 28 clinical and 25 biochemical variables that were regarded as the nodes of a network to assess their mutual relationships. Results The networks contained cliques that were densely inter-connected (r > 0.6, including cliques for high-density lipoprotein (HDL markers, for triglycerides and cholesterol, for urinary excretion and for indices of body mass. The links between the cliques showed biologically relevant interactions: an inverse relationship between HDL cholesterol and the triglyceride clique (r P -16, a connection between triglycerides and body mass via C-reactive protein (r > 0.3, P -16 and intermediate-density cholesterol as the connector between lipoprotein metabolism and albuminuria (r > 0.3, P -16. Aging and macrovascular disease were linked to death via working ability and retinopathy. Diabetic kidney disease, serum creatinine and potassium, retinopathy and blood pressure were inter-connected. Blood pressure correlations indicated accelerated vascular aging in individuals with kidney disease

  5. Critical appraisal of a quadrivalent CRM(197) conjugate vaccine against meningococcal serogroups A, C W-135 and Y (Menveo) in the context of treatment and prevention of invasive disease.

    Science.gov (United States)

    Bröker, Michael; Cooper, Brian; Detora, Lisa M; Stoddard, Jeffrey J

    2011-01-01

    Worldwide, invasive meningococcal disease affects about 500,000 people annually. Case fatality in developed countries averages 10%, and higher rates are reported in less prosperous regions. According to the World Health Organization, the most important pathogenic serogroups are A, B, C, W-135, X, and Y. Clinical features of invasive meningococcal disease make diagnosis and management difficult. Antibiotic measures are recommended for prophylaxis after exposure and for treatment of invasive meningococcal disease cases; however, resistant strains may be emerging. Vaccines are generally regarded as the best preventative measure for invasive meningococcal disease. Polysaccharide vaccines against serogroups A, C, W-135, and Y using protein conjugation technology have clear advantages over older plain polysaccharide formulations without a protein component. The first quadrivalent meningococcal conjugate vaccine (MenACWY-D) was licensed in the US in 2005. More recently, MenACWY-CRM (Menveo(®)) was licensed in Europe, the US, the Middle East, and Latin America. MenACWY-CRM uses cross-reactive material 197, a nontoxic mutant of diphtheria toxin, as the carrier protein. MenACWY-CRM offers robust immunogenicity in all age groups, with a tolerability profile similar to that of a plain polysaccharide vaccine. Given its potential for protecting persons from infancy to old age, MenACWY-CRM offers the opportunity to protect broad populations against invasive meningococcal disease. The most optimal strategy for use of the vaccine has to be assessed country by country on the basis of local epidemiology, individual health care systems, and need.

  6. Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

    DEFF Research Database (Denmark)

    Back, T.; Haraldsson, B.; Hultborn, R

    2009-01-01

    of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

  7. Boiling points of the superheavy elements 117 and 118

    International Nuclear Information System (INIS)

    Takahashi, N.

    2001-01-01

    It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

  8. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

  9. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  10. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  11. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  12. Comparison of ALS functionality and plant growth in ALS-inhibitor susceptible and resistant Myosoton aquaticum L.

    Science.gov (United States)

    Liu, Weitang; Bai, Shuang; Jia, Sisi; Guo, Wenlei; Zhang, Lele; Li, Wei; Wang, Jinxin

    2017-10-01

    Herbicide target-site resistance mutations may cause pleiotropic effects on plant ecology and physiology. The effect of several known (Pro197Ser, Pro197Leu Pro197Ala, and Pro197Glu) target-site resistance mutations of the ALS gene on both ALS functionality and plant vegetative growth of weed Myosoton aquaticum L. (water chickweed) have been investigated here. The enzyme kinetics of ALS from four purified water chickweed populations that each homozygous for the specific target-site resistance-endowing mutations were characterized and the effect of these mutations on plant growth was assessed via relative growth rate (RGR) analysis. Plants homozygous for Pro197Ser and Pro197Leu exhibited higher extractable ALS activity than susceptible (S) plants, while all ALS mutations with no negative change in ALS kinetics. The Pro197Leu mutation increased ALS sensitivity to isoleucine and valine, and Pro197Glu mutation slightly increased ALS sensitivity to isoleucine. RGR results indicated that none of these ALS resistance mutations impose negative pleiotropic effects on relative growth rate. However, resistant (R) seeds had a lowed germination rate than S seeds. This study provides baseline information on ALS functionality and plant growth characteristics associated with ALS inhibitor resistance-endowing mutations in water chickweed. Copyright © 2017. Published by Elsevier Inc.

  13. Historical notes about the development of cement normalization In European Union

    Directory of Open Access Journals (Sweden)

    Calleja, J.

    2002-12-01

    Full Text Available The European Standard EN 197-1:2000 for Cement, prepared by CEN/TC 51, is from now (2002-04-01 onwards, compulsory in all the countries of the European Union. It has been considered suitable to expose some details on the historical development of the steps and difficulties during the elaboration of the standard ENV 197-1:92 first, and of the present and final standard EN 197-1:2000 already in force, and now in Spain as Spanish Standard AENOR/UNE-EN 197-1:2000 (1.

    Al hacerse de obligado cumplimiento en todos los países de la VE a partir del 1 de abril de 2002 la Norma Europea EN 197-1:2000 para cementos, elaborada por el CEN/TC 51, se ha considerado oportuno dar una información general, muy resumida, acerca del desarrollo histórico de las etapas, vicisitudes y dificultades por las que ha pasado la culminación de la misma, hasta alcanzar, primero, la Norma Experimental ENV 197-1:92 y, finalmente, la actual y definitiva EN 197-1:2000, ya en vigor como Norma Española UNE-EN 197-1:2000, de AENOR (1.

  14. 46 CFR 197.328 - PVHO-General.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... approved in accordance with § 54.01-18 of this chapter; (ii) Pass the radiographic and other survey tests... that are designed for the environment in which they will operate to minimize the risk of fire...

  15. Reference: 197 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available bidopsis thaliana CAX2 cation transporter. 6 959-71 15821993 2004 Dec Plant molecular biology Cheng Ning-Hui|Hirschi Kendal D|Marshall Joy L|Morris Jay L|Pittman Jon K|Shigaki Toshiro

  16. Publications | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Mahan Research Fellowship Program to Assess the Impact of Public Access to ... How do you estimate the cost of adaptation to climate change on vulnerable communities, where stakeholders are involved in identifying costs and benefits?

  17. 46 CFR 197.560 - Medical surveillance.

    Science.gov (United States)

    2010-10-01

    ... current employment. (ii) A complete physical examination. (iii) A complete blood count, including a... exposure to potential marrow toxins, changes in medicinal drug use, and the appearance of physical signs..., if any. (5) Records of all previous employment-related medical examinations of the affected employee...

  18. 28_197 - 204_Saminu et al.,

    African Journals Online (AJOL)

    pc

    the control of polymer molecular weight distribut and end group ... aqueous solutions(Cunningham, 2008; J. 2005), alcoholic ..... necessary to halt the reactions after the dura stated in Table ..... The application of ionizing radiation in reversible ...

  19. 46 CFR 197.346 - Diver's equipment.

    Science.gov (United States)

    2010-10-01

    ... weight belt capable of quick release; (5) A knife; (6) Swim fins or shoes; (7) A diving wristwatch; and... consisting of a basic dress that encloses the body (except for head and hands) in a tough, waterproof cover, gloves, shoes, weight assembly, and knife; (3) Have a hose group consisting of the breathing gas hose and...

  20. Intermittency in {sup 197}Au fragmentation

    Energy Technology Data Exchange (ETDEWEB)

    Dabrowska, A; Holynski, R; Olszewski, A; Szarska, M; Wilczynska, B; Wolter, W; Wosiek, B [Institute of Nuclear Physics, Cracow (Poland); Cherry, M L; Deines-Jones, P; Jones, W V; Sengupta, K; Wefel, B [Louisiana State Univ., Baton Rouge, LA (United States). Dept. of Physics and Astronomy; Waddington, C J [Minnesota Univ., Minneapolis, MN (United States). School of Physics and Astronomy; Pozharova, E A; Skorodko, T Yu [Inst. of Theoretical and Experimental Physics, Moscow (Russian Federation); KLMM Collaboration

    1995-07-01

    The concept of factorial moments was applied to an analysis of the dynamical fluctuations in the charge distributions of the fragments emitted from gold nuclei with energies 10.6 and < 1.0 GeV/n interacting with emulsion nuclei. Clear evidence for intermittent fluctuations has been found in an analysis using all the particles released from the gold projectile, with a stronger effect observed below 1 GeV/n than at 10.6 GeV/n. For the full data sets, however, the intermittency effect was found to be very sensitive to the singly charged particles, and neglecting these particles strongly reduces the intermittency signal. When the analysis is restricted to the multiply charged fragments, an intermittency effect is revealed only for multifragmentation events, although one that is enhanced as compared to the analysis of all, singly and multiply charged, particles. The properties of the anomalous fractal dimensions suggest a sequential decay mechanism, rather than the existence of possible critical behaviour in the process of nuclear fragmentation. The likely influence of the charge conservation effects and the finite size of decaying systems on the observed intermittency signals was pointed out. (author). 37 refs, 9 figs, 5 tabs.

  1. Publications | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  2. Oregon State University nuclear chemistry progress report, August 1, 1989--August 1, 1990

    International Nuclear Information System (INIS)

    Loveland, W.D.

    1990-08-01

    This report discusses the following topics: the elements beyond uranium; the interaction of 21 MeV/nucleon 129 Xe with 197 Au; the interaction of 93 MeV/nucleon 36 Ar with 197 Au, participant-spectator physics; consistency test of two measures of linear momentum transfer; the interaction of ∼30 MeV/nucleon projectiles with 197 Au; gold target fragmentation by 800 GeV protons; target fragment mass distribution for the reaction of 13.3 GeV/nucleon 28 Si with 197 Au; momentum distributions of spallation products from the interaction of 400 MeV/nucleon 12 C with 197 Au; and pulse height defects for very low energy, very heavy ions

  3. Measurement of distance parameter using semiclassical model in various heavy ion interactions

    Energy Technology Data Exchange (ETDEWEB)

    Nasir, Tabassum [Department of Physics, Gomal University D.I. Khan (Pakistan); Khan, E U [Department of Physics, CIIT, Islamabad (Pakistan); Baluch, J J [Department of Environmental Sciences, CIIT, Abbottabad (Pakistan); Qureshi, I E [Pakistan Atomic Energy Commission, P.O. Box 1114, Islamabad (Pakistan); Sajid, M; Shahzad, M I; Khan, H A [Physics Research Division, PINSTECH, P.O. Nilore, Islamabad (Pakistan)

    2008-08-15

    The technique of solid state nuclear track detection was employed to collect data of elastic scattering as well as inelastic reaction channel. The elastic data of the reactions {sup 238}U+{sup 209}Bi, {sup 238}U+{sup 197}Au, {sup 208}Pb+{sup 197}Au and {sup 197}Au+{sup 197}Au were used to calculate the experimental elastic scattering cross-sections for various angular bins. The ratio of these cross-sections to Rutherford/Mott cross-sections were plotted with respect to distance d({theta}). Distance parameter d{sub 0} in all four reactions was obtained from the discontinuity of the slope following the method suggested in the semiclassical model. Partial reaction cross-sections were also obtained from the inelastic binary as well as multiprong events in the heavy ion interactions of {sup 208}Pb+{sup 197}Au and {sup 197}Au+{sup 197}Au both at 11.67 MeV/u beam energy. The higher values of partial cross-sections of two prong inelastic events as compared with {sigma}{sub 3} and {sigma}{sub 4} have been attributed to the emission of intermediate mass fragments in both the reactions.

  4. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  5. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  6. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Hofer, K.G.

    1980-06-01

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application

  7. Quadrupole interactions of Au in Be and lattice location studies

    International Nuclear Information System (INIS)

    Perscheid, B.; Gayer, H.W.; Krien, K.; Freitag, K.

    1978-01-01

    The Moessbauer nucleus 197 Au is used as probe for quadrupole interaction (QI) studies in Be metal. The 77 keV Moessbauer level is populated by the β - decay of 197 Pt and the EC decay of 197 Hg. This fact enabled samples prepared in different ways to be studied. (Auth.)

  8. Absolute NMR shielding scales and nuclear spin–rotation constants in {sup 175}LuX and {sup 197}AuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br and {sup 127}I)

    Energy Technology Data Exchange (ETDEWEB)

    Demissie, Taye B., E-mail: taye.b.demissie@uit.no; Komorovsky, Stanislav; Repisky, Michal; Ruud, Kenneth [Centre for Theoretical and Computational Chemistry, Department of Chemistry, UiT The Arctic University of Norway, N-9037 Tromsø (Norway); Jaszuński, Michał [Institute of Organic Chemistry, Polish Academy of Sciences, Kasprzaka 44, 01 224 Warszawa (Poland)

    2015-10-28

    We present nuclear spin–rotation constants, absolute nuclear magnetic resonance (NMR) shielding constants, and shielding spans of all the nuclei in {sup 175}LuX and {sup 197}AuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br, {sup 127}I), calculated using coupled-cluster singles-and-doubles with a perturbative triples (CCSD(T)) correction theory, four-component relativistic density functional theory (relativistic DFT), and non-relativistic DFT. The total nuclear spin–rotation constants determined by adding the relativistic corrections obtained from DFT calculations to the CCSD(T) values are in general in agreement with available experimental data, indicating that the computational approach followed in this study allows us to predict reliable results for the unknown spin–rotation constants in these molecules. The total NMR absolute shielding constants are determined for all the nuclei following the same approach as that applied for the nuclear spin–rotation constants. In most of the molecules, relativistic effects significantly change the computed shielding constants, demonstrating that straightforward application of the non-relativistic formula relating the electronic contribution to the nuclear spin–rotation constants and the paramagnetic contribution to the shielding constants does not yield correct results. We also analyze the origin of the unusually large absolute shielding constant and its relativistic correction of gold in AuF compared to the other gold monohalides.

  9. Critical appraisal of a quadrivalent CRM197 conjugate vaccine against meningococcal serogroups A, C W-135 and Y (Menveo®) in the context of treatment and prevention of invasive disease

    Science.gov (United States)

    Bröker, Michael; Cooper, Brian; DeTora, Lisa M; Stoddard, Jeffrey J

    2011-01-01

    Worldwide, invasive meningococcal disease affects about 500,000 people annually. Case fatality in developed countries averages 10%, and higher rates are reported in less prosperous regions. According to the World Health Organization, the most important pathogenic serogroups are A, B, C, W-135, X, and Y. Clinical features of invasive meningococcal disease make diagnosis and management difficult. Antibiotic measures are recommended for prophylaxis after exposure and for treatment of invasive meningococcal disease cases; however, resistant strains may be emerging. Vaccines are generally regarded as the best preventative measure for invasive meningococcal disease. Polysaccharide vaccines against serogroups A, C, W-135, and Y using protein conjugation technology have clear advantages over older plain polysaccharide formulations without a protein component. The first quadrivalent meningococcal conjugate vaccine (MenACWY-D) was licensed in the US in 2005. More recently, MenACWY-CRM (Menveo®) was licensed in Europe, the US, the Middle East, and Latin America. MenACWY-CRM uses cross-reactive material 197, a nontoxic mutant of diphtheria toxin, as the carrier protein. MenACWY-CRM offers robust immunogenicity in all age groups, with a tolerability profile similar to that of a plain polysaccharide vaccine. Given its potential for protecting persons from infancy to old age, MenACWY-CRM offers the opportunity to protect broad populations against invasive meningococcal disease. The most optimal strategy for use of the vaccine has to be assessed country by country on the basis of local epidemiology, individual health care systems, and need. PMID:21904459

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. Rapid determination of gold in Romanian auriferous alluvial sands, concentrates and rocks by 14 MeV NAA

    International Nuclear Information System (INIS)

    Nat, A.; Ene, A.; Lupu, R.

    2004-01-01

    The nuclear and spectral interferences in the 14 MeV neutron activation analysis (NAA) of gold from Romanian auriferous alluvial sands, concentrates and rocks have been studied and the optimum of activation, cooling and measuring times was determined for a maximum peak-to-background ratio for gold. The contribution of the nuclear interfering elements in the samples, Hg and Pt, to the concentration of gold has been calculated and, concluded that the nuclear reactions 197 Au(n,2n) 196 Au, 197 Au(n,2n) 196 mAu and 197 Au(n,n') 197 mAu can be used for gold determination, with minimal errors. Using the nuclear reactions 197 Au(n,n') 197 mAu and 197 Au(n,2n) 196 Au the spectral interferences are minimal and are due to Rb, Ti and V for a short irradiation and to Se for a long one. Two methods of fast gold determination were proposed for auriferous alluvial sands and rocks in the range of 20-2500 ppm, under the optimum conditions established so that the systematic errors of analysis due to the gold accompanying elements can be considerably diminished. For measuring the induced gamma-radioactivity in the samples either a short irradiation (25 seconds) with a NaI(Tl) detector or a long irradiation (3000 seconds) with a Ge(Li) detector were used. (author)

  12. 27 CFR 24.197 - Production by fermentation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Production by fermentation... fermentation. In producing special natural wine by fermentation, flavoring materials may be added before or during fermentation. Special natural wine produced by fermentation may be ameliorated in the same manner...

  13. 49 CFR 173.197 - Regulated medical waste.

    Science.gov (United States)

    2010-10-01

    ... requirements of § 178.801(j) and record retention requirements of § 178.801(l) of this subchapter. Inner... constructed of metal or fiberglass and have a capacity of at least 3.5 cubic meters (123.6 cubic feet) and not... welded or seamless construction and a rigid, weatherproof top to prevent the intrusion of water (e.g...

  14. 38 CFR 21.197 - “Interrupted” status.

    Science.gov (United States)

    2010-07-01

    ... necessary; and (2) Either: (i) A definite date for resumption of the program is established; or (ii) The... reason, the veteran's case will be discontinued and assigned to discontinued status. (e) Case management...

  15. Search Results | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Whole-system change : case study of factors facilitating early implementation of a primary ... Exploring the influence of trust relationships on motivation in the health ... recognition, appreciation and rewards; supervision; teamwork; management ...

  16. Burrowing Owl - Palo Verde Valley [ds197

    Data.gov (United States)

    California Natural Resource Agency — These burrowing owl observations were collected during the spring and early summer of 1976 in the Palo Verde Valley, eastern Riverside County, California. This is an...

  17. Determination of gold in auriferous alluvial sands and rocks by 14 MeV neutron activation analysis

    International Nuclear Information System (INIS)

    Ene, A.; Nat, A.; Lupu, R.; Popescu, I.V.

    2004-01-01

    In this work a complex study of the interferences which appear in gold determination by 14 MeV neutron activation analysis of some Romanian auriferous alluvial sands and rocks has been carried out. The contribution of the nuclear interfering elements - Hg and Pt - to the concentration of gold in the samples is minimum in the case of the nuclear reactions 197 Au (n, 2n) 196 Au, 197 Au (n, 2n) 196m Au and 197 Au (n, n') 197m Au. As regards the spectral interferences, these are minimum in the case of using the reactions 197 Au (n, n') 197m Au and 197 Au (n, 2n) 196 Au and are due to Rb, Ti and V for short irradiation and to Se for long irradiation. We propose two methods of gold determination in auriferous alluvial sands and rocks in the range 20-2500 ppm - the minimum value of 20 ppm being at the level of an economic extraction - in the optimum conditions established by us so that the systematic errors of analysis due to the gold accompanying elements should be considerably diminished: a method using short irradiation (25s) and NaI(Tl) spectrometry for measuring the induced gamma radioactivity in the samples and a method using long irradiation (3000s) and Ge(Li) spectrometry. The data presented in this paper can be adapted by other analysts to the rapid determination of gold in a variety of alluvial sands and rocks. (authors)

  18. Effect of increased CRM₁₉₇ carrier protein dose on meningococcal C bactericidal antibody response.

    Science.gov (United States)

    Lee, Lucia H; Blake, Milan S

    2012-04-01

    New multivalent CRM(197)-based conjugate vaccines are available for childhood immunization. Clinical studies were reviewed to assess meningococcal group C (MenC) antibody responses following MenC-CRM(197) coadministration with CRM(197)-based pneumococcal or Haemophilus influenzae type b conjugate vaccines. Infants receiving a total CRM(197) carrier protein dose of ∼50 μg and concomitant diphtheria-tetanus-acellular pertussis (DTaP)-containing vaccine tended to have lower MenC geometric mean antibody titers and continued to have low titers after the toddler dose. Nevertheless, at least 95% of children in the reported studies achieved a MenC serum bactericidal antibody (SBA) titer of ≥ 1:8 after the last infant or toddler dose. SBA was measured using an assay with a baby rabbit or human complement source. Additional studies are needed to assess long-term antibody persistence and MenC CRM(197) conjugate vaccine immunogenicity using alternative dosing schedules.

  19. Critical appraisal of a quadrivalent CRM197 conjugate vaccine against meningococcal serogroups A, C W-135 and Y (Menveo® in the context of treatment and prevention of invasive disease

    Directory of Open Access Journals (Sweden)

    Bröker M

    2011-07-01

    Full Text Available Michael Bröker, Brian Cooper, Lisa M DeTora, Jeffrey J StoddardGlobal Medical Affairs, Novartis Vaccines and Diagnostics, Marburg, Germany, and Cambridge, MA, USAAbstract: Worldwide, invasive meningococcal disease affects about 500,000 people annually. Case fatality in developed countries averages 10%, and higher rates are reported in less prosperous regions. According to the World Health Organization, the most important pathogenic serogroups are A, B, C, W-135, X, and Y. Clinical features of invasive meningococcal disease make diagnosis and management difficult. Antibiotic measures are recommended for prophylaxis after exposure and for treatment of invasive meningococcal disease cases; however, resistant strains may be emerging. Vaccines are generally regarded as the best preventative measure for invasive meningococcal disease. Polysaccharide vaccines against serogroups A, C, W-135, and Y using protein conjugation technology have clear advantages over older plain polysaccharide formulations without a protein component. The first quadrivalent meningococcal conjugate vaccine (MenACWY-D was licensed in the US in 2005. More recently, MenACWY-CRM (Menveo® was licensed in Europe, the US, the Middle East, and Latin America. MenACWY-CRM uses cross-reactive material 197, a nontoxic mutant of diphtheria toxin, as the carrier protein. MenACWY-CRM offers robust immunogenicity in all age groups, with a tolerability profile similar to that of a plain polysaccharide vaccine. Given its potential for protecting persons from infancy to old age, MenACWY-CRM offers the opportunity to protect broad populations against invasive meningococcal disease. The most optimal strategy for use of the vaccine has to be assessed country by country on the basis of local epidemiology, individual health care systems, and need.Keywords: invasive meningococcal disease, quadrivalent meningococcal conjugate vaccine, Neisseria meningitidis

  20. Determination of gold in Romanian auriferous alluvial sands and rocks by 14 MeV neutron activation analysis

    International Nuclear Information System (INIS)

    Lupu, Roxana; Nat, Alexandrina; Ene, Antoaneta

    2004-01-01

    In this work a complex study of the nuclear and spectral interferences which appear in gold determination by 14 MeV neutron activation analysis of Romanian auriferous alluvial sands and rocks has been accomplished. The contribution of the nuclear interfering elements - Hg and Pt - to the concentration of gold in the samples is minimum in the case of the nuclear reactions 197 Au(n, 2n) 196 Au, 197 Au (n,2n) 196m Au and 197 Au(n, n ' ) 197m Au. As regards the spectral interferences, these are minimum in the case of using the reactions 197 Au(n, n ' ) 197m Au and 197 Au (n, 2n) 196 Au and are due to Rb, Ti and V for the short irradiation and to Se for the long irradiation. We propose two methods of gold determination in auriferous alluvial sands and rocks in the range 20-2500 ppm - the minimum value of 20 ppm being at the level of an economic extraction - in the optima conditions established by us so that the systematic errors of analysis due to the gold accompanying elements should be considerably diminished: a method using short irradiation (25 s) and NaI(Tl) spectrometry for the measuring of the induced gamma radioactivity in the samples and a method using long irradiation (3000 s) and Ge(Li) spectrometry. The data presented in this paper can be adapted by other analysts to the rapid determination of gold in a variety of alluvial sands and rocks

  1. Expression of self-complementary hairpin RNA under the control of the rolC promoter confers systemic disease resistance to plum pox virus without preventing local infection.

    Science.gov (United States)

    Pandolfini, Tiziana; Molesini, Barbara; Avesani, Linda; Spena, Angelo; Polverari, Annalisa

    2003-06-25

    Homology-dependent selective degradation of RNA, or post-transcriptional gene silencing (PTGS), is involved in several biological phenomena, including adaptative defense mechanisms against plant viruses. Small interfering RNAs mediate the selective degradation of target RNA by guiding a multicomponent RNAse. Expression of self-complementary hairpin RNAs within two complementary regions separated by an intron elicits PTGS with high efficiency. Plum pox virus (PPV) is the etiological agent of sharka disease in Drupaceae, although it can also be transmitted to herbaceous species (e.g. Nicotiana benthamiana). Once inside the plant, PPV is transmitted via plasmodesmata from cell to cell, and at longer distances, via phloem. The rolC promoter drives expression in phloem cells. RolC expression is absent in both epidermal and mesophyll cells. The aim of the present study was to confer systemic disease resistance without preventing local viral infection. In the ihprolC-PP197 gene (intron hair pin rolC PPV 197), a 197 bp sequence homologous to the PPV RNA genome (from base 134 to 330) was placed as two inverted repeats separated by the DNA sequence of the rolA intron. This hairpin construct is under the control of the rolC promoter.N. benthamiana plants transgenic for the ihprolC-PP197 gene contain siRNAs homologous to the 197 bp sequence. The transgenic progeny of ihprolC-PP197 plants are resistant to PPV systemic infection. Local infection is unaffected. Most (80%) transgenic plants are virus free and symptomless. Some plants (20%) contain virus in uninoculated apical leaves; however they show only mild symptoms of leaf mottling. PPV systemic resistance cosegregates with the ihprolC-PP197 transgene and was observed in progeny plants of all independent transgenic lines analyzed. SiRNAs of 23-25 nt homologous to the PPV sequence used in the ihprolC-PP197 construct were detected in transgenic plants before and after inoculation. Transitivity of siRNAs was observed in

  2. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand

    2013-01-01

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  3. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  4. Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer

    International Nuclear Information System (INIS)

    Wilbur, D. Scott

    2011-01-01

    This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.

  5. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  6. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  7. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  8. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 2. Science Academies' Refresher Course on Modern Biiotechnology: Concepts and Practice. Information and Announcements Volume 18 Issue 2 February 2013 pp 197-197 ...

  10. Expression of self-complementary hairpin RNA under the control of the rolC promoter confers systemic disease resistance to plum pox virus without preventing local infection

    Directory of Open Access Journals (Sweden)

    Spena Angelo

    2003-06-01

    Full Text Available Abstract Background Homology-dependent selective degradation of RNA, or post-transcriptional gene silencing (PTGS, is involved in several biological phenomena, including adaptative defense mechanisms against plant viruses. Small interfering RNAs mediate the selective degradation of target RNA by guiding a multicomponent RNAse. Expression of self-complementary hairpin RNAs within two complementary regions separated by an intron elicits PTGS with high efficiency. Plum pox virus (PPV is the etiological agent of sharka disease in Drupaceae, although it can also be transmitted to herbaceous species (e.g. Nicotiana benthamiana. Once inside the plant, PPV is transmitted via plasmodesmata from cell to cell, and at longer distances, via phloem. The rolC promoter drives expression in phloem cells. RolC expression is absent in both epidermal and mesophyll cells. The aim of the present study was to confer systemic disease resistance without preventing local viral infection. Results In the ihprolC-PP197 gene (intron hair pin rolC PPV 197, a 197 bp sequence homologous to the PPV RNA genome (from base 134 to 330 was placed as two inverted repeats separated by the DNA sequence of the rolA intron. This hairpin construct is under the control of the rolC promoter.N. benthamiana plants transgenic for the ihprolC-PP197 gene contain siRNAs homologous to the 197 bp sequence. The transgenic progeny of ihprolC-PP197 plants are resistant to PPV systemic infection. Local infection is unaffected. Most (80% transgenic plants are virus free and symptomless. Some plants (20% contain virus in uninoculated apical leaves; however they show only mild symptoms of leaf mottling. PPV systemic resistance cosegregates with the ihprolC-PP197 transgene and was observed in progeny plants of all independent transgenic lines analyzed. SiRNAs of 23–25 nt homologous to the PPV sequence used in the ihprolC-PP197 construct were detected in transgenic plants before and after inoculation

  11. Identification of diphtheria toxin R domain mutants with enhanced inhibitory activity against HB-EGF.

    Science.gov (United States)

    Suzuki, Keisuke; Mizushima, Hiroto; Abe, Hiroyuki; Iwamoto, Ryo; Nakamura, Haruki; Mekada, Eisuke

    2015-05-01

    Heparin-binding epidermal growth factor-like growth factor (HB-EGF), a ligand of EGF receptor, is involved in the growth and malignant progression of cancers. Cross-reacting material 197, CRM197, a non-toxic mutant of diphtheria toxin (DT), specifically binds to the EGF-like domain of HB-EGF and inhibits its mitogenic activity, thus CRM197 is currently under evaluation in clinical trials for cancer therapy. To develop more potent DT mutants than CRM197, we screened various mutant proteins of R domain of DT, the binding site for HB-EGF. A variety of R-domain mutant proteins fused with maltose-binding protein were produced and their inhibitory activity was evaluated in vitro. We found four R domain mutants that showed much higher inhibitory activity against HB-EGF than wild-type (WT) R domain. These R domain mutants suppressed HB-EGF-dependent cell proliferation more effectively than WT R domain. Surface plasmon resonance revealed their higher affinity to HB-EGF than WT R domain. CRM197(R460H) carrying the newly identified mutation showed increased cell proliferation inhibitory activity and affinity to HB-EGF. These results suggest that CRM197(R460H) or other recombinant proteins carrying newly identified mutation(s) in the R domain are potential therapeutics targeting HB-EGF. © The Authors 2014. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

  12. Ostracods of Andaman Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Stephen, R.; Meenakshikunjamma, P.P.

    stream_size 7 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_197.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_197.pdf.txt Content-Encoding ISO-8859...

  13. Střednědobá makroekonomická predikce: makroekonomické modely v analytickém systému ČNB

    Czech Academy of Sciences Publication Activity Database

    Beneš, J.; Vávra, David; Vlček, J.

    2002-01-01

    Roč. 52, č. 4 (2002), s. 197-231 ISSN 0015-1920 Keywords : monetary policy * central bank * medium-term macroeconomic modeling Subject RIV: AH - Economics Impact factor: 0.222, year: 2002 http://journal.fsv.cuni.cz/ storage /287_197_231.pdf

  14. 26 CFR 1.197-0 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ... compete and other similar arrangements. (10) Franchises, trademarks, and trade names. (11) Contracts for... franchises. (11) Mortgage servicing rights. (12) Certain transaction costs. (13) Rights of fixed duration or...-churning rules. (e) Purchase of a trade or business. (1) Goodwill or going concern value. (2) Franchise...

  15. ZNF 197L is dispensable in mouse development

    African Journals Online (AJOL)

    Jane

    2011-07-27

    protein interactions (Kim et al., 1996; Friedman et .... A fragment of pU17 vector was used as a probe to detect the trapping ... RNA was isolated from adult mouse brain, heart, lung, .... Zinc finger peptides for the regulation of gene.

  16. MicroRNA-197 induces epithelial–mesenchymal transition and ...

    Indian Academy of Sciences (India)

    NAN ZHANG

    2018-02-20

    Feb 20, 2018 ... Abstract. The major cause of cancer-related deaths in patients with lung ... could be a useful approach for the treatment of patients with late stage metastatic LAD. ... For example, the miR-200 family ..... therapy of cancer.

  17. 1935 15' Quad #197 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  18. 46 CFR 197.540 - Determination of personal exposure.

    Science.gov (United States)

    2010-10-01

    ... repeated for the operation when there has been a change in the procedure, equipment, or work practices of... when personal exposure has returned to the level that existed before the emergency. There must be... monitoring upon reasonable belief that the PEL's are being exceeded. (e) Notification of exposure monitoring...

  19. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Science Academies' Refresher Course in Statistical Physics · More Details Fulltext PDF. pp 197-197 Information and Announcements. Science Academies' Refresher Course on Modern Biiotechnology: Concepts and Practice · More Details Fulltext PDF. pp 198-198 Information and Announcements. Forty Ninth Refresher ...

  20. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    LAD) is due to distant metastasis. Many reports have indicated that miRNA plays a key role in tumour metastasis. The expression of miR-197 is correlated with LADprogression, however, the mechanism of miR-197 is still unknown in the ...

  1. The B-cell response to a primary and booster course of MenACWY-CRM₁₉₇ vaccine administered at 2, 4 and 12 months of age.

    Science.gov (United States)

    Blanchard-Rohner, Geraldine; Snape, Matthew D; Kelly, Dominic F; O'Connor, Daniel; John, Tessa; Clutterbuck, Elizabeth A; Ohene-Kena, Brigitte; Klinger, Chaam L; Odrljin, Tatjana; Pollard, Andrew J

    2013-05-07

    A quadrivalent meningococcal vaccine conjugated to CRM197 (MenACWY-CRM197) is immunogenic in young infants. We assessed the memory B-cell and antibody responses after a primary and booster course of MenACWY-CRM197 in children. At 5 months of age, following primary immunisation, serogroup-specific memory B-cells were detectable in fewer than 25% of children, although protective antibody titres (hSBA ≥ 4) were detectable in 69% of children against serogroup A and more than 95% against the other serogroups. At 12 months, before booster immunisation the percentages with hSBA ≥ 4 were 5% for serogroup A, and between 44 and 70% for the other serogroups. One month after booster immunisation with MenACWY-CRM197 over 50% of children had detectable memory B-cells, and 91% had hSBA ≥ 4 against serogroup A and more than 99% against the other serogroups. These data show that few antigen-specific anticapsular memory B-cells can be detected after two-doses priming with MenACWY-CRM197. For MenC and CRM197, the antigens with the highest number of B-cells at 5 months, there was a definite (p ≤0 .02) but weak correlation with antibody persistence at 12 months. Although previous studies suggest that measuring memory B-cell responses after priming immunisations in infancy can be used to predict antibody persistence and memory responses, this may not be suitable for all antigens in young children. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. 78 FR 22911 - Delta Air Lines, Inc., Reservation Sales and Customer Care Call Center, Seatac, WA; Delta Air...

    Science.gov (United States)

    2013-04-17

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-82,197; TA-W-82,197A] Delta Air... requested administrative reconsideration of the negative determination regarding workers' eligibility to... threatened with total or partial separation from employment on the date of certification through two years...

  3. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  4. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  5. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  6. Tetanus-diphtheria-pertussis vaccine may suppress the immune response to subsequent immunization with pneumococcal CRM197-conjugate vaccine (coadministered with quadrivalent meningococcal TT-conjugate vaccine): a randomized, controlled trial⋆.

    Science.gov (United States)

    Tashani, Mohamed; Heron, Leon; Wong, Melanie; Rashid, Harunor; Booy, Robert

    2017-07-01

    : Due to their antigenic similarities, there is a potential for immunological interaction between tetanus/diphtheria-containing vaccines and carrier proteins presented on conjugate vaccines. The interaction could, unpredictably, result in either enhancement or suppression of the immune response to conjugate vaccines if they are injected soon after or concurrently with diphtheria or tetanus toxoid. We examined this interaction among adult Australian travellers before attending the Hajj pilgrimage of 2015. We randomly assigned each participant to one of three vaccination schedules. Group A received tetanus, diphtheria and acellular pertussis vaccine (Tdap) 3-4 weeks before receiving CRM197-conjugated 13-valent pneumococcal vaccine (PCV13) coadministered with TT-conjugated quadrivalent meningococcal vaccine (MCV4). Group B received all three vaccines concurrently. Group C received PCV13 and MCV4 3-4 weeks before Tdap. Blood samples collected at baseline, at each vaccination visit and 3-4 weeks after vaccination were tested for the pneumococcal opsonophagocytic assay (OPA). A total of 166 participants aged 18-64 (median 42) years were recruited, 159 completed the study. Compared with the other groups, Group A had significantly ( P  vaccination in seven serotypes of PCV13 (1, 3, 4, 5, 14, 18C and 9V). Additionally, Group A had lower frequency of serorises (≥ 4-fold rise in OPA titres) in serotype5 (79%, p = 0.01) and 18C (73.5%, p = 0.06); whereas Groups B and C had significantly lower frequencies of serorises in Serotype 4 (82%) and 6A (73.5%), respectively. No statistically significant difference was detected across the three groups in frequencies achieving OPA titre ≥ 1:8 post-vaccination. Tdap vaccination 3-4 weeks before administration of PCV13 and MCV4 significantly reduced the GMTs to seven of the 13 pneumococcal serotypes in adults. If multiple vaccination is required before travel, deferring tetanus/diphtheria until after administering the

  7. Search Results | Page 20 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 191 - 197 of 197 ... Learning Initiatives for Network Economies in Asia (LIRNEasia) : Building Capacity in ICT Policy. It is now generally accepted that affordable, effective telecommunication services play an integral role in development. Although there has been strong growth in connectivity in Asia, those who have ...

  8. 211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability

    International Nuclear Information System (INIS)

    Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.

    1993-01-01

    Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)

  9. Labeled estrogens as mammary tumor probes

    International Nuclear Information System (INIS)

    Feenstra, A.

    1981-01-01

    In this thesis estrogens labeled with a gamma or positron emitting nuclide, called estrogen-receptor binding radiopharmaceuticals are investigated as mammary tumour probes. The requirements for estrogen-receptor binding radiopharmaceuticals are formulated and the literature on estrogens labeled for this purpose is reviewed. The potential of mercury-197/197m and of carbon-11 as label for estrogen-receptor binding radiopharmaceuticals is investigated. The synthesis of 197 Hg-labeled 4-mercury-estradiol and 2-mercury-estradiol and their properties in vitro and in vivo are described. It appears that though basically carbon-11 labeled compounds are very promising as mammary tumour probes, their achievable specific activity has to be increased. (Auth.)

  10. Group IB Organometallic Chemistry XXXIII: ArAuPPh3, ArAu(CNR), (ArAu)n and Ar4Cu2Au2 compounds in which the aryl group contains 2-MeO, 2,6-(MeO)2, 2-Me2N, 2-Me2NCH2 and (S)- or (R)-2-Me2NCHMe substituents as potential ligands

    NARCIS (Netherlands)

    Koten, G. van; Schaap, C.A.; Jastrzebski, J.T.B.H.; Noltes, J.G.

    1980-01-01

    The synthesis and structural characterization by }1{H NMR and }1{}9{}7{Au Mossbauer spectroscopy as well as by chiral labelling of the built-in ligands of three different types of arylgold(I) compounds is described.}1{}9{}7{Au Mossbauer data revealed that the benzyl- and arylgold(I)

  11. Molecular mechanism of ion transfer across the polarized liquid/liquid interface

    Czech Academy of Sciences Publication Activity Database

    Samec, Zdeněk; Trojánek, Antonín; Mareček, Vladimír

    2015-01-01

    Roč. 61, č. 3 (2015), s. 197-197 ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR GA13-04630S Institutional support: RVO:61388955 Keywords : electrochemistry * electrochemical impedance spectroscopy Subject RIV: CG - Electrochemistry

  12. Improving the neutral phytase activity from Bacillus amyloliquefaciens DSM 1061 by site-directed mutagenesis.

    Science.gov (United States)

    Xu, Wei; Shao, Rong; Wang, Zupeng; Yan, Xiuhua

    2015-03-01

    Neutral phytase is used as a feed additive for degradation of anti-nutritional phytate in aquatic feed industry. Site-directed mutagenesis of Bacillus amyloliquefaciens DSM 1061 phytase was performed with an aim to increase its activity. Mutation residues were chosen based on multiple sequence alignments and structure analysis of neutral phytsaes from different microorganisms. The mutation sites on surface (D148E, S197E and N156E) and around the active site (D52E) of phytase were selected. Analysis of the phytase variants showed that the specific activities of mutants D148E and S197E remarkably increased by about 35 and 13% over a temperature range of 40-75 °C at pH 7.0, respectively. The k cat of mutants D148E and S197E were 1.50 and 1.25 times than that of the wild-type phytase, respectively. Both D148E and S197E showed much higher thermostability than that of the wild-type phytase. However, mutants N156E and D52E led to significant loss of specific activity of the enzyme. Structural analysis revealed that these mutations may affect conformation of the active site of phytase. The present mutant phytases D148E and S197E with increased activities and thermostabilities have application potential as additives in aquaculture feed.

  13. Rapidity and centrality dependence of proton and antiproton production from Au-197+Au-197 collisions at root S-NN=130 GeV

    Czech Academy of Sciences Publication Activity Database

    Adams, J.; Adler, C.; Aggarwal, M. M.; Chaloupka, Petr; Filip, Pavel; Lednický, Richard; Šumbera, Michal; Zborovský, Imrich

    2004-01-01

    Roč. 70, č. 4 (2004), 041901 ISSN 0556-2813 R&D Projects: GA MŠk ME 475 Institutional research plan: CEZ:AV0Z1048901 Keywords : nucleus-nucleus collisions * heavy-ion collisions * Au+Au collisions Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.125, year: 2004

  14. Fragment production and collective Behaviour in central 197Au + 197Au reactions at E/A = 100 MeV to 800 MeV

    International Nuclear Information System (INIS)

    Wienold, T.

    1993-07-01

    In this thesis results of the reaction Au on Au at incident energies of 100 to 800 MeV/u are preentes, which were obtained with the phase 1 of the 4π detector system at the GSI in Darmstadt. The studies are concentrated to collective behaviour and the production of medium-heavy fragments (IMF) in hot and dense nuclear matter, as it is produced in semicentral and central collisions. The data set consists of the measurement of triple respectively quadruple differential cross sections of charged fragments in a large range of the phase space over nearly one order of magnitude in the incident energy. In this thesis for the first time the existence of a central source of medium-heavy fragments in very central collisions is shown. For this new criteria for the event selection are applied, as the combination of large particle multiplicity and the absence of a directed sideward flow, or the degree of the stopping in the energy flow. The analysis of the central source yielded a large mean IMF multiplicity of 13±2 (extrapolated to 4π, 100 MeV/u incident energy). Furthermore the quantitative change of the directed sideward flow with the ''centrality'' of the collisions was evaluated. With the measurments performed here now a new data set exists, which prepares many observables for the test of the numerous theoretical transport theories

  15. African Heath Sciences Vol 7 No 4.p65

    African Journals Online (AJOL)

    FOMCS2

    no evidence of significant associative interactions between Hib-CRM197 and MenC-CRM197 in saline-based buffers, pH 7.2. African ... aggregation of vaccine saccharide or protein components. 17, 18 ... chromatography and for analysis of the generated data. .... protein would be expected to elute after the main MenC-.

  16. Study of some properties of bound levels and virtual levels excited with resonance neutrons; Etude de quelques proprietes de niveaux lies et de niveaux virtuels excites a l'aide de neutrons de resonance

    Energy Technology Data Exchange (ETDEWEB)

    Alves, R N [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires

    1968-05-01

    Many neutron resonance parameters of some nuclei with a spin value I 3/2 ({sup 35}Cl, {sup 37}Cl, {sup 63}Cu, {sup 65}Cu, {sup 197}Au) are determined to find the strength function S{sub 0} with accuracy. For those nuclei, the S{sub 0} value seems not to depend on the spin value J=1 or 2 but could be depend on neutron energy for {sup 197}Au. Total radiative width variation against mass number A and spacing distributions between resonances (for {sup 197}Au) are studied and discussed. Analysis methods of neutron capture experiments are described in detail and level schemes of Cl, Mn, Fe, Co, Cu, Tm, Hg are presented sometimes with the spin value. Intensities of E{sub 1} and M{sub 1} transitions with direct capture and interference effects are discussed in view of experimental results. (author) [French] On determine les parametres des resonances de quelques noyaux de spin I 3/2 ({sup 35}Cl, {sup 37}Cl, {sup 63}Cu, {sup 65}Cu, {sup 197}Au) en nombre suffisant pour obtenir la fonction densite S{sub 0} avec precision. Cette valeur S{sub 0} apparat pour ces noyaux etre independante de la valeur du spin J=1 ou 2 mais para?t, dans le cas de {sup 197}Au, dependre de l'energie. On etudie et on essaie d'interpreter la variation de la largeur radiative totale {gamma}{sub {gamma}} en fonction du nombre de masse A et les distributions des espacements entre resonances pour {sup 197}Au. On expose en detail les methodes d'analyse des experiences de capture et on presente les schemas des niveaux des noyaux: Cl, Mn, Fe, Co, Cu, Tm, Hg. Les intensites des transitions de type E{sub 1} et M{sub 1} ainsi que les effets d'interference et de capture directe sont discutes. (auteur)

  17. Blocking of proteolytic processing and deletion of glycosaminoglycan side chain of mouse DMP1 by substituting critical amino acid residues.

    Science.gov (United States)

    Peng, Tao; Huang, Bingzhen; Sun, Yao; Lu, Yongbo; Bonewald, Lynda; Chen, Shuo; Butler, William T; Feng, Jerry Q; D'Souza, Rena N; Qin, Chunlin

    2009-01-01

    Dentin matrix protein 1 (DMP1) is present in the extracellular matrix (ECM) of dentin and bone as processed NH(2)- and COOH-terminal fragments, resulting from proteolytic cleavage at the NH(2) termini of 4 aspartic acid residues during rat DMP1 processing. One cleavage site residue, Asp(181) (corresponding to Asp(197) of mouse DMP1), and its flanking region are highly conserved across species. We speculate that cleavage at the NH(2) terminus of Asp(197) of mouse DMP1 represents an initial, first-step scission in the whole cascade of proteolytic processing. To test if Asp(197) is critical for initiating the proteolytic processing of mouse DMP1, we substituted Asp(197) with Ala(197) by mutating the corresponding nucleotides of mouse cDNA that encode this amino acid residue. This mutant DMP1 cDNA was cloned into a pcDNA3.1 vector. Data from transfection experiments indicated that this single substitution blocked the proteolytic processing of mouse DMP1 in HEK-293 cells, indicating that cleavage at the NH(2) terminus of Asp(197) is essential for exposing other cleavage sites for the conversion of DMP1 to its fragments. The NH(2)-terminal fragment of DMP1 occurs as a proteoglycan form (DMP1-PG) that contains a glycosaminoglycan (GAG) chain. Previously, we showed that a GAG chain is linked to Ser(74) in rat DMP1 (Ser(89) in mouse DMP1). To confirm that mouse DMP1-PG possesses a single GAG chain attached to Ser(89), we substituted Ser(89) by Gly(89). Data from transfection analysis indicated that this substitution completely prevented formation of the GAG-containing form, confirming that DMP1-PG contains a single GAG chain attached to Ser(89) in mouse DMP1. Copyright 2008 S. Karger AG, Basel.

  18. Application of Newly Developed Rotational Sensor for Monitoring of Mining Induced Seismic Events in The Karvina region

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk; Knejzlík, Jaromír; Lednická, Markéta

    2013-01-01

    Roč. 10, č. 2 (2013), s. 197-205 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : rotational ground motion * rotational sensor * seismic monitoring Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_09_Kalab_197-205.pdf

  19. A hybrid model for the investigation of heavy ion collisions at intermediate energies

    International Nuclear Information System (INIS)

    Heide, B.M.

    1995-09-01

    The following topics were dealt with: The coupling of the Botzmann-Uehling-Uhlenbeck (BUU) model with Kopenhagen multifragmentation model realising a new hybrid model, application on 197 Au+ 197 Au reactions between 100 and 250 A.MeV, calculation of the chracteristics of the fragmentation system including mass number, excitation energy, angular momenta, two-particle correlation function

  20. NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0782 ref|YP_797515.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801264.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ78582.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...in diacylglyceryltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_797515.1 3.3 35% ...

  1. Semisynthetic prion protein (PrP) variants carrying glycan mimics at position 181 and 197 do not form fibrils† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c7sc02719b Click here for additional data file.

    Science.gov (United States)

    Araman, Can; Thompson, Robert E.; Wang, Siyao; Hackl, Stefanie; Payne, Richard J.

    2017-01-01

    The prion protein (PrP) is an N-glycosylated protein attached to the outer leaflet of eukaryotic cell membranes via a glycosylphosphatidylinositol (GPI) anchor. Different prion strains have distinct glycosylation patterns and the extent of glycosylation of potentially pathogenic misfolded prion protein (PrPSc) has a major impact on several prion-related diseases (transmissible spongiform encephalopathies, TSEs). Based on these findings it is hypothesized that posttranslational modifications (PTMs) of PrP influence conversion of cellular prion protein (PrPC) into PrPSc and, as such, modified PrP variants are critical tools needed to investigate the impact of PTMs on the pathogenesis of TSEs. Here we report a semisynthetic approach to generate PrP variants modified with monodisperse polyethyleneglycol (PEG) units as mimics of N-glycans. Incorporating PEG at glycosylation sites 181 and 197 in PrP induced only small changes to the secondary structure when compared to unmodified, wildtype PrP. More importantly, in vitro aggregation was abrogated for all PEGylated PrP variants under conditions at which wildtype PrP aggregated. Furthermore, the addition of PEGylated PrP as low as 10 mol% to wildtype PrP completely blocked aggregation. A similar effect was observed for synthetic PEGylated PrP segments comprising amino acids 179–231 alone if these were added to wildtype PrP in aggregation assays. This behavior raises the question if large N-glycans interfere with aggregation in vivo and if PEGylated PrP peptides could serve as potential therapeutics. PMID:28989689

  2. 46 CFR 197.462 - Pressure vessels and pressure piping.

    Science.gov (United States)

    2010-10-01

    ... that each pressure vessel, including each volume tank, cylinder and PVHO, and each pressure piping... tests conducted in accordance with this section shall be either hydrostatic tests or pneumatic tests. (1... times the maximum allowable working pressure. (2) When a pneumatic test is conducted on a pressure...

  3. All projects related to | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-01-26

    The flood-prone Poyang Lake is the largest freshwater lake in China, accounting for 9% of the drainage area of the Yangtze River Basin. End Date: January 26, 2017. Topic: WATER MANAGEMENT, AGRICULTURE, POLICY MAKING, Climate change, ADAPTATION. Region: China, Canada. Program: Climate Change.

  4. Ethiopian Journal of Environmental Studies & Management 7(2): 197

    African Journals Online (AJOL)

    Osondu

    2014-03-08

    Mar 8, 2014 ... influences the degree of rural poverty by limiting the scope of agricultural production, sale and keeping member of the rural communities relatively isolated. Rural physical infrastructures among which are transportation facilities (federal, state and L.G.A roads, railways, bridges, ferry services, canal ports and.

  5. Ethiopian Journal of Environmental Studies & Management 7(2): 197

    African Journals Online (AJOL)

    Osondu

    2014-03-08

    Mar 8, 2014 ... economic growth and development (PCU-. NFDO, 2005; Ahmed ... economic benefits to the rural poor (Fan et al.,. 2000 .... positive relationship between farm size and output which .... growth and poverty in India. Am. J. Agric.

  6. 14 CFR Sec. 19-7 - Passenger origin-destination survey.

    Science.gov (United States)

    2010-01-01

    ... Information, K-25, U.S. Department of Transportation, 1200 New Jersey Avenue, SE., Washington, DC 20590. (b...., Washington, DC 20590, Telephone (202) 366-9059. EC30SE91.007 B. Narrative Description A single O&D Survey is... (either standard IATA and ARC ticket stock or nonstandard ticket stock), and is to select for reporting...

  7. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  8. Critical Secondary Military Occupational Specialty (MOS) Study

    Science.gov (United States)

    2002-12-20

    total population. E 3 500 400 300 200 100 0 INON 1993 382 1994 304 ISEP I 25 I 23 1995 229 19 1996 446 53 1997 441 57 1998 1999...1994 1995 1996 199711998 1999 2000 2001 2002 2003 LNONJ287J210 ; 147 ISEP 15 ! 7 i 18 156 7 197 197 201 L L_ 192 178 ’ 207 214 14 18 J29 20

  9. Study of some properties of bound levels and virtual levels excited with resonance neutrons; Etude de quelques proprietes de niveaux lies et de niveaux virtuels excites a l'aide de neutrons de resonance

    Energy Technology Data Exchange (ETDEWEB)

    Alves, R.N. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires

    1968-05-01

    Many neutron resonance parameters of some nuclei with a spin value I 3/2 ({sup 35}Cl, {sup 37}Cl, {sup 63}Cu, {sup 65}Cu, {sup 197}Au) are determined to find the strength function S{sub 0} with accuracy. For those nuclei, the S{sub 0} value seems not to depend on the spin value J=1 or 2 but could be depend on neutron energy for {sup 197}Au. Total radiative width variation against mass number A and spacing distributions between resonances (for {sup 197}Au) are studied and discussed. Analysis methods of neutron capture experiments are described in detail and level schemes of Cl, Mn, Fe, Co, Cu, Tm, Hg are presented sometimes with the spin value. Intensities of E{sub 1} and M{sub 1} transitions with direct capture and interference effects are discussed in view of experimental results. (author) [French] On determine les parametres des resonances de quelques noyaux de spin I 3/2 ({sup 35}Cl, {sup 37}Cl, {sup 63}Cu, {sup 65}Cu, {sup 197}Au) en nombre suffisant pour obtenir la fonction densite S{sub 0} avec precision. Cette valeur S{sub 0} apparat pour ces noyaux etre independante de la valeur du spin J=1 ou 2 mais para?t, dans le cas de {sup 197}Au, dependre de l'energie. On etudie et on essaie d'interpreter la variation de la largeur radiative totale {gamma}{sub {gamma}} en fonction du nombre de masse A et les distributions des espacements entre resonances pour {sup 197}Au. On expose en detail les methodes d'analyse des experiences de capture et on presente les schemas des niveaux des noyaux: Cl, Mn, Fe, Co, Cu, Tm, Hg. Les intensites des transitions de type E{sub 1} et M{sub 1} ainsi que les effets d'interference et de capture directe sont discutes. (auteur)

  10. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  11. The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system

    International Nuclear Information System (INIS)

    Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.

    1982-01-01

    A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies

  12. Investigation of nuclear multifragmentation using molecular dynamics and restructured aggregation

    International Nuclear Information System (INIS)

    Paula, L. de; Nemeth, J.; Ben-Hao, Sa.; Leray, S.; Ngo, C.; Souza, S.R.; Yu-Ming, Zheng; Paula, L. de; Nemeth, J.; Ben-Hao, Sa.; Yu-Ming, Zheng; Ngo, H.

    1991-01-01

    We study the stability of excited 197 Au nuclei with respect to multifragmentation. For that we use a dynamical simulation based on molecular dynamics and restructured aggregation. A particular attention is paid to check the stability of the ground state nuclei generated by the simulation. Four kinds of excitations are considered: heat, compression, rotation and a geometrical instability created when a projectile drills a hole in a 197 Au nucleus

  13. The joint essential numerical range, compact perturbations, and the Olsen problem

    Czech Academy of Sciences Publication Activity Database

    Müller, Vladimír

    2010-01-01

    Roč. 197, č. 3 (2010), s. 275-290 ISSN 0039-3223 R&D Projects: GA ČR GA201/09/0473; GA AV ČR IAA100190903 Institutional research plan: CEZ:AV0Z10190503 Keywords : joint essential numerical range * joint numerical range * compact perturbation * Olsen's problem Subject RIV: BA - General Mathematics Impact factor: 0.567, year: 2010 http://journals.impan.pl/cgi-bin/doi?sm197-3-5

  14. Enabling local production of biopharmaceuticals in South Africa

    CSIR Research Space (South Africa)

    Tsekoa, Tsepo L

    2017-10-01

    Full Text Available - based pharmaceuticals. 9 Case study 1: Rabivir, new-generation rabies post-exposure prophylaxis 10 Case study 2: Microbial production of biosimilar CRM197 carrier protein • Problem/Need: Accessible and cost-competitive paediatric vaccines... • Prohibitively expensive pricing of protein reagent (CRM197) used in manufacture of conjugate vaccines for children (e.g. multivalent pneumococcal vaccine) • Solution: Fermentation-based production in recombinant E. coli • Stage: Proof of concept complete...

  15. NCBI nr-aa BLAST: CBRC-HSAP-07-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0021 ref|YP_798483.1| hypothetical protein LBL_2137 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801392.1| hypothetical protein LBJ_2143 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79550.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76634.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798483.1 0.026 28% ...

  16. NCBI nr-aa BLAST: CBRC-OCUN-01-1280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1280 ref|YP_798310.1| hypothetical protein LBL_1947 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801037.1| hypothetical protein LBJ_1728 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79377.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76279.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798310.1 4.1 31% ...

  17. On the Worst-Case Convergence of MR and CG for Symmetric Positive Definite Tridiagonal Toeplitz Matrices

    Czech Academy of Sciences Publication Activity Database

    Liesen, J.; Tichý, Petr

    2005-01-01

    Roč. 20, - (2005), s. 180-197 ISSN 1068-9613 R&D Projects: GA AV ČR(CZ) KJB1030306 Institutional research plan: CEZ:AV0Z10300504 Keywords : Krylov subspace methods * conjugate gradient method * minimal residual method * convergence analysis * tridiagonal Toeplitz matrices * Poisson equation Subject RIV: BA - General Mathematics Impact factor: 0.608, year: 2005 http://etna.mcs.kent.edu/volumes/2001-2010/vol20/abstract.php?vol=20&pages=180-197

  18. People and things. CERN Courier, Oct 1979, v. 19(7)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1979-10-15

    The article describes achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates: The booster of the Synchrotron Radiation Source under construction at Daresbury Laboratory is in operation and already providing electron beams that would be adequate to fill the storage ring in a few minutes.

  19. 197 Obnoxious Labels as Language of Class Struggle in Nigeria ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... properly understood, and strategies for tackling them more appropriately designed. The clarification ..... the word of God makes the best possible use of the miracle of intelligent ... A lot of time, energy and resources are wasted.

  20. 197 impact of project funding on the implementation of leemp

    African Journals Online (AJOL)

    2007-10-31

    Oct 31, 2007 ... the positive growth of the social welfare and functions of the populace. ... In the light of the above, this study has the objective of examining the effectiveness of the funds budgeted for LEEMP projects since inception by the ...

  1. People and things. CERN Courier, Oct 1979, v. 19(7)

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    The article describes achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates: The booster of the Synchrotron Radiation Source under construction at Daresbury Laboratory is in operation and already providing electron beams that would be adequate to fill the storage ring in a few minutes

  2. 40 CFR 197.12 - What definitions apply in subpart B?

    Science.gov (United States)

    2010-07-01

    ... controlled area); (2) Land surfaces; (3) Surface waters; (4) Oceans; and (5) The lithosphere. Aquifer means a..., a waste form with physical and chemical characteristics that significantly decrease the mobility of... received by the reasonably maximally exposed individual. Performance assessment means an analysis that: (1...

  3. People’s Republic of China Scientific Abstracts, Number 197

    Science.gov (United States)

    1978-08-10

    Chinese Academy of Sciences TITLE: "Characteristics of the DNA from Pupal Gonads of Bombyx Mori L.1*» SOURCE: Peking K’UN-CH’UNG HSUEH-PAO [ACTA...some fundamental properties of the DNA from the pupal gonada of Bombyx mori L. The results are as follows: The peak of u.v. absorption of the testicular...pest populations, especially by means of using their natural enemies and changing the spatial structures of their habitats ; (4) use of descrip

  4. NCBI nr-aa BLAST: CBRC-TSYR-01-0989 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0989 ref|YP_796828.1| hypothetical protein LBL_0283 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801953.1| hypothetical protein LBJ_2788 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ77895.1| Hypothetical protein LBL_0283 [Leptospira borgpetersenii serova...r Hardjo-bovis L550] gb|ABJ77195.1| Hypothetical protein LBJ_2788 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_796828.1 4.4 38% ...

  5. Stemcell Information: SKIP000843 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available GBA+/N370S 10001.197.01 10001.197.01 パーキンソン病 G20 Parkinson Disease 168600 ... 68 60-69 Male Ashkenazi J...ewish ... Ashkenazi Jewish ... Yes No Transgene-free iPS cells from Monozygotic twin brother of Parkinson Disease ....023 iPSC-derived dopamine neurons reveal differences between monozygotic twins discordant for Parkinson...patient.Using CytoTune iPS Sendai reprogramming protocol (Life Technologies). パーキンソン

  6. The Marine Geochemistry of the Rare Earth Elements

    Science.gov (United States)

    1983-09-01

    C3): 2045-2056. BACON, M.P., P.G. BREWER, D.W. SPENCER, T.W. MURRAY & T. GODDARD (1980). Lead - 210 , polonium - 210 , manganese and iron in the Cariaco...191 La and Pr 197 Ce: its oxidation and reduction 197 Eu 207 4.5. Conclusions 210 CHAPTER 5. Behaviour of the Rare Earth Elements in anoxic waters of...seawater and algal food . When the radioactive particles were no longer available, the accumulated radioactivity of the zooplankters was rapidly lost

  7. [Serological survey on Toxoplasma gondii infection in pregnant women with history of adverse pregnancy in Bazhou area, Hebei Province].

    Science.gov (United States)

    Ming-Hui, Zhu; Li-Juan, Xu; Zhen-Wei, Xue

    2016-06-22

    To investigate the Toxoplasma gondii infection status in pregnant women with history of adverse pregnancy and risk factors in Bazhou area, Hebei Province. A total of 302 pregnant women with the history of adverse pregnancy were chosen as respondents (an experimental group) in the hospital from March 2012 to December 2015, and 197 pregnant women without the history of adverse pregnancy as a control group. TOX-IgG and TOX-IgM were detected by using ELISA in two groups. The risk factors of Toxoplasma infection were surveyed by questionnaires. The total positive rate of Toxoplasma antibodies was 28.15% (85/302) in the experimental group, which was significantly higher than that [9.64%(19/197)] in the control group, and the difference was statistically significant ( χ 2 = 24.76, P <0.05). The positive rates of TOX-IgM, TOX-IgG and TOX-IgM + TOX-IgG were 6.95% (21/302), 18.54% (56/302), and 2.65% (8/302) respectively in the experimental group, which were higher than 2.03% (4/197), 7.61% (15/197), and 0% (0/197) respectively in the control group ( χ 2 = 6.07, 11.67, 3.76, all P <0.05). The questionnaire survey showed that the proportions of keeping pets, cutting board regardless, liking to eat hot pot or barbecue, eating raw meat, often eating in the restaurant in the pregnant women with Toxoplasma infection were higher than those in the pregnant women without Toxoplasma infection, and the differences were statistically significant ( χ 2 = 22.57, 3.96, 5.87, 7.40, 4.86, all P <0.05), and therefore, the above unhealthy habits may be important risk factors. Toxoplasma infection could lead to adverse pregnancy outcomes. Therefore, the above-mentioned unhealthy habits should be avoided, especially during pregnancy period.

  8. Late quaternary hillslope evolution recorded in eastern South African colluvial badlands

    CSIR Research Space (South Africa)

    Clarke, ML

    2003-09-01

    Full Text Available -8-03 Palaeogeography, Palaeoclimatology, Palaeoecology 197 (2003) 199^212 www.elsevier.com/locate/palaeo dates for calcrete nodules which formed post-dep- ositionally within the sequences and which could not constrain individual depositional or pedogenic events. As a..., the earlier ones of which correlate with the calculated changes in latitudinal insolation. As identi?ed by Thomas and Thorp (1995), the PALAEO 3146 4-8-03 M.L. Clarke et al. / Palaeogeography, Palaeoclimatology, Palaeoecology 197 (2003) 199^212 timing...

  9. Investigation of level energies and B(E2) values for rotation-aligned bands in Hg isotopes

    International Nuclear Information System (INIS)

    Mertin, D.; Tischler, R.; Kleinrahm, A.; Kroth, R.; Huebel, H.; Guenther, C.

    1978-01-01

    High spin states in 191 192 193 195 197 199 Hg were investigated by observing γ-rays and conversion electrons in the compound reactions 192 194 198 Pt(α,xn) and 192 Pt ( 3 He,4n). In 197 Hg the decoupled band built on the 13/2 + state and the semi-decoupled negative-parity band are observed up to Isup(π)=41/2 + and 33/2 - , respectively. A careful investigation of 199 Hg revealed no new high spin states above the previously known levels with Isup(π)=25/2 + and 31/2 - . Half-lives were determined for the 10 + , 7 - , 8 - and 16 - states in 192 Hg, the 33/2 states in 191 193 Hg and the 25/2 - states in 191 193 195 197 Hg. The systematics of the level energies and B(E2) values for the positive parity ground and 13/2 + bands and the negative-parity semi-decoupled bands in 190-200 Hg is discussed. (Auth.)

  10. Transfer in the light Hg isotopes and the U(6/12) models

    International Nuclear Information System (INIS)

    Vergnes, M.; Grafeuille, S.; Rotbard, G.

    1985-01-01

    It was suggested recently that the level schemes of the odd Hg isotopes with 193 200 Hg, 198 Hg, 196 Hg(p,d) 199 Hg, 197 Hg, 195 Hg. The comparison of the experimental spectroscopic factors with the ones computed using the U(6/12) model shows that, among the three nuclei studied, 195 Hg and 197 Hg can be considered as reasonably described. The agreement in this case with U(6/12) is better in the U(5) limit than in the O(6) limit

  11. Assessment of water quality of a river-dominated estuary with hydrochemical parameters: A statistical approach.

    Digital Repository Service at National Institute of Oceanography (India)

    Padma, P.; Sheela, V.S.; Suryakumari, S.; Jayalakshmy, K.V.; Nair, S.M.; Kumar, N.C.

    stream_size 64084 stream_content_type text/plain stream_name Water_Qual_Expos_Health_5_197.pdf.txt stream_source_info Water_Qual_Expos_Health_5_197.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8... Water Qual Expo Health DOI 10.1007/s12403-014-0115-9 ORIGINAL PAPER Assessment of Water Quality of a River-Dominated Estuary with Hydrochemical Parameters: A Statistical Approach P. Padma · V. S. Sheela · S. Suryakumari · K. V. Jayalakshmy · S. M. Nair...

  12. Allelic frequencies of two microsatellite loci in four populations of brown trout (Salmo trutta)

    OpenAIRE

    EDIT VARDHAMI; ANILA HODA; ADIOLA BIBA; MANUELA GUALTIERI; MASSIMO MECATTI; AGIM REXHEPI

    2014-01-01

    Two microsatellite loci, Str60Inra and Ssa197, were PCR amplified on 30 individuals for each populations of brown trout (Salmo trutta). A total of 120 individuals were selected from rivers of the Florence province (Italy), Valbona and Cen (Albania), Lepenci (Kosovo). There were identified 32 different alleles for Str60Inra and 41 for the locus Ssa197. Mean number of alleles ranged from 9 (Cen) to 20.5 (Florence). The mean observed and expected heterosygosities values were 0.329 and 0.755, res...

  13. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    Chatal, J. F.

    2000-01-01

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  14. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  15. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  16. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  17. Curcumin and synthetic analogs induce reactive oxygen species and decreases specificity protein (Sp) transcription factors by targeting microRNAs

    International Nuclear Information System (INIS)

    Gandhy, Shruti U; Kim, KyoungHyun; Larsen, Lesley; Rosengren, Rhonda J; Safe, Stephen

    2012-01-01

    Curcumin inhibits growth of several cancer cell lines, and studies in this laboratory in bladder and pancreatic cancer cells show that curcumin downregulates specificity protein (Sp) transcription factors Sp1, Sp3 and Sp4 and pro-oncogenic Sp-regulated genes. In this study, we investigated the anticancer activity of curcumin and several synthetic cyclohexanone and piperidine analogs in colon cancer cells. The effects of curcumin and synthetic analogs on colon cancer cell proliferation and apoptosis were determined using standardized assays. The changes in Sp proteins and Sp-regulated gene products were analysed by western blots, and real time PCR was used to determine microRNA-27a (miR-27a), miR-20a, miR-17-5p and ZBTB10 and ZBTB4 mRNA expression. The IC 50 (half-maximal) values for growth inhibition (24 hr) of colon cancer cells by curcumin and synthetic cyclohexanone and piperidine analogs of curcumin varied from 10 μM for curcumin to 0.7 μM for the most active synthetic piperidine analog RL197, which was used along with curcumin as model agents in this study. Curcumin and RL197 inhibited RKO and SW480 colon cancer cell growth and induced apoptosis, and this was accompanied by downregulation of specificity protein (Sp) transcription factors Sp1, Sp3 and Sp4 and Sp-regulated genes including the epidermal growth factor receptor (EGFR), hepatocyte growth factor receptor (c-MET), survivin, bcl-2, cyclin D1 and NFκB (p65 and p50). Curcumin and RL197 also induced reactive oxygen species (ROS), and cotreatment with the antioxidant glutathione significantly attenuated curcumin- and RL197-induced growth inhibition and downregulation of Sp1, Sp3, Sp4 and Sp-regulated genes. The mechanism of curcumin-/RL197-induced repression of Sp transcription factors was ROS-dependent and due to induction of the Sp repressors ZBTB10 and ZBTB4 and downregulation of microRNAs (miR)-27a, miR-20a and miR-17-5p that regulate these repressors. These results identify a new and highly potent

  18. Curcumin and synthetic analogs induce reactive oxygen species and decreases specificity protein (Sp transcription factors by targeting microRNAs

    Directory of Open Access Journals (Sweden)

    Gandhy Shruti U

    2012-11-01

    Full Text Available Abstract Background Curcumin inhibits growth of several cancer cell lines, and studies in this laboratory in bladder and pancreatic cancer cells show that curcumin downregulates specificity protein (Sp transcription factors Sp1, Sp3 and Sp4 and pro-oncogenic Sp-regulated genes. In this study, we investigated the anticancer activity of curcumin and several synthetic cyclohexanone and piperidine analogs in colon cancer cells. Methods The effects of curcumin and synthetic analogs on colon cancer cell proliferation and apoptosis were determined using standardized assays. The changes in Sp proteins and Sp-regulated gene products were analysed by western blots, and real time PCR was used to determine microRNA-27a (miR-27a, miR-20a, miR-17-5p and ZBTB10 and ZBTB4 mRNA expression. Results The IC50 (half-maximal values for growth inhibition (24 hr of colon cancer cells by curcumin and synthetic cyclohexanone and piperidine analogs of curcumin varied from 10 μM for curcumin to 0.7 μM for the most active synthetic piperidine analog RL197, which was used along with curcumin as model agents in this study. Curcumin and RL197 inhibited RKO and SW480 colon cancer cell growth and induced apoptosis, and this was accompanied by downregulation of specificity protein (Sp transcription factors Sp1, Sp3 and Sp4 and Sp-regulated genes including the epidermal growth factor receptor (EGFR, hepatocyte growth factor receptor (c-MET, survivin, bcl-2, cyclin D1 and NFκB (p65 and p50. Curcumin and RL197 also induced reactive oxygen species (ROS, and cotreatment with the antioxidant glutathione significantly attenuated curcumin- and RL197-induced growth inhibition and downregulation of Sp1, Sp3, Sp4 and Sp-regulated genes. The mechanism of curcumin-/RL197-induced repression of Sp transcription factors was ROS-dependent and due to induction of the Sp repressors ZBTB10 and ZBTB4 and downregulation of microRNAs (miR-27a, miR-20a and miR-17-5p that regulate these repressors

  19. Illustration of sampling-based approaches to the calculation of expected dose in performance assessments for the proposed high level radioactive waste repository at Yucca Mountain, Nevada.

    Energy Technology Data Exchange (ETDEWEB)

    Helton, Jon Craig (Arizona State University, Tempe, AZ); Sallaberry, Cedric J. PhD. (.; .)

    2007-04-01

    A deep geologic repository for high level radioactive waste is under development by the U.S. Department of Energy at Yucca Mountain (YM), Nevada. As mandated in the Energy Policy Act of 1992, the U.S. Environmental Protection Agency (EPA) has promulgated public health and safety standards (i.e., 40 CFR Part 197) for the YM repository, and the U.S. Nuclear Regulatory Commission has promulgated licensing standards (i.e., 10 CFR Parts 2, 19, 20, etc.) consistent with 40 CFR Part 197 that the DOE must establish are met in order for the YM repository to be licensed for operation. Important requirements in 40 CFR Part 197 and 10 CFR Parts 2, 19, 20, etc. relate to the determination of expected (i.e., mean) dose to a reasonably maximally exposed individual (RMEI) and the incorporation of uncertainty into this determination. This presentation describes and illustrates how general and typically nonquantitive statements in 40 CFR Part 197 and 10 CFR Parts 2, 19, 20, etc. can be given a formal mathematical structure that facilitates both the calculation of expected dose to the RMEI and the appropriate separation in this calculation of aleatory uncertainty (i.e., randomness in the properties of future occurrences such as igneous and seismic events) and epistemic uncertainty (i.e., lack of knowledge about quantities that are poorly known but assumed to have constant values in the calculation of expected dose to the RMEI).

  20. Importance of international standards on hydrogen technologies

    International Nuclear Information System (INIS)

    Bose, T.K.; Gingras, S.

    2001-01-01

    This presentation provided some basic information regarding standards and the International Organization for Standardization (ISO). It also explained the importance of standardization activities, particularly ISO/TC 197 which applies to hydrogen technologies. Standards are established by consensus. They define the minimum requirements that will ensure that products and services are reliable and effective. Standards contribute to the elimination of technical barriers to trade (TBT). The harmonization of standards around the world is desirable in a free trade environment. The influence of the TBT on international standardization was discussed with particular reference to the objectives of ISO/TC 197 hydrogen technologies. One of the priorities for ISO/TC 197 is a hydrogen fuel infrastructure which includes refuelling stations, fuelling connectors, and storage technologies for gaseous and liquid hydrogen. Other priorities include an agreement between the International Electrotechnical Commission (IEC) and the ISO, in particular the IEC/TC 105 and ISO/TC 197 for the development of fuel cell standards. The international standards that have been published thus far include ISO 13984:1999 for liquid hydrogen, land vehicle fuelling system interface, and ISO 14687:1999 for hydrogen fuel product specification. Standards are currently under development for: liquid hydrogen; airport hydrogen fuelling facilities; gaseous hydrogen blends; basic considerations for the safety of hydrogen systems; gaseous hydrogen and hydrogen blends; and gaseous hydrogen for land vehicle filling connectors. It was concluded that the widespread use of hydrogen is dependent on international standardization

  1. Molecular markers shared by diverse apomictic Pennisetum species.

    Science.gov (United States)

    Lubbers, E L; Arthur, L; Hanna, W W; Ozias-Akins, P

    1994-11-01

    Two molecular markers, a RAPD (randomly amplified polymorphic DNA) and a RFLP/STS (restriction fragment length polymorphism/sequence-tagged site), previously were found associated with apomictic reproductive behavior in a backcross population produced to transfer apomixis from Pennisetum squamulatum to pearl millet. The occurrence of these molecular markers in a range of 29 accessions of Pennisetum comprising 11 apomictic and 8 sexual species was investigated. Both markers were specific for apomictic species in Pennisetum. The RFLP/STS marker, UGT 197, was found to be associated with all taxa that displayed apomictic reproductive behavior except those in section Brevivalvula. Neither UGT197 nor the cloned RAPD fragment OPC-04600 hybridized with any sexually reproducing representatives of the genus. The cloned C04600 was associated with 3 of the 11 apomictic species, P. ciliare, P. massaicum, and P. squamulatum. UGT197 was more consistently associated with apomictic reproductive behavior than OPC04600 or cloned C04600, thus it could be inferred that UGT197 is more closely linked to the gene(s) for apomixis than the cloned C04600. The successful use of these probes to survey other Pennisetum species indicates that apomixis is a trait that can be followed across species by using molecular means. This technique of surveying species within a genus will be useful in determining the relative importance of newly isolated markers and may facilitate the identification of the apomixis gene(s).

  2. 1090 nm infrared radiation at close to threshold dose induces cataract with a time delay.

    Science.gov (United States)

    Yu, Zhaohua; Schulmeister, Karl; Talebizadeh, Nooshin; Kronschläger, Martin; Söderberg, Per G

    2015-03-01

    To investigate whether infrared radiation (IRR)-induced cataract is instant or is associated with a time delay between the exposure and the onset of lens light scattering after an exposure to just above threshold dose. Six-weeks-old albino Sprague-Dawley female rats were unilaterally exposed to 197 W/cm2 IRR at 1090 nm within the dilated pupil. In the first experiment, the animals were exposed with four exposure times of 5, 8, 13 and 20 second, respectively. At 24 hr after exposure, the light scattering in both exposed and contralateral not exposed lenses was measured. Based on the first experiment, four postexposure time groups were exposed unilaterally to 1090 nm IRR of 197 W/cm2 for 8 second. At 6, 18, 55 and 168 hr after exposure, the light scattering in both lenses was measured. A 197 W/cm2 IRR-induced light scattering in the lens with exposures of at least 8 second. Further, after exposure to IRR of 197 W/cm2 for 8 second, the light-scattering increase in the lens was delayed approximately 16 hr after the exposure. There is a time delay between the exposure and the onset of cataract after exposure to close to threshold dose implicating that either near IRR cataract is photochemical or there is a time delay in the biological expression of thermally induced damage. © 2014 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.

  3. INDRA-GSI: Collective flow from Fermi to relativistic energies

    Energy Technology Data Exchange (ETDEWEB)

    Lukasik, J.; Trautmann, W.; Begemann-Blaich, M.L.; Bittiger, R.; Gourio, D.; Le Fevre, A.; Lynen, U.; Mueller, W.F.J.; Orth, H.; Sfienti, C.; Schwarz, C.; Turzo, K. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Auger, G.; Bouriquet, B.; Chbihi, A.; Frankland, J.D.; Hudan, S.; Lopez, O. [GANIL, CEA et IN2P3-CNRS, 14 - Caen (France); Borderie, B.; Galichet, E.; Lavaud, F.; Plagnol, E. [Paris-11 Univ., Institut de Physique Nucleaire, IN2P3-CNRS, 91 - Orsay (France); Bellaize, N.; Bocage, F.; Bougault, R.; Durand, D.; Hurst, B.; Steckmeyer, J.C.; Tamain, B.; Vient, E. [Caen Univ., LPC (IN2P3-CNRS/ENSI), 14 - Caen (France); Charvet, J.L.; Dayras, R.; Legrain, R.; Nalpas, L.; Volant, C. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee (DAPNIA/SPhN), 91- Gif sur Yvette (France); Guinet, D.; Lautesse, P. [Institut de Physique Nucleaire, IN2P3-CNRS et Universite, 69 - Villeurbanne (France); Rosato, E.; Vigilante, M. [INFN, Univ. Federico II, Dipartimento di Scienze Fisiche e Sezione, Napoli (Italy); Saija, A. [Universita and INFN I, Dipartimento di Fisica dell' , Catania (Italy); Trzcinski, A.; Zwieglinski, B. [A. Soltan Institute for Nuclear Studies, Warsaw (Poland); Lukasik, J. [H. Niewodniczanski Institute of Nuclear Physics, Krakow (Poland); Galichet, E. [Conservatoire National des Arts et Metiers, 75 - Paris (France)

    2003-07-01

    Directed flow for the {sup 197}Au + {sup 197}Au reactions at incident energies between 40 and 150 A*MeV has been measured using the 4{pi} multi-detector INDRA at the GSI facility. In particular, the bombarding energy at which the elliptic flow switches from in-plane to out-of-plane enhancement has been determined to be around 100 A*MeV in good agreement with the result obtained by the FOPI Collaboration. The new data allows also to extend the experimental excitation function of v{sub 2} to lower energies. (authors)

  4. Summary of Synoptic Meteorological Observations. Siberian Coastal Marine Areas. Volume 3. Area 15 - Okhotsk Sea NE, Area 16 - West Coast Kamchatka, Area 17 - Tatar Strait N, Area 18 - Tatar Strait S, Area 19 - Okhotsk Sea SW, Area 20 - Sakhalin Island SE, Area 21 - Okhotsk Sea SE

    Science.gov (United States)

    1975-10-01

    8217 " ■., . "■ ’■<*. PEKIODI IPRIDARY) 1939-197* (OVER-ALL) 1907-197* 1UCUST TtlU 17 ADEl 0016 HtST COAST KtMCHAUA 9A.AN 15J.JE rCT ntQ 0f AIR...8217—■ ■- ^"’"’""ÜIBMÜMIÜlffifattllll i^iuiimb&m<miiM& *J W \\j- \\j PEKIQOI (DVER-4LLI 1961-1974 OCTUBE« TABLE U (CONTI «Kt» 0016 HtST CUA$T ««^CHJTK» S4.1N

  5. INDRA-GSI: Collective flow from Fermi to relativistic energies

    International Nuclear Information System (INIS)

    Lukasik, J.; Trautmann, W.; Begemann-Blaich, M.L.; Bittiger, R.; Gourio, D.; Le Fevre, A.; Lynen, U.; Mueller, W.F.J.; Orth, H.; Sfienti, C.; Schwarz, C.; Turzo, K.; Auger, G.; Bouriquet, B.; Chbihi, A.; Frankland, J.D.; Hudan, S.; Lopez, O.; Borderie, B.; Galichet, E.; Lavaud, F.; Plagnol, E.; Bellaize, N.; Bocage, F.; Bougault, R.; Durand, D.; Hurst, B.; Steckmeyer, J.C.; Tamain, B.; Vient, E.; Charvet, J.L.; Dayras, R.; Legrain, R.; Nalpas, L.; Volant, C.; Guinet, D.; Lautesse, P.; Rosato, E.; Vigilante, M.; Saija, A.; Trzcinski, A.; Zwieglinski, B.; Lukasik, J.; Galichet, E.

    2003-01-01

    Directed flow for the 197 Au + 197 Au reactions at incident energies between 40 and 150 A*MeV has been measured using the 4π multi-detector INDRA at the GSI facility. In particular, the bombarding energy at which the elliptic flow switches from in-plane to out-of-plane enhancement has been determined to be around 100 A*MeV in good agreement with the result obtained by the FOPI Collaboration. The new data allows also to extend the experimental excitation function of v 2 to lower energies. (authors)

  6. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VLAREVARRMDERLDYIRIEPKRILDLGCGTGADFGGLGRRYPKAMRI 60 ... Query: 138 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFID...MHDLGDALVA 197 ... ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA Sbjct: 121 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA 180 ...

  7. ORF Alignment: NC_005072 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ACVKDLEEAGVDRIQFDVMDGNFVPNLTFGPEMIAACRKYCEVPFE 60 ... Query: 138 PHTPFEMIENIMDMVDHVLVMTVNPGFGGQAYIPTMLNKIRKIRNF...VIEKNLNVDIEVDG 197 ... PHTPFEMIENIMDMVDHVLVMTVNPGFGGQAYIPTMLNKIRKIRNFVIEKN...LNVDIEVDG Sbjct: 121 PHTPFEMIENIMDMVDHVLVMTVNPGFGGQAYIPTMLNKIRKIRNFVIEKNLNVDIEVDG 180 ...

  8. 10 CFR 431.197 - Manufacturer's determination of efficiency for distribution transformers.

    Science.gov (United States)

    2010-01-01

    ... methods used; the mathematical model, the engineering or statistical analysis, computer simulation or... (b)(3) of this section, or by application of an alternative efficiency determination method (AEDM... section only if: (i) The AEDM has been derived from a mathematical model that represents the electrical...

  9. : tous les projets | Page 197 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les initiatives de réduction de la consommation de sel qui visent l'ensemble de la population et qui ciblent la teneur en sodium des aliments et sensibilisent les consommateurs sont susceptibles de réduire la consommation de sel dans toutes les couches de la population et d'améliorer la santé cardiovasculaire.

  10. Asie du sud | Page 197 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il situe en outre le développement de l'aquaculture en Asie dans un contexte mondial plus vaste et il décrit ses liens avec les systèmes naturels, les conditions sociales et l'économie. Read more ... Que ce soit au travail, à la maison, à l'école ou ailleurs, les TIC ont un réel impact sur la vie quotidienne des gens. Read more ...

  11. FCJ-197 Entanglements with Media and Technologies in the Occupy Movement

    Directory of Open Access Journals (Sweden)

    Megan Boler

    2015-06-01

    Full Text Available This essay explores the paradox of activists using corporate-owned platforms—the ‘master’s tools’ (Lorde, 1984—in the context of the Occupy Wall Street movement. Grounded in findings from interviews with 30 women activists from eight North American Occupy sites, this essay reveals the frictions that result from the entangled paradox between philosophies embedded within technologies and activists’ philosophies. We document entanglements between corporate platforms and radical democratic ideals, and subsequent frictions between activists’ ideals and more pragmatic, DIY practices. We also investigate frictions between aspirations of openness, and the realities of surveillance and infiltration by the police state. We examine entanglements through the theoretical lenses of ‘connective labor’ (Boler et al, 2014, ‘veillance’ (Mann, 2004, and the ‘master’s tools’ (Lorde, 1984, and lay the groundwork for ‘queering the binary of individuals and groups’ (Barad, 2012 and recognising the non-linear, dynamic relations of social movements.

  12. Monopole conversion hidden by penetration effect in magnetic dipole transitions

    International Nuclear Information System (INIS)

    Bikit, I.; Anichin, I.; Marinkov, L.

    1977-01-01

    The 191 keV 197 Au nad 340 keV 233 U transitions are investigated and the effect of penetration into the M1-component is accounted for. Theoretical internal conversion coefficients (ICC) and electron parameters to account for the penetration effect have been obtained by interpolating the data of the Hager and Zeltzer tables. The ICC values and ratios are analyzed under the assumption that the 191 keV 197 Au transition has multipolarities M1 + E2 and E 0 +M1. A common overlapping occurs when the nuclear penetration parameter lambda for magnetic dipole transition is lambda = 34.2+-2.2. For the 340 keV 233 U transition the ICC has been found to equal αk=0.69+-0.07, and the relative conversion-line intensities have been determined. It is concluded that the 191 keV 197 Au nad 340 keV 233 U transitions involve an electric monopole component concealed by the penetration effect in the M1-conversion. The matrix elements of the E0-transition have been evaluated

  13. Development of gold nanoparticle radiotracers for investigating multiphase system in process industries

    International Nuclear Information System (INIS)

    Mohd Amirul Syafiq Mohd Yunos; Jaafar Abdullah; Engku Fahmi Engku Chik; Noraishah Othman

    2010-01-01

    This paper describes the development of colloidal 197 Au-SiO 2 with core-shell structure nanoparticle radiotracers. Using conventional citrate-reduction method, gold nanoparticles were prepared from its corresponding metal salts in aqueous solution then coated with uniform shells of amorphous silica via a sol-gel reaction. This target material of radiotracer application used to investigate multiphase system in process industries without disturbing the system operation. The citrate-reduction-based method provides gold nanoparticles with higher concentration and narrow size distribution. By using transmission electron microscopy (TEM), the resultant of particle size and silica coatings could be varied from tens to several hundred of nanometers by controlling the catalyzer and precipitation time. 197 Au-SiO 2 core-shell nano structure is good to prevent the particles from getting conglomerate resulting in a big mass. In addition, silica surface offer very good chances that make the hydrophobicity behavior on the gold nanoparticles. EDXRF spectrum has proven that 197 Au-SiO 2 core-shell nanoparticles sample consists purely of a gold and silica particles. (author)

  14. Nuclear chemistry progress report, Oregon State University. August 1, 1995--August 1, 1996

    International Nuclear Information System (INIS)

    Loveland, W.

    1996-01-01

    In this report, the authors summarize the highlights of the work done between August 1, 1995, and August 1, 1996. The work reported herein is the result of a collaborative effort between the nuclear chemists at Oregon State University and many other individuals and research groups. Each project discussed was the result of a joint effort of the groups, interchanging roles in data acquisition and analysis. The work described is part of a project involving the study of low energy ( 197 Au utilizing the MSU A1200 separator; synthesis of several new neutron-deficient nuclides in reactions of 20 MeV/nucleon 197 Au with heavy targets (Ti, Zr and Au); their participation in exclusive studies of heavy residue formation in the reaction of 35 MeV/nucleon 86 Kr with 197 Au in which it was found that the residues had large associated particle multiplicities indicating their formation in highly dissipative collisions, and that particle emission leading to residue formation relative to fission was favored as the dissipated energy increased

  15. Cloning and sequencing of a gene encoding a 21-kilodalton outer membrane protein from Bordetella avium and expression of the gene in Salmonella typhimurium.

    Science.gov (United States)

    Gentry-Weeks, C R; Hultsch, A L; Kelly, S M; Keith, J M; Curtiss, R

    1992-01-01

    Three gene libraries of Bordetella avium 197 DNA were prepared in Escherichia coli LE392 by using the cosmid vectors pCP13 and pYA2329, a derivative of pCP13 specifying spectinomycin resistance. The cosmid libraries were screened with convalescent-phase anti-B. avium turkey sera and polyclonal rabbit antisera against B. avium 197 outer membrane proteins. One E. coli recombinant clone produced a 56-kDa protein which reacted with convalescent-phase serum from a turkey infected with B. avium 197. In addition, five E. coli recombinant clones were identified which produced B. avium outer membrane proteins with molecular masses of 21, 38, 40, 43, and 48 kDa. At least one of these E. coli clones, which encoded the 21-kDa protein, reacted with both convalescent-phase turkey sera and antibody against B. avium 197 outer membrane proteins. The gene for the 21-kDa outer membrane protein was localized by Tn5seq1 mutagenesis, and the nucleotide sequence was determined by dideoxy sequencing. DNA sequence analysis of the 21-kDa protein revealed an open reading frame of 582 bases that resulted in a predicted protein of 194 amino acids. Comparison of the predicted amino acid sequence of the gene encoding the 21-kDa outer membrane protein with protein sequences in the National Biomedical Research Foundation protein sequence data base indicated significant homology to the OmpA proteins of Shigella dysenteriae, Enterobacter aerogenes, E. coli, and Salmonella typhimurium and to Neisseria gonorrhoeae outer membrane protein III, Haemophilus influenzae protein P6, and Pseudomonas aeruginosa porin protein F. The gene (ompA) encoding the B. avium 21-kDa protein hybridized with 4.1-kb DNA fragments from EcoRI-digested, chromosomal DNA of Bordetella pertussis and Bordetella bronchiseptica and with 6.0- and 3.2-kb DNA fragments from EcoRI-digested, chromosomal DNA of B. avium and B. avium-like DNA, respectively. A 6.75-kb DNA fragment encoding the B. avium 21-kDa protein was subcloned into the

  16. Bioinformatic analysis of neurotropic HIV envelope sequences identifies polymorphisms in the gp120 bridging sheet that increase macrophage-tropism through enhanced interactions with CCR5

    International Nuclear Information System (INIS)

    Mefford, Megan E.; Kunstman, Kevin; Wolinsky, Steven M.; Gabuzda, Dana

    2015-01-01

    Macrophages express low levels of the CD4 receptor compared to T-cells. Macrophage-tropic HIV strains replicating in brain of untreated patients with HIV-associated dementia (HAD) express Envs that are adapted to overcome this restriction through mechanisms that are poorly understood. Here, bioinformatic analysis of env sequence datasets together with functional studies identified polymorphisms in the β3 strand of the HIV gp120 bridging sheet that increase M-tropism. D197, which results in loss of an N-glycan located near the HIV Env trimer apex, was detected in brain in some HAD patients, while position 200 was estimated to be under positive selection. D197 and T/V200 increased fusion and infection of cells expressing low CD4 by enhancing gp120 binding to CCR5. These results identify polymorphisms in the HIV gp120 bridging sheet that overcome the restriction to macrophage infection imposed by low CD4 through enhanced gp120–CCR5 interactions, thereby promoting infection of brain and other macrophage-rich tissues. - Highlights: • We analyze HIV Env sequences and identify amino acids in beta 3 of the gp120 bridging sheet that enhance macrophage tropism. • These amino acids at positions 197 and 200 are present in brain of some patients with HIV-associated dementia. • D197 results in loss of a glycan near the HIV Env trimer apex, which may increase exposure of V3. • These variants may promote infection of macrophages in the brain by enhancing gp120–CCR5 interactions

  17. [Drug administration to pediatric patients: Evaluation of the nurses' preparation habits in pediatric units].

    Science.gov (United States)

    Ménétré, S; Weber, M; Socha, M; Le Tacon, S; May, I; Schweitzer, C; Demoré, B

    2018-04-01

    In hospitals, the nursing staff is often confronted with the problem of the preparation and administration of drugs for their pediatric patients because of the lack of indication, pediatric dosage, and appropriate galenic form. The goal of this study was to give an overview of the nurses' preparation habits in pediatric units and highlight their daily problems. This single-center prospective study was conducted through an observation of the nursing staff during the drug preparation process in medicine, surgery and intensive care units. We included 91 patients (55 boys and 36 girls), with an average age of 6.3 years (youngest child, 10 days old; oldest child, 18 years old). We observed a mean 2.16 drug preparations per patient [1-5]. We collected 197 observation reports regarding 66 injectable drugs and 131 oral drugs (71 liquid forms and 60 solid forms). The majority of these reports concerned central nervous system drugs (63/197), metabolism and digestive system drugs (50/197), and anti-infective drugs (46/197). The study highlights the nurses' difficulties: modification of the solid galenic forms, lack of knowledge on oral liquid form preservation or reconstitution methods, withdrawal of small volumes, and vague and noncompliant labeling. This study led to the creation of a specific working group for pediatrics. This multidisciplinary team meets on a regular basis to work toward improving the current habits to both simplify and secure drug administration to hospitalized children. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  18. Magnetic resonance imaging - guided vacuum-assisted breast biopsy: an initial experience in a community hospital

    International Nuclear Information System (INIS)

    Friedman, P.; Enis, S.; Pinyard, J.

    2009-01-01

    To evaluate the effectiveness in diagnosing mammographically and sonographically occult breast lesions by using magnetic resonance imaging (MRI) guided vacuum-assisted breast biopsy in patients who presented to a community-based hospital with a newly established breast MRI program. The records of 142 consecutive patients, median age of 55 years, who had undergone MRI-guided biopsy at our institution between July 2006 and July 2007 were reviewed. From these patients, 197 mammographically and sonographically occult lesions were biopsied at the time of discovery. The pathology was then reviewed and correlated with the MRI findings. Cancer was present and subsequently discovered in 8% of the previously occult lesions (16/197) or 11% of the women studied (16/142). Of the cancerous lesions, 56% were invasive carcinomas (9/16) and 44% were ductal carcinomas in situ (7/16). Fourteen percent of the discovered lesions (28/197) were defined as high risk and included atypical ductal hyperplasia, atypical lobular hyperplasia, lobular carcinoma in situ, and radial scar. In total, occult cancerous and high-risk lesions were discovered in 22% of the found lesions (44/197) or 31% of the women who underwent MRI-guided biopsy (44/142). This study demonstrated that detection of cancerous and high-risk lesions can be significantly increased when an MRI-guided biopsy program is introduced at a community-based hospital. We believe that as radiologists gain confidence in imaging and histologic correlation, community-based hospitals can achieve similar rates of occult lesion diagnosis as those found in data emerging from academic institutions. (author)

  19. Magnetic resonance imaging - guided vacuum-assisted breast biopsy: an initial experience in a community hospital

    Energy Technology Data Exchange (ETDEWEB)

    Friedman, P.; Enis, S.; Pinyard, J., E-mail: jpinyard@gmail.com [Morristown Memorial Hospital, The Carol W. and Julius A. Rippel Breast Center, The Carol G. Simon Cancer Centre, Morristown, New Jersey (United States)

    2009-10-15

    To evaluate the effectiveness in diagnosing mammographically and sonographically occult breast lesions by using magnetic resonance imaging (MRI) guided vacuum-assisted breast biopsy in patients who presented to a community-based hospital with a newly established breast MRI program. The records of 142 consecutive patients, median age of 55 years, who had undergone MRI-guided biopsy at our institution between July 2006 and July 2007 were reviewed. From these patients, 197 mammographically and sonographically occult lesions were biopsied at the time of discovery. The pathology was then reviewed and correlated with the MRI findings. Cancer was present and subsequently discovered in 8% of the previously occult lesions (16/197) or 11% of the women studied (16/142). Of the cancerous lesions, 56% were invasive carcinomas (9/16) and 44% were ductal carcinomas in situ (7/16). Fourteen percent of the discovered lesions (28/197) were defined as high risk and included atypical ductal hyperplasia, atypical lobular hyperplasia, lobular carcinoma in situ, and radial scar. In total, occult cancerous and high-risk lesions were discovered in 22% of the found lesions (44/197) or 31% of the women who underwent MRI-guided biopsy (44/142). This study demonstrated that detection of cancerous and high-risk lesions can be significantly increased when an MRI-guided biopsy program is introduced at a community-based hospital. We believe that as radiologists gain confidence in imaging and histologic correlation, community-based hospitals can achieve similar rates of occult lesion diagnosis as those found in data emerging from academic institutions. (author)

  20. Bioinformatic analysis of neurotropic HIV envelope sequences identifies polymorphisms in the gp120 bridging sheet that increase macrophage-tropism through enhanced interactions with CCR5

    Energy Technology Data Exchange (ETDEWEB)

    Mefford, Megan E., E-mail: megan_mefford@hms.harvard.edu [Department of Cancer Immunology and AIDS, Dana-Farber Cancer Institute, Boston, MA (United States); Kunstman, Kevin, E-mail: kunstman@northwestern.edu [Northwestern University Medical School, Chicago, IL (United States); Wolinsky, Steven M., E-mail: s-wolinsky@northwestern.edu [Northwestern University Medical School, Chicago, IL (United States); Gabuzda, Dana, E-mail: dana_gabuzda@dfci.harvard.edu [Department of Cancer Immunology and AIDS, Dana-Farber Cancer Institute, Boston, MA (United States); Department of Neurology (Microbiology and Immunobiology), Harvard Medical School, Boston, MA (United States)

    2015-07-15

    Macrophages express low levels of the CD4 receptor compared to T-cells. Macrophage-tropic HIV strains replicating in brain of untreated patients with HIV-associated dementia (HAD) express Envs that are adapted to overcome this restriction through mechanisms that are poorly understood. Here, bioinformatic analysis of env sequence datasets together with functional studies identified polymorphisms in the β3 strand of the HIV gp120 bridging sheet that increase M-tropism. D197, which results in loss of an N-glycan located near the HIV Env trimer apex, was detected in brain in some HAD patients, while position 200 was estimated to be under positive selection. D197 and T/V200 increased fusion and infection of cells expressing low CD4 by enhancing gp120 binding to CCR5. These results identify polymorphisms in the HIV gp120 bridging sheet that overcome the restriction to macrophage infection imposed by low CD4 through enhanced gp120–CCR5 interactions, thereby promoting infection of brain and other macrophage-rich tissues. - Highlights: • We analyze HIV Env sequences and identify amino acids in beta 3 of the gp120 bridging sheet that enhance macrophage tropism. • These amino acids at positions 197 and 200 are present in brain of some patients with HIV-associated dementia. • D197 results in loss of a glycan near the HIV Env trimer apex, which may increase exposure of V3. • These variants may promote infection of macrophages in the brain by enhancing gp120–CCR5 interactions.

  1. New insight to IL-23/IL-17 axis in Iranian infected adult patients with gastritis: effects of genes polymorphisms on expression of cytokines.

    Science.gov (United States)

    Shirzad, H; Bagheri, N; Azadegan-Dehkordi, F; Zamanzad, B; Izadpanah, E; Abdi, M; Ramazani, G; Sanei, M H; Ayoubian, H; Ahmadi, A; Jamalzehi, S; Aslani, P; Zandi, F

    2015-06-01

    Chronic inflammation is the hallmark of the pathogenesis of H. pylori-induced gastric cancer. IL-17A and IL-17F are inflammatory cytokines expressed by a novel subset of CD4+Th cells and play critical function in inflammation. We evaluated the relationship between IL-17A G197A, IL-17F A7488G and IL23R+2199 A/C polymorphisms with IL-6, IL-17, IL-21, IL-23 and TGF-β1 mRNAs expression in regard to H. pylori infection with chronic gastritis. Total RNA and genomic DNA were extracted from gastric biopsies of 58 H. pylori-infected patient with gastritis. Afterward, mucosal IL-6, IL-17, IL-21, IL-23 and TGF-β1 mRNAs expression and polymorphisms in IL-17A G197A, IL-17F A7488G and IL-23R +2199A/Cin gastric biopsies were determined by real-time PCR and PCR-RFLP. Our results show that IL-17A G197A, IL-17F A7488G andIL23R +2199A/C polymorphisms have no effect on mucosal expression of IL-6, IL-17, IL-21 and TGF-β1 mRNAs expression in H. pylori-infected patients with chronic gastritis. These results suggest that IL-17A G197A, IL-17F A7488G and IL23R +2199A/C polymorphisms no alter mucosal cytokine pattern in Iranian patients with H. pylori-associated gastritis diseases. © Acta Gastro-Enterologica Belgica.

  2. ENDF/B-5 Standards Data Library (including modifications made in 1986). Summary of contents and documentation

    International Nuclear Information System (INIS)

    DayDay, N.; Lemmel, H.D.

    1986-01-01

    This document summarizes the contents and documentation of the ENDF/B-5 Standards Data Library (EN5-ST) released in September 1979. The library contains complete evaluations for all significant neutron reactions in the energy range 10 -5 eV to 20 MeV for H-1, He-3, Li-6, B-10, C-12, Au-197 and U-235 isotopes. In 1986 the files for C-12, Au-197 and U-235 were slightly modified. The entire library or selective retrievals from it can be obtained free of charge from the IAEA Nuclear Data Section. (author)

  3. A Perspective on the Numerical and Experimental Characteristics of Multi-Mode Dry-Friction Whip and Whirl

    Science.gov (United States)

    2008-06-01

    rocket engine turbopump, the shaft was machined from a solid piece of AISI 4140 steel and has an average diameter of 1.5 in (3.81 cm) and a length of...Hardness Ratio Friction Coefficient [36,37] Rotor 1.4997 (3.809) - AISI 4140 197 - - Bearing S1,S2 1.5026 (3.817) 517.14 660 Bearing Bronze 65 3.03...Bearing T1 1.5040 (3.820) 348.77 AISI 4140 197 1 0.25-0.7 20 From the data presented in Table 1, inserts S1 and S2 should have the least severe

  4. Passive neutron dosemeter with activation detector

    Energy Technology Data Exchange (ETDEWEB)

    Valero L, C.; Banuelos F, A.; Guzman G, K. A.; Borja H, C. G.; Hernandez D, V. M.; Vega C, H. R., E-mail: fermineutron@yahoo.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2011-10-15

    A passive neutron dosemeter with {sup 197}Au activation detector has been developed. The area dosemeter was made as a 20.5 {phi} x 20.5 cm{sup 2} polyethylene moderator, with a polyethylene pug where a {sup 197}Au foil can be located either parallel or perpendicular to moderator axis. Using Monte Carlo methods, with the MCNP5 code. With the fluence response and the fluence-to-equivalent dose conversion coefficients from ICRP-74, responses to H*(10) were also calculated, these were compared against responses of commercially available neutron area monitors and dosemeters. (Author)

  5. ENDF/B-5 Standards Data Library (including modifications made in 1986). Summary of contents and documentation

    Energy Technology Data Exchange (ETDEWEB)

    DayDay, N; Lemmel, H D

    1986-05-01

    This document summarizes the contents and documentation of the ENDF/B-5 Standards Data Library (EN5-ST) released in September 1979. The library contains complete evaluations for all significant neutron reactions in the energy range 10{sup -5}eV to 20 MeV for H-1, He-3, Li-6, B-10, C-12, Au-197 and U-235 isotopes. In 1986 the files for C-12, Au-197 and U-235 were slightly modified. The entire library or selective retrievals from it can be obtained free of charge from the IAEA Nuclear Data Section. (author) Refs, figs, tabs

  6. ORF Alignment: NC_005070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AICDIDGEQGLLTYRGYPMQDLAANSSFLETAFLLIWGELPSRDQLA 60 ... Query: 138 RLIAKIPTMVAAFQLIRKGQDPIQPRDDLAYSANFLYMLTEREPDPLAARIFD...RCLMLHA 197 ... RLIAKIPTMVAAFQLIRKGQDPIQPRDDLAYSANFLYMLTEREPDPLAARIFDRCLMLHA Sbjct: 121 RLIAK...IPTMVAAFQLIRKGQDPIQPRDDLAYSANFLYMLTEREPDPLAARIFDRCLMLHA 180 ... Query: 258 LDEAMAAKR

  7. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GHPVFDNQNQRTVGARGPATLENYQFLEKISHFDRERIPERVVHARGAVAYGYFE 60 ... Query: 138 NWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFD...FMSQTPEAMHMLVNLFS 197 ... NWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFDFMSQTPEAMHMLVNLFS Sbjct: 1...21 NWDLVGNNLGVFFIRDAIKFPDVIHALKPDPVTFRQEPARIFDFMSQTPEAMHMLVNLFS 180 ... Query: 258 S

  8. Protein (Cyanobacteria): 653002395 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_027254586.1 ... 1117:6743 ... 1150:53326 1301283:74640 ... 54304:943 1160:197 ... hypothetical protein Plankt...WNRQNQLGIAFDSSTGFHLPNGADRSPDASWIRQERWDLLTQEEREIFAPICPDFVLELRSKNDALEKLQAKMIEYIENGASLGWLIDRKNKTVEIYRQNQDIELLNHPLILSGEDILPGFMLDLTEVWN

  9. Evaluation of 13-valent pneumococcal conjugate vaccine and concomitant meningococcal group C conjugate vaccine in healthy infants and toddlers in Spain.

    Science.gov (United States)

    Diez-Domingo, Javier; Gurtman, Alejandra; Bernaola, Enrique; Gimenez-Sanchez, Francisco; Martinon-Torres, Federico; Pineda-Solas, Valentin; Delgado, Alfonso; Infante-Marquez, Pilar; Liang, John Z; Giardina, Peter C; Gruber, William C; Emini, Emilio A; Scott, Daniel A

    2013-11-04

    Given the concurrent administration of multiple vaccines during routine pediatric immunizations, efforts to elucidate the potential interference of any vaccine on the immune response to the concomitantly administered antigens are fundamental to prelicensure clinical research. This phase 3 randomized controlled trial of 13-valent pneumococcal conjugate vaccine (PCV13) versus 7-valent PCV (PCV7) assessed immune responses of concomitantly administered meningococcal group C conjugated to diphtheria toxin cross-reactive material 197 (MnCCV-CRM197) in a 2-dose infant series and 15-month toddler dose. 619 subjects were randomized, 315 to PCV13 and 304 to PCV7. MnCCV-CRM197-induced immune responses were similar between the PCV13 and PCV7 groups, with >97% of the subjects achieving a ≥1:8 meningococcal serum bactericidal assay (SBA) titer after both dose 2 and the toddler dose. Geometric mean titers were lower in the PCV13 group 191.22 (167.72, 218.02) versus 266.19 (234.86, 301.71) following dose 2 and 432.28 (361.22, 517.31) versus 730.84 (642.05, 831.91) following the toddler dose. The geometric mean (GM) meningococcal SBA titer ratios (PCV13/PCV7) were 0.72 after dose 2 and 0.59 after the toddler dose. The criteria for MnCCV-CRM197 non-inferiority for GM titers were satisfied after dose 2. Percent responders was similar up to titers of 1:128. PCV13 elicited substantial antipneumococcal responses against all 13 serotypes, with ≥90% of the subjects achieving an antibody concentration ≥0.35μg/mL after dose 3 in the infant series. Safety and tolerability were similar between the vaccine groups. Immunogenicity results of MnCCV-CRM197 for PCV13 compared with PCV7 included lower GMTs, but the clinical significance of this is unknown as the proportion of infants achieving protective MenC antibody titers was comparable in the two groups. Percent responders were similar up to titers of 1:128. PCV13 has an acceptable safety profile in infants and toddlers, while providing

  10. Differential microRNAs expression in serum of patients with lung cancer, pulmonary tuberculosis, and pneumonia.

    Science.gov (United States)

    Abd-El-Fattah, Amal A; Sadik, Nermin Abdel Hamid; Shaker, Olfat Gamil; Aboulftouh, Mariam Lotfy

    2013-01-01

    MicroRNAs (miRNAs) play critical regulatory roles in the physiological and pathological processes. The high stability of miRNAs in human serum represents attractive novel diagnostic biomarkers of clinical conditions. Several studies have shown that aberrant expression of miRNAs in human cancer including lung cancer, but little is known about their effects on some infectious lung diseases such as pulmonary tuberculosis (TB) and pneumonia. In this study, we investigated miRNA expression pattern in serum of Egyptian patients with lung cancer, TB, and pneumonia compared with matched healthy controls. Using microarray-based expression profiling followed by real-time quantitative polymerase chain reaction validation, we compared the levels of a series of circulating miRNAs (miR-21, miR-155, miR-182, and miR-197) in serum from patients with lung cancer (n = 65), pulmonary tuberculosis (n = 29), pneumonia (n = 29), and transudate (n = 16) compared with matched healthy controls (n = 37). MiRNA SNORD68 was the housekeeping endogenous control. We found that the serum levels of miR-21, miR-155, and miR-197 were significantly elevated in the patients with lung cancer and pneumonia whereas miR-182 and miR-197 levels were increased only in patients with lung cancer and TB, respectively, compared with controls. Receiver operating characteristic analysis revealed that miR-182, miR-155, and miR-197 have superior diagnostic potential in discriminating patients with lung cancer, pneumonia, and TB, respectively, from controls. Our results conclude that the differential expression of the four studied miRNAs can be potential non-invasive biomarkers for patients with lung cancer, TB and pneumonia.

  11. Multiple scattering mechanisms causing interference effects in the differential cross sections of H + D{sub 2} → HD(v′ = 4,  j′) + D at 3.26 eV collision energy

    Energy Technology Data Exchange (ETDEWEB)

    Sneha, Mahima; Gao, Hong; Zare, Richard N., E-mail: zare@stanford.edu, E-mail: aoiz@quim.ucm.es [Department of Chemistry, Stanford University, Stanford, California 94305 (United States); Jambrina, P. G.; Menéndez, M.; Aoiz, F. J., E-mail: zare@stanford.edu, E-mail: aoiz@quim.ucm.es [Departamento de Quimica Fisica I, Facultad de Quimica, Universidad Complutense de Madrid, Madrid 28040 (Spain)

    2016-07-14

    Differential cross sections (DCSs) for the H + D{sub 2} → HD(v′ = 4,  j′) + D reaction at 3.26 eV collision energy have been measured using the photoloc technique, and the results have been compared with those from quantum and quasiclassical scattering calculations. The quantum mechanical DCSs are in good overall agreement with the experimental measurements. In common with previous results at 1.97 eV, clear interference patterns which appear as fingerlike structures have been found at 3.26 eV but in this case for vibrational states as high as v′ = 4. The oscillatory structure is prominent for low rotational states and progressively disappears as j′ increases. A detailed analysis, similar to that carried out at 1.97 eV, shows that the origin of these structures could be traced to interferences between well defined classical mechanisms. In addition, at this energy, we do not observe the anomalous positive j′–θ trend found for the v′ = 4 manifold at lower collision energies, thus reinforcing our explanation that the anomalous distribution for HD(v′ = 4,  j′) at 1.97 eV only takes place for those states associated with low product recoil energies.

  12. Is CT effective in diagnosing the acute appendicitis?: Focus on comparison of unenhanced CT with barium enema

    International Nuclear Information System (INIS)

    Choi, Seong Hee; Hahm, So Hee; Kang Jin Hwa; Moon, Jeong Hwa

    1994-01-01

    To evaluate the role of unenhanced CT in diagnosing the acute appendicitis. We retrospectively analyzed conventional contrast-enhanced abdominal CT scans of 197 normal patients and barium enemas of 26 out of the 197 patients. Additional unenhanced CT scans of right lower abdomen were performed on 30 patients who were suspected of having acute appendicitis; barium enema was performed in 26 patients. In the analysis of the conventional CT scans, we could detect 132 (67%) normal appendices. On barium enema of 26 out of 197 patients, abruptly narrowed appendix was visualized in 5 cases and luminal irregularity in 4 cases but all 26 cases showed normal appendix on CT. In the 30 cases of unenhanced CT, all appendices were visualized. Among 12 cases which were proved as acute appendicitis, barium enema was done in 10 cases; abruptly narrowed appendix was shown in 3 and luminal irregularity in 1. Among 18 cases which were diagnosed as normal appendix, nonvisualization of appendix was in 1 case, abruptly narrowed lumen in 3, and luminal irregularity in 9. Unenhanced CT in the area of the cecum may be an effective and safe diagnostic tool acute appendicitis

  13. ORF Alignment: NC_004545 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available -phosphate synthase (DHBP synthase) ... Length = 197 ... Query: 15 ... RVKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITES...K 74 ... RVKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITESK Sbjct: 1... ... RVKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITESK 60 ... Query: 135 GH

  14. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  15. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  16. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  17. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir

    2011-01-01

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  18. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  19. Study of the decay of hot nuclear systems formed in Au-induced reactions at E/A=60 MeV

    International Nuclear Information System (INIS)

    Delis, D.N.; Colonna, N.; Sui, Q.; Tso, K.

    1993-01-01

    Multifragment production was measured for the 197 Au + 12 C, 27 Al, 51 V, 63 Cu and 197 Au reactions at E/A= 60 MeV. Comparison of experimental observables to calculations with a dynamical code coupled to a statistical model indicates agreement with some features of the experimental data. Furthermore the logarithms of the branching ratios for binary, ternary, quaternary, and quinary decays plotted as a function of E -1/2 show a linear dependence that ,strongly suggests a statistical competition between the various multifraigment channels. Finally, by utilizing the momentum tensor, the shape of the most central events in momentum space has been determined

  20. The symmetry energy at suprasaturation density and the ASY-EOS experiment at GSI

    Directory of Open Access Journals (Sweden)

    De Filippo E.

    2017-01-01

    Full Text Available The ASY-EOS experiment at GSI laboratory measured the direct and elliptic flow of neutrons and light charged particles in the reaction 197Au+197 Au at 400 A MeV incident energy. The ratio of elliptic flow of neutrons with respect to that of the light charged particles was used as main experimental observable to probe the density dependence of the symmetry energy term of the nuclear equation of state. Results, obtained by comparison of the experimental data with the UrQMD model predictions, strongly support a moderately soft to linear density dependence of the symmetry energy at suprasaturation densities below 2ρ0.

  1. Status of the experiment ASYEOS

    Energy Technology Data Exchange (ETDEWEB)

    Kupny, Sebastian [GSI Helmholtzzentrum GmbH Darmstadt (Germany); Collaboration: ASYEOS-Collaboration

    2012-07-01

    Neutron-proton squeeze-out is predicted to provide quantitative information on the symmetry term of the nuclear Equation of State at supra-saturation densities. Hence we designed an experiment consisting out of the CHIMERA charged particle detector for impact parameter determination and reaction plane reconstruction, the LAND neutron detector to measure neutron and proton squeeze-out and a Triple Telescope Array to identify light fragments. Measurements of 197Au+197Au, 96Ru+96Ru and 96Zr+96Zr collisions at 400 A MeV have been accomplished in May 2011 at the GSI facility. Current status of the analysis, first results and future plans are presented.

  2. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ADLGADLVLTPELSLWGYPPRDLLLSHNHLV 60 ... Query: 138 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAAXX ...197 ... IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAA ... Sbjct...: 121 IYDVFDEKRYFRPAGTPAVLEFERDGRRWRLGLTICEDLWVEEALQGKRIAGPDPIAALL 180 ... Query: 258 EHAELALQLPSCREALAIWD 277 ... EHAELALQLPSCREALAIWD Sbjct: 241 EHAELALQLPSCREALAIWD 260

  3. SUBJECT AND AUTHOR INDEXS

    Directory of Open Access Journals (Sweden)

    IJBE Volume 2

    2016-09-01

    Full Text Available SUBJECT INDEX IJBE VOLUME 2access credit, 93acquisition, 177AHP, 61, 82, 165arena simulation,43BMC, 69Bojonegoro, 69brand choice, 208brand image, 208brand positioning, 208bullwhip effect, 43burger buns, 1business synergy and financial reports, 177capital structure, 130cluster, 151coal reserves, 130coffee plantation, 93competitiveness, 82consumer behaviour, 33consumer complaint behavior, 101cooking spices, 1crackers, 1cross sectional analytical, 139crosstab, 101CSI, 12direct selling, 122discriminant analysis, 33economic value added, 130, 187employee motivation, 112employee performance, 112employees, 139EOQ, 23farmer decisions, 93farmer group, 52financial performance evaluation, 187financial performance, 52, 177financial ratio, 187financial report, 187fiva food, 23food crops, 151horticulture, 151imports, 151improved capital structure, 177IPA, 12leading sector, 151life insurance, 165LotteMart, 43main product, 61marketing mix, 33, 165matrix SWOT, 69MPE, 61multiple linear regression, 122muslim clothing, 197Ogun, 139Pangasius fillet, 82Pati, 93pearson correlation, 101perceived value, 208performance suppy chain, 23PLS, 208POQ, 23portfolio analyzing, 1product, 101PT SKP, 122pulp and papers, 187purchase decision, 165purchase intention, 33remuneration, 112re-purchasing decisions, 197sales performance, 122sawmill, 52SCOR, 23sekolah peternakan rakyat, 69SEM, 112SERVQUAL, 12Sido Makmur farmer groups, 93SI-PUHH Online, 12small and medium industries (IKM, 61socio-demographic, 139sport drink, 208stress, 139supply chain, 43SWOT, 82the mix marketing, 197Tobin’s Q, 130trade partnership, 52uleg chili sauce, 1 AUTHOR INDEX IJBE VOLUME 2Achsani, Noer Azam, 177Andati, Trias, 52, 177Andihka, Galih, 208Arkeman, Yandra, 43Baga, Lukman M, 69Cahyanugroho, Aldi, 112Daryanto, Arief, 12David, Ajibade, 139Djoni, 122Fahmi, Idqan, 1Fattah, Muhammad Unggul Abdul, 61Hakim, Dedi Budiman, 187Harianto, 93Hartoyo, 101Homisah, 1Hubeis, Musa, 112Hutagaol, M. Parulian, 93Jaya, Stevana

  4. 14 CFR 121.197 - Airplanes: Turbine engine powered: Landing limitations: Alternate airports.

    Science.gov (United States)

    2010-01-01

    ... obstruction clearance plane and the runway. In the case of an alternate airport for departure, as provided in § 121.617, allowance may be made for fuel jettisoning in addition to normal consumption of fuel and oil...

  5. Determination of resonance parameters at 4.90 eV for Au 197

    International Nuclear Information System (INIS)

    Tellier, Henry; Alix, Michel

    1969-12-01

    A new study of the 4.9 eV resonance of gold was carried out by the time of flight method using the 45 MeV Saclay linac as a pulsed neutron source. Four sample thicknesses were used for the measurements. The four transmission curves were shaped analysed and the following parameters were obtained: E = 4.900 ± 0.005 eV - Γ = 137.5 ± 2.0 meV and Γ n = 15.0 ± 0.2 meV. (author) [fr

  6. 26 CFR 1.197-2 - Amortization of goodwill and certain other intangibles.

    Science.gov (United States)

    2010-04-01

    ... regularly traded on an established market. (See paragraph (g)(3) of this section for special rules... existing futures contract, foreign currency contract, notional principal contract, interest rate swap, or other similar financial contract, whether or not the interest is regularly traded on an established...

  7. 197.pdf | mar2007 | jbiosci | www.ias.ac.in | | http: | Indian Academy ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Live streaming of the Symposium on Dialogue: Science, Scientists, and Society starts at 2:00 pm IST on the 13th of October – 2017. Posted on 12 ...

  8. SU-E-T-197: Helical Cranial-Spinal Treatments with a Linear Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, J; Bernard, D; Liao, Y; Templeton, A; Turian, J; Chu, J [Rush University Medical Center, Chicago, IL (United States)

    2014-06-01

    Purpose: Craniospinal irradiation (CSI) of systemic disease requires a high level of beam intensity modulation to reduce dose to bone marrow and other critical structures. Current helical delivery machines can take 30 minutes or more of beam-on time to complete these treatments. This pilot study aims to test the feasibility of performing helical treatments with a conventional linear accelerator using longitudinal couch travel during multiple gantry revolutions. Methods: The VMAT optimization package of the Eclipse 10.0 treatment planning system was used to optimize pseudo-helical CSI plans of 5 clinical patient scans. Each gantry revolution was divided into three 120° arcs with each isocenter shifted longitudinally. Treatments requiring more than the maximum 10 arcs used multiple plans with each plan after the first being optimized including the dose of the others (Figure 1). The beam pitch was varied between 0.2 and 0.9 (couch speed 5- 20cm/revolution and field width of 22cm) and dose-volume histograms of critical organs were compared to tomotherapy plans. Results: Viable pseudo-helical plans were achieved using Eclipse. Decreasing the pitch from 0.9 to 0.2 lowered the maximum lens dose by 40%, the mean bone marrow dose by 2.1% and the maximum esophagus dose by 17.5%. (Figure 2). Linac-based helical plans showed dose results comparable to tomotherapy delivery for both target coverage and critical organ sparing, with the D50 of bone marrow and esophagus respectively 12% and 31% lower in the helical linear accelerator plan (Figure 3). Total mean beam-on time for the linear accelerator plan was 8.3 minutes, 54% faster than the tomotherapy average for the same plans. Conclusions: This pilot study has demonstrated the feasibility of planning pseudo-helical treatments for CSI targets using a conventional linac and dynamic couch movement, and supports the ongoing development of true helical optimization and delivery.

  9. Oregon State University nuclear chemistry progress report, August 1, 1988--August 1, 1989

    International Nuclear Information System (INIS)

    Loveland, W.D.

    1989-08-01

    The work described herein is part of a project involving the study of intermediate energy, and relativistic heavy ion reactions. The intermediate energy research focused on the characterization of the heavy residues, the large target fragments with A frag >2/3 A target . For the reaction of 85 MeV/nucleon 12 C with 197 Au, we had measured the heavy residue yields and angular distributions previously. We report herein the measurement of their energy spectra. The average residue energies are quite low, ranging from 15 keV/nucleon to 314 keV/nucleon. These low energies imply errors in some previous measurements of heavy residues in that many residues have energies below counter thresholds, etc. The essential physics of heavy residue production is shown to be correctly described by a VUU calculation. For the reaction of 35 and 43 MeV/nucleon Kr with Au, we found the linear momenta of the near-target heavy residues to be in agreement with models of peripheral collisions. For the heavy residues with large ΔA values, the residue linear momenta approach a limiting value which is far below that expected from the ''universal'' systematics of linear momentum transfer in reactions induced by smaller projectiles. Reasons for this limiting behavior are suggested. In the area of relativistic nuclear collisions, complete target fragment mass distributions were measured for the ultrarelativistic reactions of 13.6 GeV/nucleon 16 O and 28 Si with 197 Au. An unexpected finding in this study was the relatively large cross section for the two neutron removal process via electromagnetic dissociation. Similar measurements for the reaction of 1.1 GeV/nucleon 197 Au with 197 Au furnished the first complete fragment mass distribution for that reaction

  10. Magnetic resonance imaging of articular cartilage abnormalities of the far posterior femoral condyle of the knee

    Energy Technology Data Exchange (ETDEWEB)

    Ogino, Shuhei; Huang, Thomas; Watanabe, Atsuya; Iranpour-Boroujeni, Tannaz; Yoshioka, Hiroshi (Dept. of Radiology, Brigham and Women' s Hospital, Boston, MA (United States)), e-mail: hiroshi@uci.edu

    2010-01-15

    Background: Incidental articular cartilage lesions of the far posterior femoral condyle (FPFC) are commonly detected. Whether or not these cartilage lesions are symptomatic or clinically significant is unknown. Purpose: To characterize and assess prevalence of articular cartilage abnormalities of the FPFC and associated bone marrow edema (BME) and/or internal derangements through magnetic resonance (MR) images. Material and Methods: 654 knee MR examinations were reviewed retrospectively. Sagittal fast spin-echo proton density-weighted images with and without fat suppression were acquired with a 1.5T scanner, and were evaluated by two readers by consensus. The following factors were assessed: 1) the prevalence of cartilage abnormalities, 2) laterality, 3) the type of cartilage abnormalities, 4) cartilage abnormality grading, 5) associated BME, 6) complications such as meniscal injury and cruciate ligament injury, and 7) knee alignment (femorotibial angle [FTA]). Results: Articular cartilage abnormalities of the FPFC were demonstrated in 157 of the 654 patients (24%). Of these, 40 patients demonstrated medial and lateral FPFC cartilage abnormalities and were thus counted as 80 cases. Focal lateral FPFC abnormalities were demonstrated in 117 of 197 cases (59.4%), while diffuse lateral FPFC abnormalities were demonstrated in 24 of 197 cases (12.2%). Focal medial FPFC abnormalities were demonstrated in 23 of 197 cases (11.6%), while diffuse medial FPFC abnormalities were demonstrated in 33 of 197 cases (16.8%). No statistically significant pattern of associated BME, FTA, or internal derangements including meniscal and cruciate ligament injury was demonstrated. Conclusion: Articular cartilage abnormalities of the FPFC are common and were demonstrated in 24% of patients or 30% of cases. Lateral FPFC abnormalities occur 2.5 times more frequently than medial FPFC abnormalities and were more frequently focal compared with medial cohorts. BME is associated in 36.5% of cases

  11. [Relationship between interleukin-17A gene polymorphisms and the susceptibility to childhood asthma].

    Science.gov (United States)

    Zhong, Fang-Fang; Zou, Yan; Liu, Chun-Yan; Liu, Wen-Jun

    2016-12-01

    To explore the relationship between polymorphisms of interleukin-17A (IL-17A) gene promoter (-197G/A and -692C/T) and the susceptibility to childhood asthma, to further identify the candidate genes for asthma, and to provide a basis for early prevention of asthma in high-risk children. Sixty-five outpatients or inpatients with childhood asthma between August 2013 and August 2015 were assigned to asthma group. Seventy healthy children within the same period were assigned to control group. Using peripheral venous blood from the two groups, PCR with sequence-specific primers was carried out to determine single nucleotide polymorphisms at positions -197G/A and -692C/T in IL-17A gene promoter. A statistical analysis was used to evaluate differences in genotype and allele frequencies between the two groups. Compared with the control group, the asthma group had significantly higher frequencies of TT genotype (29% vs 16%; P=0.012) and T allele (52% vs 42%; P=0.039) at position -692C/T of IL-17A gene. Children with T allele had 1.413-fold higher risk of childhood asthma than those with C allele (OR=1.413, 95%CI: 1.015-1.917). There were no significant differences in genotype and allele frequencies at position -197G/A in IL-17A gene between the two groups (p>0.05). Polymorphisms at position -692C/T in IL-17A gene promoter is associated with the susceptibility to childhood asthma. Children with -692T allele are more susceptible to childhood asthma. There is no significant relationship between polymorphisms at position -197G/A in IL-17A gene promoter and the susceptibility to childhood asthma.

  12. Seed dormancy is modulated in recently evolved chlorsulfuron-resistant Turkish biotypes of wild mustard (Sinapis arvensis

    Directory of Open Access Journals (Sweden)

    Muhamet eTopuz

    2015-07-01

    Full Text Available Biotypes of the broad-leaved wild mustard (Sinapis arvensis L. found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron, an inhibitor of acetolactate synthase (ALS. DNA sequence analysis of the ALS genes from two such resistant (‘R’ biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197 to TCT (Ser 197 in KNF-R1 and CCT (Pro 197 to ACT (Thr 197 in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the ‘R’ S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis ‘R’ biotypes was revealed in the form of an altered seed dormancy behavior over 4 to 48 months of dry storage (after-ripening compared to the susceptible (‘S’ biotypes. Seeds of the ‘S’ biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the ‘R’ biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months’ of dry storage. The ‘R’ biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of ‘R’ and ‘S’ biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, ‘R’ seeds were significantly heavier than those of the ‘S’ seeds. Differential seed germinability between ‘S’ and ‘R’ biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination.

  13. Direct anti-inflammatory effects of granulocyte colony-stimulating factor (G-CSF) on activation and functional properties of human T cell subpopulations in vitro.

    Science.gov (United States)

    Malashchenko, Vladimir Vladimirovich; Meniailo, Maxsim Evgenievich; Shmarov, Viacheslav Anatolievich; Gazatova, Natalia Dinislamovna; Melashchenko, Olga Borisovna; Goncharov, Andrei Gennadievich; Seledtsova, Galina Victorovna; Seledtsov, Victor Ivanovich

    2018-03-01

    We investigated the direct effects of human granulocyte colony-stimulating factor (G-CSF) on functionality of human T-cell subsets. CD3 + T-lymphocytes were isolated from blood of healthy donors by positive magnetic separation. T cell activation with particles conjugated with antibodies (Abs) to human CD3, CD28 and CD2 molecules increased the proportion of cells expressing G-CSF receptor (G-CSFR, CD114) in all T cell subpopulations studied (CD45RA + /CD197 + naive T cells, CD45RA - /CD197 + central memory T cells, CD45RA - /CD197 - effector memory T cells and CD45RA + /CD197 - terminally differentiated effector T cells). Upon T-cell activation in vitro, G-CSF (10.0 ng/ml) significantly and specifically enhanced the proportion of CD114 + T cells in central memory CD4 + T cell compartment. A dilution series of G-CSF (range, 0.1-10.0 ng/ml) was tested, with no effect on the expression of CD25 (interleukin-2 receptor α-chain) on activated T cells. Meanwhile, G-CSF treatment enhanced the proportion of CD38 + T cells in CD4 + naïve T cell, effector memory T cell and terminally differentiated effector T cell subsets, as well as in CD4 - central memory T cells and terminally differentiated effector T cells. G-CSF did not affect IL-2 production by T cells; relatively low concentrations of G-CSF down-regulated INF-γ production, while high concentrations of this cytokine up-regulated IL-4 production in activated T cells. The data obtained suggests that G-CSF could play a significant role both in preventing the development of excessive and potentially damaging inflammatory reactivity, and in constraining the expansion of potentially cytodestructive T cells. Copyright © 2018 Elsevier Inc. All rights reserved.

  14. Seed dormancy is modulated in recently evolved chlorsulfuron-resistant Turkish biotypes of wild mustard (Sinapis arvensis)

    Science.gov (United States)

    Topuz, Muhamet; Nemli, Yildiz; Fatima, Tahira; Mattoo, Autar

    2015-07-01

    Biotypes of the broad-leaved wild mustard (Sinapis arvensis L.) found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron), an inhibitor of acetolactate synthase (ALS). DNA sequence analysis of the ALS genes from two such resistant (‘R’) biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197) to TCT (Ser 197) in KNF-R1 and CCT (Pro 197) to ACT (Thr 197) in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the ‘R’ S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis ‘R’ biotypes was revealed in the form of an altered seed dormancy behavior over 4 to 48 months of dry storage (after-ripening) compared to the susceptible (‘S’) biotypes. Seeds of the ‘S’ biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the ‘R’ biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months’ of dry storage. The ‘R’ biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of ‘R’ and ‘S’ biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, ‘R’ seeds were significantly heavier than those of the ‘S’ seeds. Differential seed germinability between ‘S’ and ‘R’ biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination.

  15. Study of the odd-${A}$, high-spin isomers in neutron-deficient trans-lead nuclei with ISOLTRAP

    CERN Multimedia

    Herfurth, F; Blaum, K; Beck, D; Kowalska, M; Schwarz, S; Stanja, J; Huyse, M L; Wienholtz, F

    We propose to measure the excitation energy of the $\\frac{13^{+}}{2}$ isomers in the neutron-deficient isotopes $^{193,195,197}$Po with the ISOLTRAP mass spectrometer. The assignment of the low- and high-spin isomers will be made by measuring the energy of the $\\alpha$- particles emitted in the decay of purified beams implanted in a windmill system. Using $\\alpha$-decay information, it is then also possible to determine the excitation energy of the similar isomers in the $\\alpha$-daughter nuclei $^{189,191,193}$Pb, $\\alpha$-parent nuclei $^{197,199,201}$Rn, and $\\alpha$-grand-parent nuclei $^{201,203,205}$Ra. The polonium beams are produced with a UC$_{\\textrm{x}}$ target and using the RILIS.

  16. Temperatures of exploding nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Serfling, V.; Schwarz, C.; Begemann-Blaich, M.; Fritz, S.; Gross, C.; Kleinevoss, U.; Kunze, W.D; Lynen, U.; Mahi, M.; Mueller, W.F.J.; Odeh, T.; Schnittker, M.; Trautmann, W.; Woerner, A.; Xi, H. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Bassini, R.; Iori, I.; Moroni, A.; Petruzzelli, F. [Milan Univ. (Italy). Ist. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Milan (Italy); Gaff, S.J.; Kunde, G.J. [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy]|[Michigan State Univ., East Lansing, MI (United States). National Superconducting Cyclotron Lab.; Imme, G.; Maddalena, V.; Nociforo, C.; Raciti, G.; Riccobene, G.; Romano, F.P.; Saija, A.; Sfienti, C.; Verde, G. [Catania Univ. (Italy). Dipt. di Fisica]|[Istituto Nazionale di Fisica Nucleare, Catania (Italy); Moehlenkamp, T.; Seidel, W. [Forschungszentrum Rossendorf e.V. (FZR), Dresden (Germany); Ocker, B.; Schuettauf, A. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Pochodzalla, J. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Trzcinski, A.; Zwieglinski, B. [Soltan Inst. for Nuclear Studies, Warsaw (Poland)

    1998-01-01

    Breakup temperatures in central collisions of {sup 197}Au+{sup 197}Au at bombarding energies E/A=50 to 200 MeV were determined with two methods. Isotope temperatures, deduced from double ratios of hydrogen, helium, and lithium isotopic yields, increase monotonically with bombarding energy from 5 MeV to 12 MeV, in qualitative agreement with a scenario of chemical freeze-out after adiabatic expansion. Excited-state temperatures, derived from yield ratios of states in {sup 4}He, {sup 5,6}Li, and {sup 8}Be, are about 5 MeV, independent of the projectile energy, and seem to reflect the internal temperature of fragments at their final separation from the system. (orig.)

  17. Neutron removal in peripheral relativistic heavy ion collisions

    International Nuclear Information System (INIS)

    Aumann, T.

    1994-09-01

    We investigate the relativistic Coulomb fragmentation of 197 Au by heavy ions, leading to one-, two- and three-neutron removal. To resolve the ambiguity connected with the choice of a specific minimum impact parameter in a semiclassical calculation, a microscopic approach is developed based on nucleon-nucleon collisions ('soft-spheres' model). This approach is compared with experimental data for 197 Au at 1 GeV/nucleon and with a calculation using the 'sharp-cutoff' approximation. We find that the harmonic-oscillator model predicting a Poisson distribution of the excitation probabilities of multiphonon states gives a good agreement with one-neutron removal cross sections but is unable to reach an equally good agreement with three-neutron removal cross sections. (orig.)

  18. Diphtheria toxin can simultaneously bind to its receptor and adenylyl-(3',5')-uridine 3'-monophosphate

    International Nuclear Information System (INIS)

    Barbieri, J.T.; Collins, C.M.; Collier, R.J.

    1986-01-01

    Diphtheria toxin (DT) that was bound to receptors on BS-C-1 cells was able to bind approximately 1 molar equiv of adenylyl-(3',5')-uridine 3'-monophosphate (ApUp). In contrast, receptor-bound CRM197, a mutant form of toxin with greatly diminished affinity for dinucleotides, did not bind ApUp. Affinity of the dinucleotide for receptor-bound toxin differed from that for free toxin by less than an order of magnitude. These results indicate that the receptor site and the ApUp site on the toxin do not significantly overlap. BS-C-1 cells were incubated with or without 125 I-DT or CRM 197. They were then incubated with [ 32 P]ApUp, and assayed

  19. The ASY-EOS Experiment at GSI

    Directory of Open Access Journals (Sweden)

    Russotto P.

    2016-01-01

    Full Text Available The elliptic-flow ratio of neutrons with respect to protons or light complex particles in reactions of heavy ions at pre-relativistic energies has been proposed as an observable sensitive to the strength of the symmetry term of the nuclear equation of state at supra-saturation densities. In the ASY-EOS experiment at the GSI laboratory, flows of neutrons and light charged particles were measured for 197Au+197Au collisions at 400 MeV/nucleon. Flow results obtained for the Au+Au system, in comparison with predictions of the UrQMD transport model, confirm the moderately soft to linear density dependence of the symmetry energy deduced from the earlier FOPI-LAND data.

  20. Experimental evidence for the reducibility of multifragment emission probabilities

    International Nuclear Information System (INIS)

    Wozniak, G.J.; Tso, K.; Phair, L.

    1995-01-01

    Multifragmentation has been studied for 36 Ar-induced reactions on a 197 Au target at E/A = 80 and 110 MeV and for 129 Xe-induced reactions on several targets ( nat Cu, 89 y, 165 ho, 197 Au) and E/A = 40, 50 and 60 MeV. The probability of emitting n intermediate-mass-fragments is shown to be binomial at each transversal energy and reducible to an elementary binary probability p. For each target and at each bombarding energy, this probability p shows a thermal nature by giving linear Arrhenius plots. For the 129 Xe-induced reactions, a nearly universal linear Arrhenius plot is observed at each bombarding energy, indicating a large degree of target independence

  1. Procedure and apparatus for the determination of the gold content in a material containing gold

    International Nuclear Information System (INIS)

    1980-01-01

    This patent describes a method and apparatus for determining the gold content of materials, and in particular, of rock and stone samples. The procedure is based upon the irradiation of the material with neutrons and the determination of the intensity of the gamma radiation (279 keV) produced in the reaction 197 Au(n,n')sup(197m)Au. The neutron source used produces the neutrons by the deuteron-deuteron or deuteron-beryllium reaction. The energy of these neutrons is not high enough for producing fast neutron reactions in the other elements of the material. The apparatus described separates the samples with a gold content above a certain value by means of the procedure described above. (Th.P.)

  2. Gold internal standard correction for elemental imaging of soft tissue sections by LA-ICP-MS: element distribution in eye microstructures.

    Science.gov (United States)

    Konz, Ioana; Fernández, Beatriz; Fernández, M Luisa; Pereiro, Rosario; González, Héctor; Alvarez, Lydia; Coca-Prados, Miguel; Sanz-Medel, Alfredo

    2013-04-01

    Laser ablation coupled to inductively coupled plasma mass spectrometry has been developed for the elemental imaging of Mg, Fe and Cu distribution in histological tissue sections of fixed eyes, embedded in paraffin, from human donors (cadavers). This work presents the development of a novel internal standard correction methodology based on the deposition of a homogeneous thin gold film on the tissue surface and the use of the (197)Au(+) signal as internal standard. Sample preparation (tissue section thickness) and laser conditions were carefully optimized, and internal normalisation using (197)Au(+) was compared with (13)C(+) correction for imaging applications. (24)Mg(+), (56)Fe(+) and (63)Cu(+) distributions were investigated in histological sections of the anterior segment of the eye (including the iris, ciliary body, cornea and trabecular meshwork) and were shown to be heterogeneously distributed along those tissue structures. Reproducibility was assessed by imaging different human eye sections from the same donor and from ten different eyes from adult normal donors, which showed that similar spatial maps were obtained and therefore demonstrate the analytical potential of using (197)Au(+) as internal standard. The proposed analytical approach could offer a robust tool with great practical interest for clinical studies, e.g. to investigate trace element distribution of metals and their alterations in ocular diseases.

  3. Patterns of binding of aluminum-containing adjuvants to Haemophilus influenzae type b and meningococcal group C conjugate vaccines and components

    Science.gov (United States)

    Otto, Robert B.D.; Burkin, Karena; Amir, Saba Erum; Crane, Dennis T.; Bolgiano, Barbara

    2015-01-01

    The basis of Haemophilus influenzae type b (Hib) and Neisseria meningitidis serogroup C (MenC) glycoconjugates binding to aluminum-containing adjuvants was studied. By measuring the amount of polysaccharide and protein in the non-adsorbed supernatant, the adjuvant, aluminum phosphate, AlPO4, was found to be less efficient than aluminum hydroxide, Al(OH)3 at binding to the conjugates, at concentrations relevant to licensed vaccine formulations and when equimolar. At neutral pH, binding of TT conjugates to AlPO4 was facilitated through the carrier protein, with only weak binding of AlPO4 to CRM197 being observed. There was slightly higher binding of either adjuvant to tetanus toxoid conjugates, than to CRM197 conjugates. This was verified in AlPO4 formulations containing DTwP–Hib, where the adsorption of TT-conjugated Hib was higher than CRM197-conjugated Hib. At neutral pH, the anionic Hib and MenC polysaccharides did not appreciably bind to AlPO4, but did bind to Al(OH)3, due to electrostatic interactions. Phosphate ions reduced the binding of the conjugates to the adjuvants. These patterns of adjuvant adsorption can form the basis for future formulation studies with individual and combination vaccines containing saccharide-protein conjugates. PMID:26194164

  4. Using Emotional Intelligence in Personalized Adaptation

    NARCIS (Netherlands)

    Damjanovic, Violeta; Kravcik, Milos

    2008-01-01

    Damjanovic, V. & Kravcik, M. (2007). Using Emotional Intelligence in Personalized Adaptation. In M. D. Lytras & A. Naeve (Eds.), Ubiquitous and Pervasive Knowledge and Learning Management (pp. 158-197). IGI Publishing.

  5. 77 FR 15012 - Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or on Various...

    Science.gov (United States)

    2012-03-14

    ... could also be affected. The North American Industrial Classification System (NAICS) codes have been..., Parque Tecnol[oacute]gico de Cantanhede, N[uacute]cleo 04, Lote 2, 3060-197 Cantanhede, Portugal...

  6. Contribution of radioisotopes in the diagnosis of lung tumours

    International Nuclear Information System (INIS)

    Raynaud, C.; Crouzel, M.

    1976-01-01

    197 Hg, a radioisotope of half life 65 h, injected as acetate builds up in malignant tumours and evolutive inflammatory lesions. In spite of a high proportion of false positives it can lead to a lung cancer diagnosis under well-defined circumstances such as: round lung images, X-ray tuberculosis images persisting after prolonged therapy, treated cancers where it can detect relapses before X-rays and in the difficult case of benign tumours. In man the uptake kinetics of carrier-free 67 Cu (half-life 58 h), injected as citrate, are apparently not the same in cancers as in evolutive inflammatory lesions. The false positive yield, through much lower than that observed with 197 Hg, is still too high in this preliminary study [fr

  7. Influence of the nuclear symmetry energy on the collective flows of charged pions

    Science.gov (United States)

    Gao, Yuan; Yong, Gao-Chan; Zhang, Lei; Zuo, Wei

    2018-01-01

    Based on the isospin-dependent Boltzmann-Uehling-Uhlenbeck (IBUU) transport model, we studied charged pion transverse and elliptic flows in semicentral 197Au+197Au collisions at 600 MeV/nucleon. It is found that π+-π- differential transverse flow and the difference of π+ and π- transverse flows almost show no effects of the symmetry energy. Their corresponding elliptic flows are largely affected by the symmetry energy, especially at high transverse momenta. The isospin-dependent pion elliptic flow at high transverse momenta thus provides a promising way to probe the high-density behavior of the symmetry energy in heavy-ion collisions at the Facility for Antiproton and Ion Research (FAIR) at GSI, Darmstadt or at the Cooling Storage Ring (CSR) at HIRFL, Lanzhou.

  8. Charge-state distributions of 100, 175, 275, and 352 MeV gold ions emerging from thin carbon foils

    International Nuclear Information System (INIS)

    Martin, J.A.; Auble, R.L.; Erb, K.A.; Jones, C.M.; Olsen, D.K.

    1985-01-01

    These measurements were undertaken as a consequence of our failure early this year to accelerate Au +46 ions in the Oak Ridge Isochronous Cyclotron using an injected beam of 352 MeV 197 Au +17 from the 25 MV tandem accelerator. Following that unsuccessful test, we made a preliminary measurement of the charge-state distribution of 352 MeV 197 Au ions emerging from a carbon foil using the bending magnet that is a part of the cyclotron beam injection system. The measured mean charge was approx.38.5, about 4.5 charge-states lower than predicted by the Sayer semi-empirical formula. The measurements reported here were done more precisely and systematically confirm that preliminary result. 12 refs., 5 figs., 4 tabs

  9. Charge-state distributions of 100, 175, 275, and 352 MeV gold ions emerging from thin carbon foils

    Energy Technology Data Exchange (ETDEWEB)

    Martin, J.A.; Auble, R.L.; Erb, K.A.; Jones, C.M.; Olsen, D.K.

    1985-01-01

    These measurements were undertaken as a consequence of our failure early this year to accelerate Au/sup +46/ ions in the Oak Ridge Isochronous Cyclotron using an injected beam of 352 MeV /sup 197/Au/sup +17/ from the 25 MV tandem accelerator. Following that unsuccessful test, we made a preliminary measurement of the charge-state distribution of 352 MeV /sup 197/Au ions emerging from a carbon foil using the bending magnet that is a part of the cyclotron beam injection system. The measured mean charge was approx.38.5, about 4.5 charge-states lower than predicted by the Sayer semi-empirical formula. The measurements reported here were done more precisely and systematically confirm that preliminary result. 12 refs., 5 figs., 4 tabs.

  10. Stability of FeNO and airway hyperresponsiveness to mannitol in untreated asthmatics

    DEFF Research Database (Denmark)

    Udesen, Pernille Bækgaard; Westergaard, Christian Grabow; Porsbjerg, Celeste

    2017-01-01

    measured, and asthma control was assessed with the Asthma Control Questionnaire (ACQ). RESULTS: A total of 41 subjects completed both visits. Mean (SD) FEV1% at baseline was 94.1% (17.7) and at re-examination 94.6% (19.7) (ns). The ACQ score was unchanged from baseline (Mean (SD): 0.90 (± 0.73)) to follow......-up 0.90 (± 0.74) (ns), as was the FEV1% (94.1% (±17.1%) vs 94.6% (19.7%)(ns) indicating that patients were clinically stable during follow-up. The response to mannitol was unchanged at follow-up (Geometric mean (CI) of Response Dose Ratio (RDR) to mannitol: 0.026(0.013-0.046) vs 0.026(0.012-0.050) (ns...

  11. Double and triple isotope gamma camera studies with energy selection after data collection

    International Nuclear Information System (INIS)

    Soussaline, F.; Raynaud, C.; Kacperek, A.; Kellershohn, C.; Sauce, M.; Zadje, C.

    1974-01-01

    A system comprising a Toshiba camera and a Informatek data processing system has been used to perform multiple isotope studies. A large window (30-550KeV) is used and the data can be manipulated after data collection, to form sets of dynamic frames for various energies. Linear combinations of matrices have been used to correct for scattering. Double isotope studies using 197Hg/198Au have been used to determine Hg renal uptake in man, and are compared to a previous technique requiring two separate data acquisitions. Animal (pig) renal experiments have been performed using 169 Yb/sup(99m)Tc/ 197 Hg. This pilot study gave good results and indicates the utility of the system for multiple isotope function studies in man [fr

  12. System size and beam energy effects on probing the high-density behavior of nuclear symmetry energy with pion ratio

    International Nuclear Information System (INIS)

    Zhang Ming; Xiao Zhigang; Li Baoan; Chen Liewen; Yong Gaochan; Zhu Shengjiang

    2010-01-01

    Based on the isospin-and momentum-dependent hadronic transport model IBUU04, we have investigated the π - /π + ratio in the following three reactions: 48 Ca+ 48 Ca, 124 Sn + 124 Sn and 197 Au + 197 Au with nearly the same isospin asymmetry but different masses, at the bombarding energies from 0.25 to 0.6 AGeV. It is shown that the sensitivity of probing the E sym (ρ) with π - /π + increases with increasing the system size or decreasing the beam energy, showing a correlation to the degree of isospin fractionation. Therefore, with a given isospin asymmetry, heavier system at energies near the pion threshold is preferential to study the behavior of nuclear symmetry energy at supra-saturation densities.

  13. Contribution of radioisotopes in the diagnosis of lung tumours

    Energy Technology Data Exchange (ETDEWEB)

    Raynaud, C; Crouzel, M [CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot

    1976-12-01

    Mercury-197, a radioisotope of half life 65 h, injected as acetate builds up in malignant tumours and evolutive inflammatory lesions. In spite of a high proportion of false positives it can lead to a lung cancer diagnosis under well-defined circumstances such as: round lung images, x-ray tuberculosis images persisting after prolonged therapy, treated cancers where it can detect relapses before X-rays and in the difficult case of benign tumours. In man the uptake kinetics of carrier-free /sup 67/Cu (half-life 58 h), injected as citrate, are apparently not the same in cancers as in evolutive inflammatory lesions. The false positive yield, through much lower than that observed with /sup 197/Hg, is still too high in this preliminary study.

  14. Research Highlights: Helping Adolescents Resist Drugs

    National Research Council Canada - National Science Library

    2000-01-01

    Project ALERT departs boldly from prevention models of the 196Os and 197Os, which emphasized informing adolescents about the long-term consequences of drug use or building their decisionmaking skills...

  15. Wood as the material of carvings and paintings of Bohemian and Moravian provenance in the years 1280–1550. Identification of wood

    Czech Academy of Sciences Publication Activity Database

    Antušková, V.; Vernerová, I.; Chlumská, Š.; Dáňová, Helena; Třeštíková, A.; Šefců, R.

    -, č. 26 (2016), s. 93-111, 197-211 ISSN 0862-8912 Institutional support: RVO:68378033 Keywords : wood * carving * panel painting * Middle Ages * Early Renaissance Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. 40 CFR 421.315 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Tungsten....346 68.543 Tungsten 197.1 87.8 (k) Cobalt hydroxide filter cake wash. PSES for the Secondary Tungsten...

  17. Cancer therapy with alpha-emitters labeled peptides.

    Science.gov (United States)

    Dadachova, Ekaterina

    2010-05-01

    Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.

  18. Selective targeting of tumour neovasculature by a radiohalogenated human antibody fragment specific for the ED-B domain of fibronectin

    International Nuclear Information System (INIS)

    Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.

    2001-01-01

    Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)

  19. Latest Achievements on Climate Change and Forest Interactions in a Polluted Environment

    Czech Academy of Sciences Publication Activity Database

    Carriero, G.; Tuovinen, J.-P.; Clarke, N.; Matteucci, G.; Matyssek, R.; Wieser, G.; Mikkelsen, J. D.; Fischer, R.; Cudlín, Pavel; Serengil, Y.; Boscaleri, F.; Calfapietra, Carlo; Feng, Z.; Paoletti, E.

    2014-01-01

    Roč. 4, č. 3 (2014), s. 197-207 ISSN 2163-0429 Institutional support: RVO:67179843 Keywords : air pollution * climate change * forests * supersites * COST * FP0903 Action Subject RIV: EH - Ecology, Behaviour

  20. Patterns of binding of aluminum-containing adjuvants to Haemophilus influenzae type b and meningococcal group C conjugate vaccines and components.

    Science.gov (United States)

    Otto, Robert B D; Burkin, Karena; Amir, Saba Erum; Crane, Dennis T; Bolgiano, Barbara

    2015-09-01

    The basis of Haemophilus influenzae type b (Hib) and Neisseria meningitidis serogroup C (MenC) glycoconjugates binding to aluminum-containing adjuvants was studied. By measuring the amount of polysaccharide and protein in the non-adsorbed supernatant, the adjuvant, aluminum phosphate, AlPO4, was found to be less efficient than aluminum hydroxide, Al(OH)3 at binding to the conjugates, at concentrations relevant to licensed vaccine formulations and when equimolar. At neutral pH, binding of TT conjugates to AlPO4 was facilitated through the carrier protein, with only weak binding of AlPO4 to CRM197 being observed. There was slightly higher binding of either adjuvant to tetanus toxoid conjugates, than to CRM197 conjugates. This was verified in AlPO4 formulations containing DTwP-Hib, where the adsorption of TT-conjugated Hib was higher than CRM197-conjugated Hib. At neutral pH, the anionic Hib and MenC polysaccharides did not appreciably bind to AlPO4, but did bind to Al(OH)3, due to electrostatic interactions. Phosphate ions reduced the binding of the conjugates to the adjuvants. These patterns of adjuvant adsorption can form the basis for future formulation studies with individual and combination vaccines containing saccharide-protein conjugates. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.

  1. Differential replication of avian influenza H9N2 viruses in human alveolar epithelial A549 cells

    Directory of Open Access Journals (Sweden)

    Peiris Malik

    2010-03-01

    Full Text Available Abstract Avian influenza virus H9N2 isolates cause a mild influenza-like illness in humans. However, the pathogenesis of the H9N2 subtypes in human remains to be investigated. Using a human alveolar epithelial cell line A549 as host, we found that A/Quail/Hong Kong/G1/97 (H9N2/G1, which shares 6 viral "internal genes" with the lethal A/Hong Kong/156/97 (H5N1/97 virus, replicates efficiently whereas other H9N2 viruses, A/Duck/Hong Kong/Y280/97 (H9N2/Y280 and A/Chicken/Hong Kong/G9/97 (H9N2/G9, replicate poorly. Interestingly, we found that there is a difference in the translation of viral protein but not in the infectivity or transcription of viral genes of these H9N2 viruses in the infected cells. This difference may possibly be explained by H9N2/G1 being more efficient on viral protein production in specific cell types. These findings suggest that the H9N2/G1 virus like its counterpart H5N1/97 may be better adapted to the human host and replicates efficiently in human alveolar epithelial cells.

  2. Notes on the physiology of Hg uptake by the kidney

    International Nuclear Information System (INIS)

    Raynaud, C.

    1976-01-01

    The kidney has many functions of which the best known is excretion, and the purpose of most functional exploration methods is to study the excretion capacity. The Hg uptake test explores another function, the uptake of metals and toxic substances. The uptake process involves an active transport through the peritubular membrane and a concentration inside the kidney cell in a bound or insoluble form. Transfer into the tubular lumen, if any, is quantitatively negligible and appears to be due to neither an active nor a passive transfer. This uptake process may be identified in vivo from the shape of the kidney and urine radioactivity curves, even when excretion and uptake are associated, the former curve rising slowly to a plateau while the latter, very low, also appears to reach a plateau. The kidney and urine 197 HgCl 2 radioactivity curves illustrate this process very well. The 197 Hg uptake fraction at the plateau level has been proposed has a kidney function exploration test, this value being related by a highly significant correlation to other quantitative tests such as inuline and PAH clearances, PAH Tm and urine concentration capacity. In rats the 197 HgCl 2 uptake area has been located, by measurements on dissected nephrons, at the pars recta and to a lesser extent the whole of the proximal convolution [fr

  3. Preparation of Silver Immobilised TiO2-Hectorite for Phenol Removal and Eschericia coli Desinfection

    Directory of Open Access Journals (Sweden)

    Is Fatimah

    2013-03-01

    Full Text Available Preparation of silver immobilized TiO2-Hectorite and its application in phenol photooxidation and Eschericia coli bacteria desinfection has been conducted. Material was obtained by two steps of synthesis: preparation of TiO2-Hectorite and silver immobilization into TiO2-Hectorite. Physico-chemical characterization to the prepared material compared to raw hectorite was conducted by X-ray Diffraction, gas sorption analyzer, scanning electron microscope and DRUV-Visible spectrophotometry and for photoactivity study, phenol photooxidation and Eschericia coli desinfection were investigated. The results indicated that the modification to hectorite material improve the physico-chemical character related to its role as photo-catalyst. Kinetic study of phenol photooxidation revealed the role of TiO2 pillarization and silver immobilization in enhancing rate of reaction as well as increased photoactivity of the materials in E. coli desinfection. © 2013 BCREC UNDIP. All rights reservedReceived: 28th September 2012; Revised: 7th December 2012; Accepted: 20th Decemberber 2012[How to Cite: I. Fatimah (2013. Preparation of Silver Immobilised TiO2-Hectorite for Phenol Removal and Eschericia coli Desinfection. Bulletin of Chemical Reaction Engineering & Catalysis, 7 (3: 191-197. (doi:10.9767/bcrec.7.3.4047.191-197][Permalink/DOI: http://dx.doi.org/10.9767/bcrec.7.3.4047.191-197 ] View in  |

  4. North Carolina Statewide Lidar DEM 2015 Phase 3

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Geographic Extent: North Carolina Area of Interest, covering approximately 7,197 square miles. Dataset Description: The North Carolina LiDAR project called for the...

  5. 2015 NCFMP Lidar: Statewide North Carolina (Phase 3)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Geographic Extent: North Carolina Area of Interest, covering approximately 7,197 square miles. Dataset Description: The North Carolina LiDAR project called for the...

  6. Structure of an RNA dimer of a regulatory element from human thymidylate synthase mRNA

    OpenAIRE

    Dibrov, Sergey; McLean, Jaime; Hermann, Thomas

    2011-01-01

    An oligonucleotide representing a regulatory element of human thymidylate synthase mRNA has been crystallized as a dimer. The structure of the asymmetric dimer has been determined at 1.97 Å resolution.

  7. Evaluation of the induction of immune memory following infant immunisation with serogroup C Neisseria meningitidis conjugate vaccines--exploratory analyses within a randomised controlled trial.

    Directory of Open Access Journals (Sweden)

    Ameneh Khatami

    Full Text Available We measured meningococcal serogroup C (MenC-specific memory B-cell responses in infants by Enzyme-Linked Immunospot (ELISpot following different MenC conjugate vaccine schedules to investigate the impact of priming on immune memory.Infants aged 2 months were randomised to receive 1 or 2 doses of MenC-CRM197 at 3 or 3 and 4 months, 1 dose of MenC-TT at 3 months, or no primary MenC doses. All children received a Haemophilus influenzae type b (Hib-MenC booster at 12 months. Blood was drawn at 5, 12, 12 months +6 days and 13 months of age.Results were available for 110, 103, 76 and 44 children from each group respectively. Following primary immunisations, and prior to the 12-month booster, there were no significant differences between 1- or 2-dose primed children in the number of MenC memory B-cells detected. One month following the booster, children primed with 1 dose MenC-TT had more memory B-cells than children primed with either 1-dose (p = 0.001 or 2-dose (p<0.0001 MenC-CRM197. There were no differences in MenC memory B-cells detected in children who received 1 or 2 doses of MenC-CRM197 in infancy and un-primed children.MenC-specific memory B-cell production may be more dependent on the type of primary vaccine used than the number of doses administered. Although the mechanistic differences between MenC-CRM197 and MenC-TT priming are unclear, it is possible that structural differences, including the carrier proteins, may underlie differential interactions with B- and T-cell populations, and thus different effects on various memory B-cell subsets. A MenC-TT/Hib-MenC-TT combination for priming/boosting may offer an advantage in inducing more persistent antibody.EU Clinical Trials Register 2009-016579-31 ClinicalTrials.gov NCT01129518.

  8. Diphtheria toxin- and Pseudomonas A toxin-mediated apoptosis. ADP ribosylation of elongation factor-2 is required for DNA fragmentation and cell lysis and synergy with tumor necrosis factor-alpha.

    Science.gov (United States)

    Morimoto, H; Bonavida, B

    1992-09-15

    We have reported that diphtheria toxin (DTX) mediates target cell lysis and intranucleosomal DNA fragmentation (apoptosis) and also synergizes with TNF-alpha. In this paper, we examined which step in the pathway of DTX-mediated inhibition of protein synthesis was important for induction of cytolytic activity and for synergy. Using a DTX-sensitive tumor cell line, we first examined the activity of the mutant CRM 197, which does not catalyze the ADP ribosylation of elongation factor-2 (EF-2). CRM 197 was not cytolytic for target cells and did not mediate intranucleosomal DNA fragmentation of viable cells. The failure of CRM 197 to mediate target cell lysis suggested that the catalytic activity of DTX is prerequisite for target cell lysis. This was corroborated by demonstrating that MeSAdo, which blocks the biosynthesis of diphthamide, inhibited DTX-mediated protein synthesis inhibition and also blocked target cell lysis. Furthermore, the addition of nicotinamide, which competes with NAD+ on the DTX action site of EF-2, also blocked DTX-mediated lysis. These findings suggest that ADP-ribosylation of EF-2 may be a necessary step in the pathway leading to target cell lysis. In contrast to the sensitive line, the SKOV-3 tumor cell line is sensitive to protein synthesis inhibition by DTX but is not susceptible to cytolysis and apoptosis by DTX. Thus, protein synthesis inhibition by DTX is not sufficient to mediate target cell lysis. The synergy in cytotoxicity obtained with the combination of DTX and TNF-alpha was examined in order to determine the pathway mediated by DTX in synergy. Like the direct lysis by DTX, synergy was significantly reduced by MeSAdo and by nicotinamide. Furthermore, synergy was not observed with combination of CRM 197 and TNF-alpha. These results demonstrate that, in synergy, DTX may utilize the same pathway required for its cytolytic activity. Pseudomonas aeruginosa exotoxin shared most the properties shown for DTX. Altogether, these findings

  9. Vaccine-Elicited Tier 2 HIV-1 Neutralizing Antibodies Bind to Quaternary Epitopes Involving Glycan-Deficient Patches Proximal to the CD4 Binding Site.

    Directory of Open Access Journals (Sweden)

    Ema T Crooks

    2015-05-01

    Full Text Available Eliciting broad tier 2 neutralizing antibodies (nAbs is a major goal of HIV-1 vaccine research. Here we investigated the ability of native, membrane-expressed JR-FL Env trimers to elicit nAbs. Unusually potent nAb titers developed in 2 of 8 rabbits immunized with virus-like particles (VLPs expressing trimers (trimer VLP sera and in 1 of 20 rabbits immunized with DNA expressing native Env trimer, followed by a protein boost (DNA trimer sera. All 3 sera neutralized via quaternary epitopes and exploited natural gaps in the glycan defenses of the second conserved region of JR-FL gp120. Specifically, trimer VLP sera took advantage of the unusual absence of a glycan at residue 197 (present in 98.7% of Envs. Intriguingly, removing the N197 glycan (with no loss of tier 2 phenotype rendered 50% or 16.7% (n = 18 of clade B tier 2 isolates sensitive to the two trimer VLP sera, showing broad neutralization via the surface masked by the N197 glycan. Neutralizing sera targeted epitopes that overlap with the CD4 binding site, consistent with the role of the N197 glycan in a putative "glycan fence" that limits access to this region. A bioinformatics analysis suggested shared features of one of the trimer VLP sera and monoclonal antibody PG9, consistent with its trimer-dependency. The neutralizing DNA trimer serum took advantage of the absence of a glycan at residue 230, also proximal to the CD4 binding site and suggesting an epitope similar to that of monoclonal antibody 8ANC195, albeit lacking tier 2 breadth. Taken together, our data show for the first time that strain-specific holes in the glycan fence can allow the development of tier 2 neutralizing antibodies to native spikes. Moreover, cross-neutralization can occur in the absence of protecting glycan. Overall, our observations provide new insights that may inform the future development of a neutralizing antibody vaccine.

  10. Statistical report of A-bomb survivors detailed health examinations October 197 - March 1976

    International Nuclear Information System (INIS)

    Mori, Hiroyuki; Nakamura, Takeshi; Hosono, Chiharu; Inomata, Mariko; Okajima, Shunzo

    1978-01-01

    The subject was 82,705 persons, and the number of female was larger by about 16,000. The number of cases which were exposed to atomic bomb at places within 2.0 km far from the center of explosion was 476 (212 males and 264 females), and it was 10.2% of the total. With respect to a correlation of each item for general examinations estimated from the statistical values, the mean age of male was 52.9 years old, and correlations of age with the number of erythrocytes, blood sedimentation, and hemoglobin were high. The mean age of female was 53.3 years old, and a correlation of age with the maximum blood pressure was high, while correlations of age, with blood sedimentation, and hemoglobin were not so high. The number of leukocyte was directly proportional to urine sugar only in male. Correlation coefficients between urobilinogen and protein in urine were low in both female and male. A correlation between the maximum blood pressure and the minimum blood pressure was properly high, and the maximum blood pressure in both female and male was directly proportional to age. In female, both the maximum and minimum blood pressures were directly proportional to the number of erythrocytes and hemoglobin. There was the highest correlation between the distance from the center of explosion and the minimum blood pressure in female and male. Factor analysis made on the basis of the above-mentioned correlation matrix demonstrated that the first factor was erythrocyte, and the second factor was blood pressure. (Kanao, N.)

  11. 197 Diagnostic et caractérisation microbiologique des procédés ...

    African Journals Online (AJOL)

    HP

    Les techniques classiques de la microbiologie alimentaire ont été utilisées pour la recherche de chaque ... résultats ont montré la présence d'une contamination croisée dont l'origine peut être diverse (personnel ; ..... Absence. Escherichia coli.

  12. Neutron capture cross section of /sup 197/Au: A standard for stellar nucleosynthesis

    International Nuclear Information System (INIS)

    Ratynski, W.; Kaeppeler, F.

    1988-01-01

    We have measured the neutron capture cross section of gold using the 7 Li(p,n) 7 Be reaction for neutron production. This reaction not only provides the integrated neutron flux via the 7 Be activity of the target, but also allows for the simulation of a Maxwellian neutron energy spectrum at kT = 25 keV. As this spectrum is emitted in a forward cone of 120 0 opening angle, the cross section can be measured in good geometry and independent of any other standard. Systematic uncertainties were studied experimentally in a series of activations. The final stellar cross section at kT = 25 keV was found to be 648 +- 10 mb, and extrapolation to the common s-process temperature kT = 30 keV yields 582 +- 9 mb. This result is used for renormalization of a number of cross sections which had been measured relative to gold

  13. Sexospécificités | Page 197 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In that time, a project to bring the Information Age to villagers in southern India has won awards and given 50 000 "information shop" users in a dozen communities high-speed wireless telephone and Internet access. It has also helped improve more traditional Indian communication methods, such as community newspapers ...

  14. Two-particle correlations in 40Ar + 197Au at 60 MeV/A

    International Nuclear Information System (INIS)

    Quebert, J.

    1986-01-01

    Two-particle correlations have been measured at GANIL with a multidetector array of 21 telescopes (a part of which was set-up in a close-packed geometry). Simultaneously a plastic wall, made of 96 scintillators, set-up at foward angles, was triggered either by coincidence events or single events. The correlation functions R, are measured for different sets of light particles. They are also studied versus collective data given by the plastic wall detection of each event. We deduce different informations concerning the spatial extent of the emitting source, as well as the population of particle unstable states of light nuclei

  15. 2. The Data Librarian: introducing the Data Librarian

    OpenAIRE

    Liscouski, Joe

    1997-01-01

    This paper provides some initial considerations into the design and function of the Data Librarian. The first part (Liscouski, J., 1997, Journal of Automatic Chemistry, 19, 193-197) described the need for the Librarian.

  16. Černá vlajka pirátů znovu nahání strach? Opatření proti pirátství a ozbrojenému lupičství na moři na začátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2009-01-01

    Roč. 8, č. 7 (2009), s. 193-197 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences

  17. Approaches taken by South African advertisers to select and appoint ...

    African Journals Online (AJOL)

    accreditation as a Black Economic Empowerment (BEE) compliant company. The ...... antecedents, and consequences', Journal of the Academy of Marketing Science, 31(2): 109–. 126. .... American Academy of Business, 6(2): 197–207.

  18. Cr1/3Zr2P3O12 with unusual tetrahedral coordination of Cr(III): peculiarities of the formation, thermal stability and application as a pigment

    Czech Academy of Sciences Publication Activity Database

    Gorodylova, N.; Kosinová, V.; Šulcová, P.; Bělina, P.; Vlček, Milan

    2014-01-01

    Roč. 43, č. 41 (2014), s. 15439-15449 ISSN 1477-9226 Institutional support: RVO:61389013 Keywords : magnetic properties * crystal structure * cation distibution Subject RIV: CA - Inorganic Chemistry Impact factor: 4.197, year: 2014

  19. I musei dell'Unione Sovietica / The museums of the Soviet Union

    Directory of Open Access Journals (Sweden)

    Frederick Antal

    2016-12-01

    Full Text Available Il classico è un estratto di un articolo di Frederick Antaldel 1932, Über museen in der Sowjetunion,  apparso solo nel 1973  in «Kritische Berichte», nn. 2-3. La traduzione italiana si trova  in L. Binni, G. Pinna (1980, Museo. Storia e funzioni di una macchina cultrale dal Cinquecento a oggi, Milano: Garzanti, pp. 197-204.   The classis is an excherpt from a paper of Frederick Antal,  Über museen in der Sowjetunion (1932 published in 1973 in «Kritische Berichte», nn. 2-3. The Italian translation is on  L. Binni, G. Pinna (1980, Museo. Storia e funzioni di una macchina cultrale dal Cinquecento a oggi, Milano: Garzanti, pp. 197-204.

  20. Fragmentation in peripheral heavy-ion collisions: from neck emission to spectator decays

    Energy Technology Data Exchange (ETDEWEB)

    Lukasik, J.; Auger, G.; Begemann-Blaich, M.L.; Bellaize, N.; Bittiger, R.; Bocage, F.; Borderie, B.; Bougault, R.; Bouriquet, B.; Charvet, J.L.; Chbihi, A.; Dayras, R.; Durand, D.; Frankland, J.D.; Galichet, E.; Gourio, D.; Guinet, D.; Hudan, S.; Hurst, B.; Lautesse, P.; Lavaud, F.; Le Fevre, A.; Legrain, R.; Lopez, O.; Lynen, U.; Mueller, W.F.J.; Nalpas, L.; Orth, H.; Plagnol, E.; Rosato, E.; Saija, A.; Schwarz, C.; Sfienti, C.; Steckmeyer, J.C.; Tamain, B.; Trautmann, W.; Trzcinski, A.; Turzo, K.; Vient, E.; Vigilante, M.; Volant, C.; Zwieglinski, B.; Botvina, A.S

    2003-07-24

    Invariant cross sections of intermediate mass fragments in peripheral collisions of {sup 197}Au on {sup 197}Au at incident energies between 40 and 150 MeV per nucleon have been measured with the 4{pi} multi-detector INDRA. The maximum of the fragment production is located near mid-rapidity at the lower energies and moves gradually towards the projectile and target rapidities as the energy is increased. Schematic calculations within an extended Goldhaber model suggest that the observed cross section distributions and their evolution with energy are predominantly the result of the clustering requirement for the emerging fragments and of their Coulomb repulsion from the projectile and target residues. The quantitative comparison with transverse energy spectra and fragment charge distributions emphasizes the role of hard scattered nucleons in the fragmentation process.

  1. Energy dissipation in the process of ternary fission in heavy nuclear reaction

    International Nuclear Information System (INIS)

    Li Xian; Wang Chengqian; Yan Shiwei

    2015-01-01

    We studied the evolution of the collective motion, interaction potential, the total kinetic and excitation energies in ternary fissions of 197 Au + 197 Au system at 15 MeV/u, and discussed energy dissipation of this reaction. Through the comparison with energy-angle correlation data in binary fissions, we preliminarily concluded that the rst fission of ternary fission was an extreme deep-inelastic process. We further analyzed the correlation of the total kinetic energy with impact parameters in both binary and ternary reactions, and found that the total energy of binary reactions systems was lost about 150 MeV more than ternary fission with small impact parameters, and with larger impact parameters the total energy of ternary reactions were lost 300 MeV more than binary reactions. (authors)

  2. Tatalina AFS, Alaska. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

    Science.gov (United States)

    1983-03-01

    pecini obseriat ons recorded at scheduled hourly intervals. DAILY OBSERVATIONS • .i, ar tor,, lo nrcwl , I rsa ni tot rcorded on r.tporI i, foruw...03- 5 . 1 51 .8 15.83 4.6 1 i - 06-0 8 16.6 16.61 5.41 .4 1. 1 8 9 11 17.5 17.51 3.2 oli 33.3 7 8 12-14 .6 19.7 19.7 1.8 1.5 1 768 15-17 .9 15.8...22 3 Z’ / 29 j 14 0 26/ 27 I I 26/25 _ _ _ _I o 2/23 4, < 221 21 2.3 _ 17.0 11.29. 17.12. .58 1 146 ’ TAL 2. 701. .7’ 768 __ 788 _ 7P8 El...., (X) Z

  3. Can the nuclear symmetry potential at supra-saturation densities be negative?

    International Nuclear Information System (INIS)

    Yong Gaochan

    2010-01-01

    In the framework of an isospin-dependent Boltzmann-Uehling-Uhlenbeck (IBUU) transport model, for the central 197 Au+ 197 Au reaction at an incident beam energy of 400 MeV/nucleon, the effect of nuclear symmetry potential at supra-saturation densities on the preequilibrium clusters emission is studied. It is found that for the positive symmetry potential at supra-saturation densities the neutron-to-proton ratio of lighter clusters with mass number A≤3[(n/p) A≤3 ] is larger than that of the heavier clusters with mass number A>3[(n/p) A>3 ], whereas for the negative symmetry potential at supra-saturation densities the (n/p) A≤3 is smaller than the (n/p) A>3 . This may be considered as a probe of the negative symmetry potential at supra-saturation densities.

  4. ASY-EOS experiment at GSI

    Directory of Open Access Journals (Sweden)

    Kezzar K.

    2012-07-01

    Full Text Available The elliptic-flow ratio of neutrons with respect to protons in reactions of neutron rich Heavy-Ion at intermediate energies has been recently proposed as an observable sensitive to the strength of the symmetry term in the nuclear equation of state (EOS at supra-saturation densities. The recent results obtained from the existing FOPI/LAND data for 197Au+197Au collisions at 400 MeV/nucleon in comparison with the UrQMD model allowed a first estimate of the symmetry term of the EOS but suffer from a considerable statistical uncertainty. In order to obtain an improved data set for Au+Au collisions and to extend the study to other systems, a new experiment was carried out at the GSI laboratory by the ASY-EOS collaboration in May 2011.

  5. VizieR Online Data Catalog: CGS. V. Statistical study of bars and buckled bars (Li+, 2017)

    Science.gov (United States)

    Li, Z.-Y.; Ho, L. C.; Barth, A. J.

    2018-04-01

    Images in B-, V-, R-, and I-band filters were taken with the du Pont 2.5m telescope at Las Campanas Observatory, with a field of view (FOV) of 8.9'x8.9'. The typical depths of the B-, V-, R-, and I-band images are 27.5, 26.9, 26.4, and 25.3mag/arcsec2, respectively. More information about the Carnegie-Irvine Galaxy Survey (CGS) design, data reduction, and photometric measurements can be found in Papers I (Ho+, 2011, J/ApJS/197/21) and II (Li+, 2011, J/ApJS/197/22). In this work, we use the CGS I-band images to minimize the effect of dust extinction. The selected sample contains 376 disk galaxies with 264 disks hosting bars. (1 data file).

  6. A neutronics feasibility study for the LEU conversion of Poland's Maria research reactor

    International Nuclear Information System (INIS)

    Bretscher, M. M.

    1998-01-01

    The MARIA reactor is a high-flux multipurpose research reactor which is water-cooled and moderated with both beryllium and water. Standard HEU (80% 235 U)fuel assemblies consist of six concentric fuel tubes of a U-Al alloy clad in aluminum. Although the inventory of HEU (80%) fuel is nearly exhausted, a supply of highly-loaded 36%-enriched fuel assemblies is available at the reactor site. Neutronic equilibrium studies have been made to determine the relative performance of fuels with enrichments of 80%, 36% and 19.7%. These studies indicate that LEU (19.7%) densities of about 2.5 gU/cm 3 and 3.8 gU/cm 3 are required to match the performance of the MARIA reactor with 80%-enriched and with 36%-enriched fuels, respectively

  7. Design considerations for post accident monitoring system of a research reactor

    International Nuclear Information System (INIS)

    Jang, Gwi Sook; Park, Je Yun; Kim, Young Ki

    2012-01-01

    The Post Accident Monitoring System (PAMS) provides primary information for operators to assess the plant conditions and perform their role in bringing the plant to a safe condition during an accident. The PAMS of NPP (Nuclear Power Plant) in KOREA provides the continuous display of the PAM category 1 parameters specified in R.G 1.97, Rev. 03. Recently the PAMS of NPP has been designed according to R.G 1.97, Rev. 04. There is no PAMS at the HANARO in KOREA, but recently RRs (Research Reactors) around the world are going to have PAMS for various multi purposes. We should determine the design considerations for PAMS in a Korean RR based on the design state analysis. Thus, this paper proposes strategies on the design considerations for the PAMS of a Korean RR

  8. Systematic study of the π-/π+ ratio in heavy-ion collisions with the same neutron/proton ratio but different masses

    International Nuclear Information System (INIS)

    Zhang Ming; Xiao Zhigang; Zhu Shengjiang; Li Baoan; Chen Liewen; Yong Gaochan

    2009-01-01

    A systematic study of the π - /π + ratio in heavy-ion collisions with the same neutron/proton ratio but different masses can help single out effects of the nuclear mean field on pion production. Based on simulations using the IBUU04 transport model, it is found that the π - /π + ratio in head-on collisions of 48 Ca+ 48 Ca, 124 Sn+ 124 Sn, and 197 Au+ 197 Au at beam energies from 0.25 to 0.6 GeV/nucleon increases with increasing the system size or decreasing the beam energies. A comprehensive analysis of the dynamical isospin fractionation and the π - /π + ratio as well as their time evolution and spatial distributions demonstrates clearly that the π - /π + ratio is an effective probe of the high-density behavior of the nuclear symmetry energy.

  9. Layered inorganic solids

    Czech Academy of Sciences Publication Activity Database

    Čejka, Jiří; Morris, R. E.; Nachtigall, P.; Roth, Wieslaw Jerzy

    2014-01-01

    Roč. 43, č. 27 (2014), s. 10274-10275 ISSN 1477-9226 Institutional support: RVO:61388955 Keywords : layered inorganic solids * physical chemistry * catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.197, year: 2014

  10. TDM-pumped RFA Assisted Transmission of 20x10 GE Channels over 364 km in a Three Span Link

    Czech Academy of Sciences Publication Activity Database

    Karásek, Miroslav; Vojtěch, M.; Radil, J.

    2010-01-01

    Roč. 31, č. 4 (2010), s. 194-197 ISSN 0173-4911 Institutional research plan: CEZ:AV0Z20670512 Keywords : Distributed Raman amplification * Long fiber * Fiber spans Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  11. Die Benennungen und Klassifikation der Hautkrankheiten im Mittelalter

    Czech Academy of Sciences Publication Activity Database

    Florianová, Hana

    -, č. 71 (2013), s. 197-207 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval medicine * medieval medical terminology * medieval Latin lexicography Subject RIV: AI - Linguistics

  12. Search Results | Page 9 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 81 - 90 of 197 ... Telework and the Disabled (Latin America) ... (ICTs) have opened up many opportunities for people with disabilities, such as building solidarity, ... Partnership in Opportunities for Employment through Technologies in the ...

  13. Search Results | Page 3 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 21 - 30 of 197 ... Mozambique Science, Technology and Innovation Review ... Pervasive Technologies: Access to Knowledge (A2K)in the Marketplace ... Better understanding Open Access of scholarly research will help determine how it ...

  14. Geoarcheologický záznam středního a mladého paleolitu v jeskyni Kůlně, Moravský kras

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Neruda, P.; Nerudová, Z.; Bajer, A.

    2013-01-01

    Roč. 98, č. 2 (2013), s. 197-214 ISSN 0323-0570 Institutional support: RVO:67985831 Keywords : Middle and Upper Palaeolithic * Kůlna cave * cave deposits * formation processes * micromorphology Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. 2010 U.S. Geological Survey (USGS) Topographic Lidar: Channel Islands, California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected LiDAR for 197 square miles covering five islands off the coast of Los Angeles, California. These islands are part of the Channel Islands...

  16. Visualization of carbon nanotubes dispersion in composite by using confocal laser scanning microscopy

    Czech Academy of Sciences Publication Activity Database

    Ilčíková, M.; Danko, M.; Doroshenko, M.; Best, A.; Mrlík, M.; Csomorová, K.; Šlouf, Miroslav; Chorvát Jr., D.; Koynov, K.; Mosnáček, J.

    2016-01-01

    Roč. 79, June (2016), s. 187-197 ISSN 0014-3057 Institutional support: RVO:61389013 Keywords : confocal laser scanning microscopy * composites * carbon nanotubes dispersion Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.531, year: 2016

  17. Humoral immune response and spreading of Encephalitozoon cuniculi infection in experimentally infected ponies

    Czech Academy of Sciences Publication Activity Database

    Wagnerová, Pavla; Sak, Bohumil; Květoňová, Dana; Maršálek, M.; Langerová, I.; Kváč, Martin

    2013-01-01

    Roč. 197, 1-2 (2013), s. 1-6 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Ponies * Encephalitozoon cuniculi genotype II * PCR * Antibodies * Experimental infection Subject RIV: EC - Immunology Impact factor: 2.545, year: 2013

  18. OGLE-IV Transient Search report 31 December 2016, part 1

    Science.gov (United States)

    Wyrzykowski, L.; Hamanowicz, A.; Kostrzewa-Rutkowska, Z.; Klencki, J.; Sitek, M.; Udalski, A.; Kozlowski, S.; Ulaczyk, K.; Soszynski, I.; Mroz, P.; Szymanski, M. K.; Poleski, R.; Pietrukowicz, P.; Pawlak, M.; Skowron, J.

    2016-12-01

    The OGLE-IV Transient Detection System (Wyrzykowski et al. 2014, AcA,64,197; Kozlowski et al. 2013; Klencki et al. 2016, AcA, 66,15) announces discovery of 52 transients discovered in last three months.

  19. OGLE-IV Transient Search report 31 December 2016, part 2

    Science.gov (United States)

    Wyrzykowski, L.; Hamanowicz, A.; Kostrzewa-Rutkowska, Z.; Klencki, J.; Sitek, M.; Udalski, A.; Kozlowski, S.; Ulaczyk, K.; Soszynski, I.; Mroz, P.; Szymanski, M. K.; Poleski, R.; Pietrukowicz, P.; Pawlak, M.; Skowron, J.

    2016-12-01

    The OGLE-IV Transient Detection System (Wyrzykowski et al. 2014, AcA,64,197; Kozlowski et al. 2013; Klencki et al. 2016, AcA, 66,15) announces discovery of 46 transients discovered in last three months.

  20. "Nemělo to obličeje. Byla to věc." K napětí mezi člověkem a věcmi v prozaické tvorbě české avantgardy počátku 20. let

    Czech Academy of Sciences Publication Activity Database

    Malá, Zuzana

    2011-01-01

    Roč. 59, č. 2 (2011), s. 175-197 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Avant-garde fiction * 20th century Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor

    Czech Academy of Sciences Publication Activity Database

    Boubakri, H.; Seghezzi, N.; Duchateau, M.; Gominet, M.; Kofroňová, Olga; Benada, Oldřich; Mazodier, P.; Pernodet, J.-L.

    2015-01-01

    Roč. 197, č. 21 (2015), s. 3388-3399 ISSN 0021-9193 Institutional support: RVO:61388971 Keywords : PROTEASOMAL ATPASE HOMOLOG * MYCOBACTERIUM-TUBERCULOSIS * 20S PROTEASOME Subject RIV: EE - Microbiology, Virology Impact factor: 3.198, year: 2015

  2. Nové velké laserové projekty Evropské unie v ČR

    Czech Academy of Sciences Publication Activity Database

    Rohlena, Karel

    2010-01-01

    Roč. 60, č. 4 (2010), 197-198 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10100523 Keywords : diode pumped solid state lasers * repetative regime * high average power Subject RIV: BH - Optics, Masers, Lasers

  3. Vliv předozáření na některé biochemické parametry maligních nádorů mléčné žlázy: receptory steroidních hormonů

    Czech Academy of Sciences Publication Activity Database

    Lang, B.A.; Černoch, M.; Šimíčková, M.; Nekulová, M.; Forbelská, M.; Pecen, Ladislav; Eben, Kryštof; Vondráček, Jiří; Pačovský, Z.; Vermousek, I.

    2001-01-01

    Roč. 14, č. 6 (2001), s. 197-201 ISSN 0862-495X Institutional research plan: AV0Z1030915 Keywords : breast cancer * estrogen-receptor * progesteron-receptor * radiotherapy * cancer cell * ionizing radiation Subject RIV: BA - General Mathematics

  4. CPAP Tips

    Medline Plus

    Full Text Available ... Published on Dec 12, 2012 Do you have sleep apnea and use a continuous positive airway pressure ( ... 29 Airing: The world's first micro- CPAP for sleep apnea - Duration: 4:26. Airing 461,197 views ...

  5. Synthesis of Diphenylamine Catalyzed by Zeolites

    Czech Academy of Sciences Publication Activity Database

    Hronec, M.; Cvengrošová, Z.; Čejka, Jiří

    2003-01-01

    Roč. 255, - (2003), s. 197-202 ISSN 0926-860X Institutional research plan: CEZ:AV0Z4040901 Keywords : zeolites beta * bentonite * Bronsted site Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

  6. Sociolinguistic Bibliography of European Countries for 2009: CZ

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr

    2011-01-01

    Roč. 25, - (2011), s. 190-197 ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistics * bibliography * Czech Republic Subject RIV: AI - Linguistics

  7. The Representation of Vowel Duration in Civili Dictionaries*

    African Journals Online (AJOL)

    Riette Ruthven

    Lexikos 19 (AFRILEX-reeks/series 19: 2009): 197-206 .... means of three perception tests administered to 68 mother-tongue listeners. The 100 prepared ... The outcome of this experimental study showed a definite consistency in minimal pairs ...

  8. Unmarried mothers in pre-industrial Bohemian rural society – example of the Šťáhlavy domain 1741–1830

    Czech Academy of Sciences Publication Activity Database

    Velková, Alice

    2016-01-01

    Roč. 40, č. 2 (2016), s. 179-197 ISSN 0323-0937 R&D Projects: GA ČR GA15-02196S Institutional support: RVO:67985963 Keywords : illegitimate children * rural society * materhood * marriage Subject RIV: AB - History

  9. Airway Science curriculum demonstration project : summary of initial evaluation findings.

    Science.gov (United States)

    1988-10-01

    The performance, perceptions, and characteristics of Airway Science hires were compared with those of traditional hires. As of May 12, 1987. a total of 197 Airway Science candidates had been selected into FAA occupations. The demographic characterist...

  10. Decrease of Pseudomonas aeruginosa biofilm formation by food waste materials

    Czech Academy of Sciences Publication Activity Database

    Maděrová, Z.; Horská, K.; Kim, S.-R.; Lee, Ch.-H.; Pospíšková, K.; Šafaříková, Miroslava; Šafařík, Ivo

    2016-01-01

    Roč. 73, č. 9 (2016), s. 2143-2149 ISSN 0273-1223 Institutional support: RVO:60077344 Keywords : biofilm * food waste materials * magnetic spent grain * Pseudomonas aeruginosa Subject RIV: EI - Biotechnology ; Bionics Impact factor: 1.197, year: 2016

  11. Experiment list: SRX142525 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Cruz Biotech || antibody vendorid=sc-197 || control=Control_50bp || control description=This data represents a control being...on=Immortal cells || control=Control_50bp || control description=This data represents a control being compar

  12. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

  13. Measurement of thermal neutron cross-section and resonance integral for the 165Ho(n,γ) 166gHo reaction using electron linac-based neutron source

    Science.gov (United States)

    Nguyen, Van Do; Pham, Duc Khue; Kim, Tien Thanh; Kim, Guinyun; Lee, Manwoo; Kim, Kyung Sook; Kang, Heung-Sik; Cho, Moo-Hyun; Ko, In Soo; Namkung, Won

    2011-01-01

    The thermal neutron cross-section and the resonance integral of the 165Ho(n,γ) 166gHo reaction have been measured by the activation method using a 197Au(n,γ) 198Au monitor reaction as a single comparator. The high-purity natural Ho and Au foils with and without a cadmium shield case of 0.5 mm thickness were irradiated in a neutron field of the Pohang neutron facility. The induced activities in the activated foils were measured with a calibrated p-type high-purity Ge detector. The correction factors for the γ-ray attenuation ( Fg), the thermal neutron self-shielding ( Gth), the resonance neutron self-shielding ( Gepi) effects, and the epithermal neutron spectrum shape factor ( α) were taken into account. The thermal neutron cross-section for the 165Ho(n,γ) 166gHo reaction has been determined to be 59.7 ± 2.5 barn, relative to the reference value of 98.65 ± 0.09 barn for the 197Au(n,γ) 198Au reaction. By assuming the cadmium cut-off energy of 0.55 eV, the resonance integral for the 165Ho(n,γ) 166gHo reaction is 671 ± 47 barn, which is determined relative to the reference value of 1550 ± 28 barn for the 197Au(n,γ) 198Au reaction. The present results are, in general, good agreement with most of the previously reported data within uncertainty limits.

  14. Total System Performance Assessment - Analyses for Disposal of Commercial and DOE Waste Inventories at Yucca Mountain - Input to Final Environmental Impact Statement and Site Suitability Evaluation, Rev. 00

    International Nuclear Information System (INIS)

    NA

    2001-01-01

    This Letter Report presents the results of calculations to assess long-term performance of commercial spent nuclear fuel (CSNF), U.S. Department of Energy (DOE) spent nuclear fuel (DSNF), high-level radioactive waste (HLW), and Greater Than Class C (GTCC) radioactive waste and DOE Special Performance Assessment Required (SPAR) radioactive waste at the potential Yucca Mountain repository in Nye County Nevada with respect to the 10,000-year performance period specified in 40 CFR Part 197.30 (66 FR 32074 [DIRS 155216], p. 32134) with regard to radiation-protection standards. The EPA Final Rule 40 CFR Part 197 has three separate standards, individual-protection, human-intrusion, and groundwater-protection standards, all with a compliance timeframe of 10,000 years. These calculations evaluate the dose to receptors for each of these standards. Further, this Letter Report includes the results of simulations to the 1,000,000-year performance period described in 40 CFR Part 197.35 (66 FR 32074 [DIRS 155216], p. 32135) which calls for the calculation of the peak dose to the Reasonably Maximally Exposed Individual (RMEI) that would occur after 10,000 years and within the period of geological stability. In accordance with TSPA-SR the ''period of geologic stability'' is from zero to 1,000,000 years after repository closure. The calculations also present the 5th and 95th percentiles, and the mean and median of the set of probabilistic simulations used to evaluate various disposal scenarios

  15. preservative activities parkia biglobosa ervative activities of aqueous

    African Journals Online (AJOL)

    userpc

    The general idea of preserving food is to incre its shelf life ... volatile oil and resinous matter (David, 197. Development in ... extracts of P. biglobosa as plant based food preservatives with. ,Preservative ..... activity of essential oils obtained from.

  16. Going to Tchepone: Oplan El Paso

    National Research Council Canada - National Science Library

    Collins, John

    1998-01-01

    The Ho Chi Minh Trail, which linked North and South Vietnam via the Laotian panhandle, was an indispensable source of supplies for communist forces operating below the 17th parallel in the 1960s and early 197Os...

  17. Development and Optimization of a Positron Annihilation Lifetime Spectrometer to Measure Nanoscale Defects in Solids and Borane Cage Molecules in Aqueous Nitrate Solutions

    National Research Council Canada - National Science Library

    Ross, Matthew A

    2008-01-01

    .... The timing resolution of the optimized system is 197 +or- 14 ps as measured with a known (60)Co source. A single-crystal tungsten sample was used to confirm the system calibration resulting in a lifetime of 101...

  18. Analysis of material effect in molten fuel-coolant interaction, comparison of thermodynamic calculations and experimental observations

    Czech Academy of Sciences Publication Activity Database

    Tyrpekl, Václav; Piluso, P.

    2012-01-01

    Roč. 46, AUGUST (2012), s. 197-203 ISSN 0306-4549 Institutional support: RVO:61388980 Keywords : Nuclear reactor severe accident * Fuel -Coolant Interaction * Material effect * Steam explosion Subject RIV: CA - Inorganic Chemistry Impact factor: 0.800, year: 2012

  19. Influe and nce of polysa f plant acchar Pe growt ride pr elargon h ...

    African Journals Online (AJOL)

    SAM

    De. Pelargonium formulation propagation compounds seedlings a achieved in with 50 mg/ .... cal active shoots of ures was lemented nsible for d of sub- nopurine on of the ...... somatic embryogenesis of Daucus carota L. Planta 197: 135-141.

  20. Antibody recognizing 4-sulfated chondroitin sulfate proteoglycans restores memory in tauopathy-induced neurodegeneration

    Czech Academy of Sciences Publication Activity Database

    Yang, S.; Hilton, S.; Alves, J.N.; Saksida, L.M.; Bussey, T.; Matthews, R.T.; Kitagawa, H.; Spillantini, M.G.; Kwok, Jessica; Fawcett, James

    2017-01-01

    Roč. 59, nov (2017), s. 197-209 ISSN 0197-4580 Institutional support: RVO:68378041 Keywords : perineuronal nets * CSPGs * object recognition memory Subject RIV: FH - Neurology OBOR OECD: Neuroscience s (including psychophysiology Impact factor: 5.117, year: 2016