International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
Carrier-free 194Ir from an 194Os/194Ir generator - a new candidate for radioimmunotherapy
International Nuclear Information System (INIS)
Mirzadeh, S.; Rice, D.E.; Knapp, F.F. Jr.
1992-01-01
Iridium-194 (t 1/2 = 19.15 h) decays by beta-particle emission (E max = 2.236 MeV) and is a potential candidate for radioimmunotherapy. An important characteristic is availability of 194 Ir from decay of reactor-produced 194 Os (t 1/2 = 6y). We report the fabrication of the first 194 Os/ 194 Ir generator system using activated carbon. In addition, a novel gas thermochromatographic method was developed for the one step conversion of metallic Os to OsO 4 and subsequent separation and purification of OsO 4 . In this manner, the reactor irradiated enriched 192 Os target was converted to 194 OsO 4 , which was then converted to the K 2 OsCl 6 for generator loading. The yield and the elution profile of carrier-free 194 Ir, and 194 Os breakthrough were determined for a prototype generator which was evaluated over a 10-month period. (author)
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Catsup. 155.194 Section 155.194 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED VEGETABLES Requirements for Specific Standardized Canned Vegetables § 155.194 Catsup. (a...
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Monitoring. 194.42 Section 194.42... § 194.42 Monitoring. (a) The Department shall conduct an analysis of the effects of disposal system...-closure and post-closure monitoring required pursuant to paragraphs (c) and (d) of this section. The...
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Peer review. 194.27 Section 194.27... § 194.27 Peer review. (a) Any compliance application shall include documentation of peer review that has... barrier evaluation as required in § 194.44. (b) Peer review processes required in paragraph (a) of this...
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
46 CFR 194.10-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 194.10-1 Section 194.10-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-1 Application. (a) The provisions...
2010-10-01
... National Contingency Plan (40 CFR part 300). Onshore oil pipeline facilities means new and existing pipe... 49 Transportation 3 2010-10-01 2010-10-01 false Definitions. 194.5 Section 194.5 Transportation... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY RESPONSE PLANS FOR ONSHORE OIL PIPELINES...
40 CFR 194.46 - Removal of waste.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Removal of waste. 194.46 Section 194... PROGRAMS CRITERIA FOR THE CERTIFICATION AND RE-CERTIFICATION OF THE WASTE ISOLATION PILOT PLANT'S... Assurance Requirements § 194.46 Removal of waste. Any compliance application shall include documentation...
46 CFR 194.10-30 - Magazine sprinklers.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine sprinklers. 194.10-30 Section 194.10-30..., USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-30 Magazine sprinklers... shall be installed in each magazine or magazine group. The control valve shall generally be in...
46 CFR 194.15-11 - Flushing systems.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Flushing systems. 194.15-11 Section 194.15-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE... § 194.15-11 Flushing systems. (a) Working spaces in which chemical stores are used shall be equipped...
46 CFR 194.15-7 - Fire protection.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Fire protection. 194.15-7 Section 194.15-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE... § 194.15-7 Fire protection. (a) If a fixed or semiportable fire-fighting system is installed, it shall...
46 CFR 194.10-25 - Ventilation.
2010-10-01
... magazines. (1) All integral magazines shall be provided with natural or mechanical ventilation. Design... vans shall be provided with natural ventilation sufficient to maintain the inside air temperature below... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation. 194.10-25 Section 194.10-25 Shipping COAST...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
46 CFR 194.10-5 - Type and location.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Type and location. 194.10-5 Section 194.10-5 Shipping..., AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-5 Type and location. (a.... (b) Magazine vans. (1) Magazine vans may be installed on deck in a location protected from boarding...
46 CFR 194.20-7 - Fire protection.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Fire protection. 194.20-7 Section 194.20-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE... Fire protection. (a) Each chemical storeroom shall be protected by a fixed automatic carbon dioxide...
49 CFR 173.194 - Gas identification sets.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Gas identification sets. 173.194 Section 173.194... Gas identification sets. Gas identification sets containing poisonous material must be packaged in... silical gel, gas identification sets may be shipped as follows: (1) If the poisonous material does not...
46 CFR 194.20-11 - Flushing systems.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Flushing systems. 194.20-11 Section 194.20-11 Shipping... Flushing systems. (a) Provision shall be made for flushing away chemical spills. (b) If a drainage system is installed, it shall be separate from any other drainage system. ...
Studies of {sup 194,195,197}Po
Energy Technology Data Exchange (ETDEWEB)
Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others
1995-08-01
The energy systematics of low-lying polonium states show sudden changes near N = 114. The observed drops in the low-lying levels of {sup 196,198}Po relative to the heavier isotopes indicate significant changes in the underlying structure of these nuclei. It is thought that this change is due to the onset of vibrational collectivity brought about by the quadrupole interaction between neutron and proton-pairs. In order to extend the Po systematics even further, we measured, for the first time, states in {sup 194,195,197}Po using the {sup 28}Si + {sup 170}Yb reaction at a beam energy of 142 MeV. The beam was supplied by ATLAS, and the data were taken with 10 Compton-suppressed Ge detectors placed at the target position of the Fragment Mass Analyzer. Preliminary level schemes were constructed for {sup 194,195,197}Po based on {gamma}-{gamma} and {gamma}-FMA coincidences. The results for {sup 194}Po show that the 2{sup +} - 0{sup +} transition energy decreased in energy by 140 keV relative to {sup 196}Po suggesting that this nucleus moved beyond the vibrational limit to more collective motion. An extrapolation of the systematics predicts that the 2{sup +} energy could drop another 140 keV between {sup 194}Po and {sup 192}Po which would indicate the onset of rotational motion. Currently, we have an approved experiment to investigate the decay of yrast isomers in {sup 194}Po which will allow us to (1) confirm our earlier level scheme of {sup 194}Po, and (2) assess the experimental conditions needed for a future study of {sup 192}Po.
40 CFR 194.23 - Models and computer codes.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Models and computer codes. 194.23... General Requirements § 194.23 Models and computer codes. (a) Any compliance application shall include: (1... obtain stable solutions; (iv) Computer models accurately implement the numerical models; i.e., computer...
13 CFR 120.194 - Use of computer forms.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Use of computer forms. 120.194... Applying to All Business Loans Computerized Sba Forms § 120.194 Use of computer forms. Any Applicant or Participant may use computer generated SBA application forms, closing forms, and other forms designated by SBA...
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
International Nuclear Information System (INIS)
Cleveland, W.E.; Zganjar, E.F.
1976-01-01
The decay of 194 Ir has been thoroughly studied resulting in the construction of a decay scheme consisting of 26 excited states and 69 transitions. Nine new levels and 29 new transitions were added to the previously known scheme. Of these, levels at 1,893.6 and 2,053.0 keV as well as 9 γ-ray transitions are new to the 194 Pt level scheme. Precise γ-ray energy and intensity measurements as well as quantitative coincidence measurements were performed, and the internal conversion spectrum was investigated with a Si(Li) detector. Directional correlation measurements were performed for selected cascades with the major result being the unique assignment of 0 + to the new level at 1,893.6 keV. The structure was interpreted within the framework of the PPQ model as well as the effective-core picture including nuclear triaxiality. (orig.) [de
41 CFR 102-194.5 - What is the Standard and Optional Forms Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Standard and Optional Forms Management Program? 102-194.5 Section 102-194.5 Public Contracts and Property Management... PROGRAMS 194-STANDARD AND OPTIONAL FORMS MANAGEMENT PROGRAM § 102-194.5 What is the Standard and Optional...
49 CFR 176.194 - Stowage of Class 1 (explosive) materials on magazine vessels.
2010-10-01
... magazine vessels. 176.194 Section 176.194 Transportation Other Regulations Relating to Transportation... REGULATIONS CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Magazine Vessels § 176.194 Stowage of Class 1 (explosive) materials on magazine vessels. (a) General. The requirements of...
42 CFR 84.194 - Filters used with chemical cartridges; location; replacement.
2010-10-01
...; replacement. 84.194 Section 84.194 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN...; replacement. (a) Particulate matter filters used in conjunction with a chemical cartridge shall be located on... replacement on the cartridge. ...
40 CFR 194.24 - Waste characterization.
2010-07-01
... other information and methods. (b) The Department shall submit in the compliance certification... proposed for disposal in the disposal system, WIPP complies with the numeric requirements of § 194.34 and... release. (2) Identify and describe the method(s) used to quantify the limits of waste components...
40 CFR 194.22 - Quality assurance.
2010-07-01
... General Requirements § 194.22 Quality assurance. (a)(1) As soon as practicable after April 9, 1996, the Department shall adhere to a quality assurance program that implements the requirements of ASME NQA-1-1989... elicitation used to support applications for certification or re-certification of compliance; (vi) Design of...
Oblate deformation and intruder configuration in 194,195Bi
International Nuclear Information System (INIS)
Mukherjee, G.; Banerjee, K.; Banerjee, S.R.; Basu, S.K.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharya, Srijit; Bhattacharjee, T.; Chanda, S.; Dey, A.; Gupta, D.; Meena, J.K.; Mukhopadhyay, S.; Rana, T.K.; Bhattacharya, Sudeb; Ganguly, S.; Goswami, A.; Kshetri, R.; Pradhan, M.K.; Raut, R.; Dey, G.
2006-01-01
The experimental information on 194,195 Bi are very scarce compared to its neighbouring isotopes. Only 6 levels above the ground state band of 195 Bi, based on 9/2, are known with tentative spin parity assignments. Only two low energy gamma rays above the 10 isomeric state are known in 194 Bi. It is interesting not only to extend the presently known bands to higher spins, beyond band crossing but also to search for the intruder quasiparticle configurations to get a clear idea about the structure of these nuclei
New features of superdeformed bands in 194Hg
International Nuclear Information System (INIS)
Janssens, R.V.F.; Ahmad, I.; Carpenter, M.P.
1995-01-01
A striking difference between superdeformed (SD) nuclei near A = 190 and those in the other regions is the behavior of the dynamic moment of inertia (lm) with the rotational frequency hω. While the (lm) patterns of the SD bands near A = 130 and A = 150 show pronounced variations, the majority of the SD bands near A = 190 display the same large, smooth increase of (lm) within the frequency range 0.15 194 Hg were populated with the reaction 150 Nd( 48 Ca,4n) 194 Hg at a beam energy of 206 MeV. The gamma rays emitted in the reaction were detected with the Gammasphere detector array (32 detectors for this experiment)
Phenotype-gene: 194 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available uence of brassinosteroid for AT1G12840 ... decreased sensitivity toward under influence... 194 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1192i decreased sensitivity toward under infl
Decay from the superdeformed bands in 194Hg
International Nuclear Information System (INIS)
Henry, R.G.; Khoo, T.L.; Carpenter, M.P.
1995-01-01
Superdeformed bands in 194 H g were studied using the early implementation of Gammasphere. The response functions for the Ge detectors were measured for the first time as part of this experiment. Experiments were performed with both a backed target (where the residue stopped in the Au backing) and a thin target (where the residue recoiled into vacuum). This will permit measurements of the decay times of the quasicontinuum γrays. The spectrum in coincidence with the yrast SD band in 194 Hg reveals the same features as found in the quasicontinuum structure in 192 Hg. These features include: statistical γrays feeding the SD band, a pronounced E2 peak from transitions feeding the SD band, a Ml/E2 bump at low energies that is associated with the last stages of feeding of the superdeformed band, and a quasicontinuous distribution from γrays linking SD and normal states, including a sizable clustering of strength around 1.7 MeV. The remarkable similarity of the spectra coincident with SD bands in 192,194 Hg provides additional support for a statistical process for decay out of the SD states. This similarity contrasts with differences observed in the spectrum coincident with the SD band in the odd-even 191 Hg, confirming the predictions about the role of pairing (in normal states) in influencing the shape of the decay-out spectrum
34 CFR Appendix B to Part 403 - Examples for 34 CFR 403.194-Comparability Requirements
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Examples for 34 CFR 403.194-Comparability Requirements... TECHNOLOGY EDUCATION PROGRAM Pt. 403, App. B Appendix B to Part 403—Examples for 34 CFR 403.194—Comparability... requirements in 34 CFR 403.194(a) include the following: Example 1: The local educational agency files with the...
Removal of Acid Black 194 dye from water by electrocoagulation with aluminum anode.
Vidal, Jorge; Villegas, Loreto; Peralta-Hernández, Juan M; Salazar González, Ricardo
2016-01-01
Application of an electrocoagulation process (EC) for the elimination of AB194 textile dye from synthetic and textile wastewater (effluent) contaminated with AB194 dye, was carried out using aluminum anodes at two different initial pH values. Tafel studies in the presence and absence of the dye were performed. The aluminum species formed during the electrolysis were quantified by atomic absorption, and the flocs formed in the process were analyzed by HPLC-MS. Complete removal of AB194 from 1.0 L of solution was achieved applying low densities current at initial pH values of 4.0 and 8.0. The removal of AB194 by EC was possible with a short electrolysis time, removing practically 100% of the total organic carbon content and chemical oxygen demand. The final result was completely discolored water lacking dye and organic matter. An effluent contaminated with 126 mg L(-1) AB194 dye from a Chilean textile industry was also treated by EC under optimized experimental conditions, yielding discolored water and considerably decreasing the presence of organic compounds (dye + dyeing additives), with very low concentrations of dissolved Al(3+). Analysis of flocs showed the presence of the original dye without changes in its chemical structure.
33 CFR 110.194a - Mobile Bay, Ala., and Mississippi Sound, Miss.
2010-07-01
... Sound, Miss. 110.194a Section 110.194a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Mississippi Sound, Miss. (a) The anchorage grounds. (1) The waters of lower Mobile Bay, near Cedar Point... south by latitude 30°20′00″, and on the west by longitude 88°06′00″. (2) The waters of Mississippi Sound...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Liaison with other governmental agencies and submission of views by interested persons. 19.4 Section 19.4 Public Lands: Interior Office of the Secretary of the Interior WILDERNESS PRESERVATION National Wilderness Preservation System § 19.4 Liaison with other governmental agencies and...
30 CFR 19.4 - Conditions governing investigations.
2010-07-01
... lamps; (2) 500 bulbs; (3) 50 feet of cord; (4) a battery discharge rack for 20 batteries; and (5) a 50..., EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC CAP LAMPS § 19.4 Conditions governing investigations. (a) One complete lamp, with the assembly and detail drawings that show the construction of the lamp and...
RDDS lifetime measurements of low-lying superdeformed states in {sup 194}Hg
Energy Technology Data Exchange (ETDEWEB)
Kuehn, R.; Dewald, A.; Kruecken, R. [Universitaet Koeln (Germany)] [and others
1996-12-31
The lifetimes of three low-lying states in the superdeformed (SD) yrast band of {sup 194}Hg were measured by the recoil-distance Doppler-shift method. The deduced transition quadrupole moments, Q{sub t}, equal those extracted from a DSAM measurement for the high-lying states of the band corroborate the assumption that the decay out of SD bands does not strongly affect the structure of the corresponding states. By a simple mixing-model the decay can be described assuming a very small admixture of normal-deformed (ND) states to the decaying SD states. The deduced ND mixing amplitudes for the yrast SD bands in {sup 192,194}Hg and {sup 194}Pb are presented along with average transition quadrupole moments for the lower parts of the excited SD bands.
46 CFR 194.20-19 - Piping and electrical requirements.
2010-10-01
... Storerooms § 194.20-19 Piping and electrical requirements. (a) Piping, electrical equipment, and wiring shall... storeroom itself. (b) The electrical installation shall be in accordance with the applicable requirements of...
Lifetimes of superdeformed states in {sup 194}Pb
Energy Technology Data Exchange (ETDEWEB)
Willsau, P; Hubel, H [Bonn Univ. (Germany). Inst. fuer Strahlen- und Kernphysik; Azaiez, F; Deleplanque, M A; Diamond, R M; Korten, W; Macchiavelli, A O; Stephens, F S [Lawrence Berkeley Lab., CA (United States); Kluge, H [Hahn-Meitner-Institut fuer Kernforschung Berlin G.m.b.H. (Germany); Hannachi, F [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Bacelar, J C [Kernfysisch Versneller Instituut, Zernikelaan 25 (Netherlands); Becker, J A; Brinkman, M J; Henry, E A; Kuhnert, A; Wang, T F [Lawrence Livermore National Lab., CA (United States); Draper, J A; Rubel, E [California Univ., Davis, CA (United States)
1992-08-01
Lifetimes of superdeformed states in {sup 194}Pb were measured by the Doppler-shift attenuation method. Quadrupole moments around 20 eb, that are constant over the observed frequency range, are derived. The results rule out large centrifugal stretching effects. 7 refs., 1 tab., 2 figs.
Genetic characterization of plasmid pRJ5 of Staphylococcus aureus compared to plasmid pE194
International Nuclear Information System (INIS)
Oliveira, S.S. de; Freire Bastos, M.C. de
1993-01-01
The pRJ5, a naturally occurring constitutive macrolide, lincosamide and streptogramin B (MLS) resistance plasmid of Staphylococcus aureus, was compared to pE194, a plasmid that confers the inducible phenotype. pRJ5 was stable in all strains of S. aureus tested, even under growth at 43 O C, which distinguished it from pE194 which was shown to be thermo-sensitive for replication. pRJ5, like pE194, was highly unstable in Bacillus subtilis when the cells were grown in nonselective conditions. Multimeric forms of pRJ5 DNA were detected in the few cells of B. subtilis that retained this plasmid. pE194 was transduced by phages φ 11 and φ 443 at frequencies 400 and 20-fold higher, respectively, than pRJ5. Both plasmids were co-transduced with the plasmid pRJ4. pRJ5 was shown to be compatible with pE194. Therefore they belong to distinct Inc groups. Hybridization studies revealed that pRJ5 shares a 1.35 kb region of homology to pE194, which is limited to the erm gene, conferring MLS resistance. (author)
Test of supersymmetry in the 193Ir→194Pt proton stripping reactions
International Nuclear Information System (INIS)
Vergnes, M.; Rotbard, G.; Kalifa, J.; Berrier-Ronsin, G.; Vernotte, J.; Seltz, R.; Burke, D.G.
1980-01-01
A breakdown of the selection rules of the supersymmetry model is observed for the population of the 0 2 + and 2 2 + levels of 194 Pt in the 193 Ir → 194 Pt proton stripping reactions performed using the Orsay and Mc Master University tandem accelerators. The existence of other violations in the neighbouring nuclei leads to believe that we are seeing the limitations of the supersymmetry scheme itself, at least for particle transfer reactions
The Contribution of Serine 194 Phosphorylation to Steroidogenic Acute Regulatory Protein Function
Sasaki, Goro; Zubair, Mohamad; Ishii, Tomohiro; Mitsui, Toshikatsu; Hasegawa, Tomonobu; Auchus, Richard J.
2014-01-01
The steroidogenic acute regulatory protein (StAR) facilitates the delivery of cholesterol to the inner mitochondrial membrane, where the cholesterol side-chain cleavage enzyme catalyzes the initial step of steroid hormone biosynthesis. StAR was initially identified in adrenocortical cells as a phosphoprotein, the expression and phosphorylation of which were stimulated by corticotropin. A number of in vitro studies have implicated cAMP-dependent phosphorylation at serine 194 (S194, S195 in hum...
40 CFR 194.51 - Consideration of protected individual.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Consideration of protected individual... Individual and Ground-Water Protection Requirements § 194.51 Consideration of protected individual. Compliance assessments that analyze compliance with § 191.15 of this chapter shall assume that an individual...
40 CFR 194.52 - Consideration of exposure pathways.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Consideration of exposure pathways... Individual and Ground-Water Protection Requirements § 194.52 Consideration of exposure pathways. In compliance assessments that analyze compliance with § 191.15 of this chapter, all potential exposure pathways...
INTEGRAL Observations of MAXI J1836-194
DEFF Research Database (Denmark)
Del Santo, M.; Kuulkers, E.; Rodriguez, J.
2011-01-01
. The source was also clearly detected by JEM-X at 23 sigma level in the 3-10 keV energy band with a flux of about 38 mCrab (~5 ks effective exposure time). The simultaneous IBIS/ISGRI+JEM-X 4-300 keV spectrum can be well described (chi2_red/d.o.f=1.0/18) by a power-law model with photon index 2......MAXI J1836-194 (ATEL #3611) was in the INTEGRAL/IBIS FOV on September 13th from UT 09:15 till 12:56, during the Galactic Bulge monitoring observations (See http://integral.esac.esa.int/BULGE ). It was detected at about 55 mCrab and 50 mCrab (in 18-40 keV) in revolutions 1088 and 1090, respectively...... on 2011-09-18 since 03:11:34.0 until 14:48:56.0. MAXI 1836-194 was detected by IBIS/ISGRI at a significance level of 32 sigma and 19 sigma in the 20-40 keV and 40-80 keV bands, respectively (~23 ks effective exposure time). The corresponding fluxes are roughly 48 mCrab and 44 mCrab, respectively...
miR-194 Inhibits Innate Antiviral Immunity by Targeting FGF2 in Influenza H1N1 Virus Infection
Directory of Open Access Journals (Sweden)
Keyu Wang
2017-11-01
Full Text Available Fibroblast growth factor 2 (FGF2 or basic FGF regulates a wide range of cell biological functions including proliferation, angiogenesis, migration, differentiation, and injury repair. However, the roles of FGF2 and the underlying mechanisms of action in influenza A virus (IAV-induced lung injury remain largely unexplored. In this study, we report that microRNA-194-5p (miR-194 expression is significantly decreased in A549 alveolar epithelial cells (AECs following infection with IAV/Beijing/501/2009 (BJ501. We found that miR-194 can directly target FGF2, a novel antiviral regulator, to suppress FGF2 expression at the mRNA and protein levels. Overexpression of miR-194 facilitated IAV replication by negatively regulating type I interferon (IFN production, whereas reintroduction of FGF2 abrogated the miR-194-induced effects on IAV replication. Conversely, inhibition of miR-194 alleviated IAV-induced lung injury by promoting type I IFN antiviral activities in vivo. Importantly, FGF2 activated the retinoic acid-inducible gene I signaling pathway, whereas miR-194 suppressed the phosphorylation of tank binding kinase 1 and IFN regulatory factor 3. Our findings suggest that the miR-194-FGF2 axis plays a vital role in IAV-induced lung injury, and miR-194 antagonism might be a potential therapeutic target during IAV infection.
Decay from the superdeformed bands in {sup 194}Hg
Energy Technology Data Exchange (ETDEWEB)
Henry, R.G.; Khoo, T.L.; Carpenter, M.P. [and others
1995-08-01
Superdeformed bands in {sup 194}H g were studied using the early implementation of Gammasphere. The response functions for the Ge detectors were measured for the first time as part of this experiment. Experiments were performed with both a backed target (where the residue stopped in the Au backing) and a thin target (where the residue recoiled into vacuum). This will permit measurements of the decay times of the quasicontinuum {gamma}rays. The spectrum in coincidence with the yrast SD band in {sup 194}Hg reveals the same features as found in the quasicontinuum structure in {sup 192}Hg. These features include: statistical {gamma}rays feeding the SD band, a pronounced E2 peak from transitions feeding the SD band, a Ml/E2 bump at low energies that is associated with the last stages of feeding of the superdeformed band, and a quasicontinuous distribution from {gamma}rays linking SD and normal states, including a sizable clustering of strength around 1.7 MeV. The remarkable similarity of the spectra coincident with SD bands in {sup 192,194}Hg provides additional support for a statistical process for decay out of the SD states. This similarity contrasts with differences observed in the spectrum coincident with the SD band in the odd-even {sup 191}Hg, confirming the predictions about the role of pairing (in normal states) in influencing the shape of the decay-out spectrum.
International Nuclear Information System (INIS)
Fotiades, N.; Vlastou, R.; Serris, M.; Sharpey-Schafer, J.F.; Fallon, P.; Riley, M.A.; Clark, R.M.; Hauschild, K.; Wadsworth, R.
1996-01-01
High spin states in the isotope 194 Hg were populated using the 150 Nd( 48 Ca,4n) reaction at a beam energy of 213 MeV. The analysis of γ-γ coincidences has revealed two new structures at excitation energies above 6 MeV and at moderate spin. The two structures are a manifestation of the deviation of nucleus from the collective rotation which dominates its lower excitation behaviour. A comparison with similar structures in the neighbouring Hg isotopes is also attempted. (orig.)
Rational Design of Cyclic Antimicrobial Peptides Based on BPC194 and BPC198
Directory of Open Access Journals (Sweden)
Anna D. Cirac
2017-06-01
Full Text Available A strategy for the design of antimicrobial cyclic peptides derived from the lead compounds c(KKLKKFKKLQ (BPC194 and c(KLKKKFKKLQ (BPC198 is reported. First, the secondary β-structure of BPC194 and BPC198 was analyzed by carrying out molecular dynamics (MD simulations. Then, based on the sequence pattern and the β-structure of BPC194 or BPC198, fifteen analogues were designed and synthesized on solid-phase. The best peptides (BPC490, BPC918, and BPC924 showed minimum inhibitory concentration (MIC values <6.2 μM against Pseudomonas syringae pv. syringae and Xanthomonas axonopodis pv. vesicatoria, and an MIC value of 12.5 to 25 μM against Erwinia amylovora, being as active as BPC194 and BPC198. Interestingly, these three analogues followed the structural pattern defined from the MD simulations of the parent peptides. Thus, BPC490 maintained the parallel alignment of the hydrophilic pairs K1–K8, K2–K7, and K4–K5, whereas BPC918 and BPC924 included the two hydrophilic interactions K3–Q10 and K5–K8. In short, MD simulations have proved to be very useful for ascertaining the structural features of cyclic peptides that are crucial for their biological activity. Such approaches could be further employed for the development of new antibacterial cyclic peptides.
27 CFR 41.194 - Articles of partnership or association.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles of partnership or... AND TUBES, AND PROCESSED TOBACCO Tobacco Products Importers § 41.194 Articles of partnership or..., must furnish with its application for permit required by § 41.191 a true copy of the articles of...
Generation of continuous-wave 194 nm laser for mercury ion optical frequency standard
Zou, Hongxin; Wu, Yue; Chen, Guozhu; Shen, Yong; Liu, Qu; Precision measurement; atomic clock Team
2015-05-01
194 nm continuous-wave (CW) laser is an essential part in mercury ion optical frequency standard. The continuous-wave tunable radiation sources in the deep ultraviolet (DUV) region of the spectrum is also serviceable in high-resolution spectroscopy with many atomic and molecular lines. We introduce a scheme to generate continuous-wave 194 nm radiation with SFM in a Beta Barium Borate (BBO) crystal here. The two source beams are at 718 nm and 266 nm, respectively. Due to the property of BBO, critical phase matching (CPM) is implemented. One bow-tie cavity is used to resonantly enhance the 718 nm beam while the 266 nm makes a single pass, which makes the configuration easy to implement. Considering the walk-off effect in CPM, the cavity mode is designed to be elliptical so that the conversion efficiency can be promoted. Since the 266 nm radiation is generated by a 532 nm laser through SHG in a BBO crystal with a large walk-off angle, the output mode is quite non-Gaussian. To improve mode matching, we shaped the 266 nm beam into Gaussian modes with a cylindrical lens and iris diaphragm. As a result, 2.05 mW 194 nm radiation can be generated. As we know, this is the highest power for 194 nm CW laser using SFM in BBO with just single resonance. The work is supported by the National Natural Science Foundation of China (Grant No. 91436103 and No. 11204374).
Imunogenicidade da cepa avirulenta RV194-2 do vírus rábico em camundongos
Directory of Open Access Journals (Sweden)
Rugimar Marcovistz
1996-12-01
Full Text Available O vírus rábico RV194-2, uma variante avirulenta da cepa CVS (Challenge Vírus Standard, produz uma infecção inaparente quando inoculado intracerebralmente em camundongos adultos. Sugerindo que a resposta imunológica do hospedeiro permite a eliminação do vírus do sistema nervoso central. Por esta razão foram estudadas a indução de interferon e a resposta imune humoral em camundongos BALB/c inoculados com vírus RV194-2. Durante a infecção, estes camundongos apresentaram elevados níveis de interferon no plasma e no cérebro com altos títulos de anticorpos neutralizantes anti-rábicos. A 2-5A sintetase. um marcador da ação dos interferons,foi também analisada no cérebro destes animais. Sua atividade, aumentou, paralelamente, á produção de interferon, demonstrando que este interferon é bioquímicamente ativo. O vírus RV194-2 também induziu, 45 dias após sua inoculação, proteção aos animais quando desafiados com a cepa virulenta CVS. Estes resultados demonstram que a cepa RV194-2possui um alto nível imunogênico.RV194-2 rabies virus, an avirulent mutant of CVS strain, induces an inapparent infection limited to the central nervous system (CNS in adult mice inoculated intracerebrally. This fact suggest that immune response of the host is able to eliminate the virus in CNS. For this reason, we have studied the induction of interferon and the humoral immune responses in BALB/c mice after RV194-2 inoculation. These mice presented high levels of interferon in the plasma and in the brain, with elevated levels of neutralizing antirabies antibodies. The 2-5A synthetase, an enzyme marker of interferon action, was analyzed in the brain of inoculated animals. Its enhancement in parallel to the interferon production in the brain, showed biochemical evidence that this interferon is active. Forty five days after RV194-2 virus inoculation, mice were protected against a challenge with the CVS virulent strain. The results presented
Directory of Open Access Journals (Sweden)
Liang T
2016-07-01
Full Text Available Tian Liang, Liru Li, Yan Cheng, Chengcheng Ren, Guangmei Zhang Department of Gynecology and Obstetrics, The first Affiliated Hospital of Harbin Medical University, Nangang District, Harbin, Hei Longjiang, People’s Republic of China Abstract: Ovarian carcinoma is the most lethal gynecologic malignancy among women. Ovarian cancer metastasis is the main reason for poor prognosis. MicroRNAs (miRNAs have been shown to play an important role in tumorigenesis and metastasis in various cancers by affecting the expression of their targets. In this study, we explored the role of miR-194 in ovarian cancer. Real-time polymerase chain reaction assays showed that miR-194 was significantly upregulated in ovarian cancer tissues. Overexpression of miR-194 in ovarian cancer cells promotes cell proliferation, migration, and invasion; in contrast, inhibition of the expression of miR-194 has the opposite effects. Meanwhile, bioinformatics tools were used to identify protein tyrosine phosphatase nonreceptor type 12 (PTPN12 as a potential target of miR-194. The luciferase assay showed that miR-194 directly binds to the 3'-untranslated region of PTPN12. Western blot analysis and quantitative real-time polymerase chain reaction assay revealed that PTPN12 expression was negatively associated with miR-194 expression in both ovarian cancer tissues and cells. Thus, we conclude that miR-194 targets PTPN12 and functions as an oncogene in ovarian cancer cells. This novel pathway may provide a new insight to explain ovarian cancer development and metastasis. Keywords: miR-194, ovarian cancer, PTPN12, metastasis
Energy Technology Data Exchange (ETDEWEB)
Hauschild, K.; Bernstein, L.A.; Becker, J.A. [Lawrence Livermore National Lab., CA (United States)] [and others
1996-12-31
The observation of one-step `primary` gamma-ray transitions directly linking the superdeformed (SD) states to the normal deformed (ND) low-lying states of known excitation energies (E{sub x}), spins and parities (J{sup {pi}}) is crucial to determining the E{sub x} and J{sup {pi}} of the SD states. With this knowledge one can begin to address some of the outstanding problems associated with SD nuclei, such as the identical band issue, and one can also place more stringent restrictions on theoretical calculations which predict SD states and their properties. Brinkman, et al., used the early implementation of the GAMMASPHERE spectrometer array (32 detectors) and proposed a single, candidate {gamma} ray linking the {sup 194}Pb yrast SD band to the low-lying ND states in {sup 194}Pb. Using 55 detectors in the GAMMASPHERE array Khoo, et al., observed multiple links between the yrast SD band in {sup 194}Hg and the low-lying level scheme and conclusively determined E{sub x} and J of the yrast SD states. Here the authors report on an experiment in which Gammasphere with 88 detectors was used and the E{sub x} and J{sup {pi}} values of the yrast SD states in {sup 194}Pb were uniquely determined. Twelve one-step linking transitions between the yrast SD band and low-lying states in {sup 194}Pb have been identified, including the transition proposed by Brinkman. These transitions have been placed in the level scheme of {sup 194}Pb using coincidence relationships and agreements between the energies of the primary transitions and the energy differences in level spacings. Furthermore, measurements of angular asymmetries have yielded the multipolarities of the primaries which have allowed J{sup {pi}} assignments of the {sup 194}Pb SD states to be unambiguously determined for the first time without a priori assumptions about the character of SD bands. A study performed in parallel to this work using the EUROGAM-II array reports similar, but somewhat less extensive, results.
46 CFR 194.05-5 - Chemicals in the chemistry laboratory.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Chemicals in the chemistry laboratory. 194.05-5 Section....05-5 Chemicals in the chemistry laboratory. (a) Small working quantities of chemical stores in the chemistry laboratory which have been removed from the approved shipping container need not be marked or...
Coulomb excitation of the 4+1 states of 194Pt, 196Pt and 198Pt
International Nuclear Information System (INIS)
Fewell, M.P.; Gyapong, G.J.; Spear, R.H.
1987-09-01
Probabilities for the Coulomb excitation of the 4 1 + states of 194 Pt, 196 Pt, 198 Pt by the backscattering of 4 He, 12 C and 16 O ions are reported. Model-independent values of the matrix elements 1 + ; M(E4), 4 1 + > and 1 + , M(E2), 4 1 + > are extracted. Agreement with previous measurements of these matrix elements is good. Values of β 2 and β 4 are determined for 194 Pt and compared with calculations of these quantities
Trauma facial: análise de 194 casos
Silva, Joaquim José de Lima; Lima, Antonia Artemisa Aurélio Soares; Melo, Igor Furtado Soares; Maia, Rafael Costa Lima; Pinheiro Filho, Tadeu Rodriguez de Carvalho
2011-01-01
INTRODUÇÃO: O trauma facial tem crescido em importância para a Cirurgia Plástica, especialmente nas últimas quatro décadas, tendo estreita relação com o aumento de acidentes automobilísticos e violência urbana. O presente estudo objetiva traçar um perfil dos pacientes que sofreram esse tipo de trauma. MÉTODO: Foram analisados 194 casos de trauma facial atendidos em serviço de referência em Fortaleza (Ceará), entre 2005 e 2009. Os dados obtidos foram entrecruzados e classificados utilizando os...
12 CFR 19.194 - Eligibility of attorneys and accountants to practice.
2010-01-01
... certified public accountant or public accountant and is not currently under suspension or debarment by the... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Eligibility of attorneys and accountants to... Conduct § 19.194 Eligibility of attorneys and accountants to practice. (a) Attorneys. Any attorney who is...
Gong, Baolan; Yue, Yan; Wang, Renxiao; Zhang, Yi; Jin, Quanfang; Zhou, Xi
2017-06-01
The epithelial-mesenchymal transition is the key process driving cancer metastasis. MicroRNA-194 inhibits epithelial-mesenchymal transition in several cancers and its downregulation indicates a poor prognosis in human endometrial carcinoma. Self-renewal factor Sox3 induces epithelial-mesenchymal transition at gastrulation and is also involved epithelial-mesenchymal transition in several cancers. We intended to determine the roles of Sox3 in inducing epithelial-mesenchymal transition in endometrial cancer stem cells and the possible role of microRNA-194 in controlling Sox3 expression. Firstly, we found that Sox3 and microRNA-194 expressions were associated with the status of endometrial cancer stem cells in a panel of endometrial carcinoma tissue, the CD133+ cell was higher in tumorsphere than in differentiated cells, and overexpression of microRNA-194 would decrease CD133+ cell expression. Silencing of Sox3 in endometrial cancer stem cell upregulated the epithelial marker E-cadherin, downregulated the mesenchymal marker vimentin, and significantly reduced cell invasion in vitro; overexpression of Sox3 reversed these phenotypes. Furthermore, we discovered that the expression of Sox3 was suppressed by microRNA-194 through direct binding to the Sox3 3'-untranslated region. Ectopic expression of microRNA-194 in endometrial cancer stem cells induced a mesenchymal-epithelial transition by restoring E-cadherin expression, decreasing vimentin expression, and inhibiting cell invasion in vitro. Moreover, overexpression of microRNA-194 inhibited endometrial cancer stem cell invasion or metastasis in vivo by injection of adenovirus microRNA-194. These findings demonstrate the novel mechanism by which Sox3 contributes to endometrial cancer stem cell invasion and suggest that repression of Sox3 by microRNA-194 may have therapeutic potential to suppress endometrial carcinoma metastasis. The cancer stem cell marker, CD133, might be the surface marker of endometrial cancer stem
2010-07-01
... What role does my agency play in the Standard and Optional Forms Management Program? Your agency head... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What role does my agency play in the Standard and Optional Forms Management Program? 102-194.30 Section 102-194.30 Public...
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
Directory of Open Access Journals (Sweden)
An J
2017-11-01
Full Text Available Jihong An,* Weiling Lv,* Yongzhou Zhang Department of Clinical Pharmacy, Huaihe Hospital of Henan University, Kaifeng, People’s Republic of China *These authors contributed equally to this work Background: Chemoresistance is one of the major obstacles for cancer therapy in the clinic. Nuclear paraspeckle assembly transcript 1 (NEAT1 has been reported as an oncogene in most malignancies such as lung cancer, esophageal cancer, and gastric cancer. This study is designed to investigate the function of NEAT1 in paclitaxel (PTX resistance of ovarian cancer and its potential molecular mechanism. Patients and methods: The expressions of NEAT1 and miR-194 in ovarian cancer tissues and cells were estimated by quantitative real-time polymerase chain reaction (qRT-PCR. MTT, flow cytometry, and Western blot assays were used to assess the effect of NEAT1 on PTX resistance in PTX-resistant ovarian cancer cells. Luciferase reporter assay was applied to examine the association between NEAT1, zinc finger E-box-binding homeobox 1 (ZEB1 and miR-194. Xenograft tumor model was established to confirm the biological role of NEAT1 in PTX resistance of ovarian cancer in vivo. Results: NEAT1 was upregulated, and miR-194 was downregulated in PTX-resistant ovarian cancer tissues and cells. Functionally, NEAT1 knockdown enhanced cell sensitivity to PTX via promoting PTX-induced apoptosis in vitro. NEAT1 was identified as a molecular sponge of miR-194 to upregulate ZEB1 expression. Mechanistically, NEAT1-knockdown-induced PTX sensitivity was mediated by miR-194/ZEB1 axis. Moreover, NEAT1 knockdown improved PTX sensitivity of ovarian cancer in vivo. Conclusion: NEAT1 contributed to PTX resistance of ovarian cancer cells at least partly through upregulating ZEB1 expression by sponging miR-194, elucidating a novel regulatory pathway of chemoresistance in PTX-resistant ovarian cancer cells and providing a possible long noncoding RNA (lncRNA-targeted therapy for ovarian cancer
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
Study of the superdeformed band in {sup 194}Pb with EUROGAM
Energy Technology Data Exchange (ETDEWEB)
Hannachi, F [Daresbury Lab. (United Kingdom); [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Porquet, M G; Bastin, G; Deloncle, I; Gall, B; Schuck, C; Smith, A G [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Bourgeois, C; Duprat, J; Korichi, A; Perrin, N; Sergolle, H [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire; Poffe, N [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire; [Oxford Univ. (United Kingdom). Dept. of Physics; Astier, A; Coz, Y Le; Meyer, M; Redon, N [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Bentley, M; Simpson, J [Daresbury Lab. (United Kingdom); Sharpey-Schafer, J F; Joyce, M J; Beausang, C W; Fallon, P; Paul, E S; Dagnall, P J; Forbes, S A; Gale, S; Jones, P M [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Wadsworth, R; Clark, R M [Bordeaux-1 Univ., 33 - Gradignan (France). Centre d` Etudes Nucleaires; Curien, D [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires
1992-08-01
An experiment has been carried out using a subset of the EUROGAM array to investigate the decay out of the superdeformed (SD) band in {sup 194}Pb. Two new band members and a new decay pattern into the low lying states at normal deformation (ND) have been established for this band. New spectroscopic information about the level scheme at normal deformation has also been extracted. (author). 9 refs., 1 tab., 4 figs.
49 CFR Appendix A to Part 194 - Guidelines for the Preparation of Response Plans
2010-10-01
... potentially affected public drinking water intake, lake, river, and stream within a radius of 5 miles (8... Appendix A to Part 194 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY RESPONSE...
Evaporation residue excitation function measurement for 19F + 194,198Pt reactions
International Nuclear Information System (INIS)
Singh, Varinderjit; Behera, B.R.; Kaur, Maninder
2012-01-01
Nuclear dissipation is one of the active fields in the present day nuclear physics research. Experimental signatures for dissipation are observed through large excess in pre-fission neutrons, γ-ray multiplicities from the compound nucleus, giant dipole resonance (GDR) γ-rays, light charged particles and evaporation residues in comparison to standard statistical model, for the heavy-ion induced fusion-fission or fusion-evaporation reactions (ERs). From the analysis of a large set of experimental data, it is well established that there exists a large dissipation at nuclear temperature above 1 MeV. But most of these probes are not sensitive to the dissipation within saddle. The ER cross-section is a probe which is sensitive to dissipation within the saddle point. Hence, the study of ER cross-section can be helpful in estimating the dissipation effects inside the saddle point. Also the other motivation for these measurements is to see the effect of shell closure on dissipation. With this motivation the evaporation cross-sections for 19 F + 194,198 Pt are measured at beam energy of 101 to 137.3 MeV. Of the above systems 19 F + 194 Pt populates 213 Fr (N = 126) shell closed compound nucleus (CN) whereas, other system populate 217 Fr (N = 130) non-shell closed CN
Energy Technology Data Exchange (ETDEWEB)
Chiang, Chien-I [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Huang, Ya-Li [Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China); Chen, Wei-Jen [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Shiue, Horng-Sheng [Department of Chinese Medicine, Chang Gung Memorial Hospital and Chang Gung University College of Medicine, Taoyuan, Taiwan (China); Huang, Chao-Yuan; Pu, Yeong-Shiau [Department of Urology, National Taiwan University Hospital, College of Medicine National Taiwan University, Taipei, Taiwan (China); Lin, Ying-Chin [Department of Family Medicine, Shung Ho Hospital, Taipei Medical University, New Taipei, Taiwan (China); Department of Health Examination, Wan Fang Hospital, Taipei Medical University, Taipei, Taiwan (China); Division of Family Medicine, School of Medicine, Taipei Medical University, Taipei, Taiwan (China); Hsueh, Yu-Mei, E-mail: ymhsueh@tmu.edu.tw [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China)
2014-09-15
The association between DNA repair gene polymorphisms and bladder cancer has been widely studied. However, few studies have examined the correlation between urothelial carcinoma (UC) and arsenic or its metabolites. The aim of this study was to examine the association between polymorphisms of the DNA repair genes, XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln, with urinary arsenic profiles and UC. To this end, we conducted a hospital-based case–control study with 324 UC patients and 647 age- and gender-matched non-cancer controls. Genomic DNA was used to examine the genotype of XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln by PCR-restriction fragment length polymorphism analysis (PCR-RFLP). Urinary arsenic profiles were measured by high performance liquid chromatography (HPLC) linked with hydride generator and atomic absorption spectrometry. The XRCC1 399 Gln/Gln and 194 Arg/Trp and Trp/Trp genotypes were significantly related to UC, and the odds ratio (OR) and 95% confidence interval (95%CI) were 1.68 (1.03–2.75) and 0.66 (0.48–0.90), respectively. Participants with higher total urinary arsenic levels, a higher percentage of inorganic arsenic (InAs%) and a lower percentage of dimethylarsinic acid (DMA%) had a higher OR of UC. Participants carrying XRCC1 risk diplotypes G-C/G-C, A-C/A-C, and A-T/G-T, and who had higher total arsenic levels, higher InAs%, or lower DMA% compared to those with other XRCC1 diplotypes had a higher OR of UC. Our results suggest that the XRCC1 399 Gln/Gln and 194 Arg/Arg DNA repair genes play an important role in poor arsenic methylation capacity, thereby increasing the risk of UC in non-obvious arsenic exposure areas. - Highlights: • The XRCC1 399Gln/Gln genotype was significantly associated with increased OR of UC. • The XRCC1 194 Arg/Trp and Trp/Trp genotype had a significantly decreased OR of UC. • Combined effect of the XRCC1 genotypes and poor arsenic methylation capacity on
DSAM lifetime measurements for the chiral pair in {sup 194}Tl
Energy Technology Data Exchange (ETDEWEB)
Masiteng, P.L.; Bvumbi, S.P. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of the Western Cape, Private Bag X17, Bellville (South Africa); University of Johannesburg, PO Box 524, Auckland Park (South Africa); Pasternak, A.A. [A.F. Ioffe Physical-Technical Institute, St.-Petersburg (Russian Federation); Lawrie, E.A.; Shirinda, O.; Lawrie, J.J.; Bark, R.A.; Kheswa, N.Y.; Lieder, E.O.; Lieder, R.M.; Mullins, S.M.; Murray, S.H.T. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); Lindsay, R. [University of the Western Cape, Private Bag X17, Bellville (South Africa); Madiba, T.E.; Sharpey-Schafer, J.F. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of the Western Cape, Private Bag X17, Bellville (South Africa); Ndayishimye, J.; Papka, P. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of Stellenbosch, Department of Physics, Private Bag X1, Matieland (South Africa); Ntshangase, S.S. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of Cape Town, Department of Physics, Private Bag, Rondebosch (South Africa)
2016-02-15
Most important for the identification of chiral symmetry in atomic nuclei is to establish a pair of bands that are near-degenerate in energy, but also in B(M1) and B(E2) transition probabilities. Dedicated lifetime measurements were performed for four bands of {sup 194}Tl, including the pair of four-quasiparticle chiral bands with close near-degeneracy, considered as a prime candidate for best chiral symmetry pair. The lifetime measurements confirm the excellent near-degeneracy in this pair and indicate that a third band may be involved in the chiral symmetry scenario. (orig.)
International Nuclear Information System (INIS)
Lopez-Martens, A.P.; Doessing, T.; Khoo, T.L.; Korichi, A.; Hannachi, F.; Calderin, I.J.; Lauritsen, T.; Ahmad, I.; Carpenter, M.P.; Fischer, S.M.; Hackman, G.; Janssens, R.V.F.; Nisius, D.; Reiter, P.; Amro, H.; Moore, E.F.
1999-01-01
The strength distribution of the primary γ rays in the decay from superdeformed (SD) states is investigated by applying the maximum likelihood method. For the 194 Hg nucleus, 41 primary transitions are identified above 2600 keV. It is concluded that they represent the strongest 10% of the transitions selected stochastically from a Porter-Thomas distribution. This would support the scenario of a statistical decay of SD states via coupling to a compound state at normal deformation. However, the occurrence of several very strong 'one-step linking' transitions is found to have a very small probability. Based on the absence of strong primary transitions from SD states in adjacent nuclei, the situation in 194 Hg is viewed as a very lucky incidence
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
Notes on LCW Activation Calculation for Neutron Imaging Operations in the North Cave of Building 194
Energy Technology Data Exchange (ETDEWEB)
Anderson, S. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-09-20
This note estimates the amount of activation that could be produced in the Facilities-provided Low Conductivity Water (LCW) that is proposed to be used for cooling of electromagnets and beam stops in the Neutron Imaging (NI) accelerator project in the North Cave of Building 194.
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
Close near-degeneracy in a pair of four-quasiparticle bands in 194Tl
International Nuclear Information System (INIS)
Masiteng, P.L.; Lawrie, E.A.; Ramashidzha, T.M.; Bark, R.A.; Carlsson, B.G.; Lawrie, J.J.; Lindsay, R.; Komati, F.; Kau, J.; Maine, P.; Maliage, S.M.; Matamba, I.; Mullins, S.M.; Murray, S.H.T.; Mutshena, K.P.; Pasternak, A.A.; Ragnarsson, I.
2013-01-01
A pair of rotational bands associated with the πh 9/2 ⊗νi 13/2 −1 configuration at lower spins and with the πh 9/2 ⊗νi 13/2 −3 configuration at higher spins is found in 194 Tl. The two 4-quasiparticle bands show exceptionally close near-degeneracy in the excitation energies. Furthermore close similarity is also found in their alignments and B(M1)/B(E2) reduced transition probability ratios. Such close near-degeneracy probably indicates chiral geometry in the angular momentum space
Alternatives to argon for gas stopping volumes in the B194 neutron imager
Energy Technology Data Exchange (ETDEWEB)
Bleuel, D. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Anderson, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Caggiano, J. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hall, J. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Johnson, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ratkiewicz, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rusnak, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-05-17
In a recent experiment at Lawrence Berkeley National Laboratory, the 40Ar(d,p)41Ar excitation function between 3-7 MeV was measured, confirming a previous estimation that there may be an intolerable radiation dose from 41Ar production by slowing to rest 6.74 MeV deuterons in the gas cell of the neutron imaging facility being constructed in B194. Gas alternatives to argon are considered, including helium, nitrogen (N2), neon, sulfur hexafluoride (SF6), krypton, and xenon, as well as high atomic number solid backings such as tantalum.
Multiple superdeformed bands in sup 194 Hg and their dynamical moments of inertia
Energy Technology Data Exchange (ETDEWEB)
Riley, M.A.; Cullen, D.M.; Alderson, A.; Ali, I.; Fallon, P.; Forsyth, P.D.; Hanna, F.; Mullins, S.M.; Roberts, J.W.; Sharpey-Schafer, J.F.; Twin, P.J. (Liverpool Univ. (UK). Oliver Lodge Lab.); Poynter, R.; Wadsworth, R. (York Univ. (UK). Dept. of Physics); Bentley, M.A.; Bruce, A.M.; Simpson, J. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Sletten, G. (Niels Bohr Inst., Roskilde (Denmark). Tandem Accelerator Lab.); Nazarewicz, W. (Liverpool Univ. (UK). Oliver Lodge Lab. Politechnika Warszawska (Poland). Inst. Fizyki); Bengtsson, T. (Lund Inst. of Tech. (Sweden). Dept. of Mathematical Physics); Wyss, R. (Manne Siegbahn Inst. of Physics, Stockholm (Sweden))
1990-05-28
Three superdeformed bands have been observed in {sup 194}Hg. The dynamical moment of inertia J{sup (2)} of all three bands is observed to increase by 30-40% over the frequency range {Dirac h}{omega}=0.1-0.4 MeV. This phenomena can be understood in terms of the gradual alignment of pairs of high-j intruder orbitals within the framework of the cranked Woods-Saxon and Nilsson models including pairing. The calculations together with the observed J{sup (2)} behaviour of the three bands indicate that pairing correlations in the superdeformed minimum are rather weak. (orig.).
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
Carnt, Nicole; Robaei, Dana; Minassian, Darwin C; Dart, John K G
2018-01-03
To determine demographic and clinical features of patients with Acanthamoeba keratitis (AK) that are independent risk factors both for bad outcomes and for severe inflammatory complications (SIC). A retrospective audit of medical records of AK cases at Moorfields Eye Hospital from July 2000 to April 2012, including 12 earlier surgical cases. Cases with a bad outcome were defined as those having one or more of the following: corneal perforation, keratoplasty, other surgery (except biopsy), duration of antiamoebic therapy (AAT) ≥10.5 months (the 75th percentile of the whole cohort) and final visual acuity ≤20/80. SICs were defined as having scleritis and/or a stromal ring infiltrate. Multivariable analysis was used to identify independent risk factors for both bad outcomes and SICs. Records of 194 eyes (194 patients) were included, having bad outcomes in 93 (48%). Bad outcomes were associated with the presence of SIC, aged >34 years, corticosteroids used before giving AAT and symptom duration >37 days before AAT. The development of SIC was independently associated with aged >34 years, corticosteroids used before giving AAT and herpes simplex virus (HSV) keratitis treatment before AAT. The prompt diagnosis of AK, avoidance of a misdiagnosis of HSV keratitis and corticosteroid use before the exclusion of AK as a potential cause of keratitis are essential to the provision of a good outcome for patients and for the avoidance of SIC. Older age is an unmodifiable risk factor that may reflect differences in the immune response to AK in this patient subset. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Fission excitation function for 19F + 194,196,198Pt at near and above barrier energies
Directory of Open Access Journals (Sweden)
Singh Varinderjit
2015-01-01
Full Text Available Fission excitation functions for 19F + 194,196,198Pt reactions populating 213,215,217Fr compound nuclei are reported. Out of these three compound nuclei, 213Fr is a shell closed (N=126 compound nucleus and the other two are away from the shell closure. From a comparison of the experimental fission cross-sections with the statistical model predictions, it is observed that the fission cross-sections are underestimated by the statistical model predictions using shell corrected finite range rotating liquid drop model (FRLDM fission barriers. Further the FRLDM fission barriers are reduced to fit the fission cross-sections over the entire measured energy range.
Hu, Bo; Xu, Chen; Tian, Ye; Shi, Changgui; Zhang, Ying; Deng, Lianfu; Zhou, Hongyu; Cao, Peng; Chen, Huajiang; Yuan, Wen
2017-07-25
Intervertebral disc degeneration (IDD) is characterized by dehydration and loss of extracellular matrixes in the nucleus pulposus region. Chondroitin sulfate has been found to be the water-binding molecule that played a key role in IDD. Although investigators have reported that inflammatory cytokines are involved in the reduction of chondroitin sulfate in IDD, but the underlying mechanism is unrevealed. Since chondroitin sulfate synthesis is controlled by chondroitin sulfate glycosyltransferases CHSY-1/2/3 and CSGALNACT-1/2, their functional role and regulatory mechanism in IDD is not fully studied. Here, we set out to investigate the function and regulatory roles of these factors during IDD development. We found that among these chondroitin sulfate glycosyltransferases, CHSY-1/2/3 are significantly down-regulated in severe IDD samples than mild IDD samples. In vitro experiments revealed that Interleukin-1β and Tumor Necrosis Factor-α stimulation led to significant reduction of CHSY-1/2/3 at protein level than mRNA level in NP cells, indicating a post-transcriptional regulatory mechanisms are involved. By computational prediction and analysis, we found that inflammatory cytokines stimulated microRNA-194 and -515 target CHSY-1/2/3 mRNA and significantly interrupt their translation and downstream chondroitin sulfate deposition. Inhibition of microRNA-194 and -515 however, significantly rescued CHSY-1/2/3 expressions and chondroitin sulfate deposition. These findings together demonstrated a vital role of inflammatory stimulated microRNAs in promoting intervertebral disc degeneration by interrupt chondroitin sulfate synthesis, which may provide new insights into the mechanism and therapeutic approaches in IDD.
Oblate L = 1 bands in 194,196-201Pb, and 193Hg
International Nuclear Information System (INIS)
Becker, J.A.; Kuhnert, A.; Stoyer, M.A.; Brinkman, M.J.; Wang, T.F.; Roy, N.; Cizewski, J.A.; Stephens, F.S.; Deleplanque, M.A.; Diamond, R.M.; Azaiez, F.; Macchiavelli, A.O.; Korten, W.; Draper, J.E.; California Univ., Berkeley, CA
1992-11-01
Reports of recent experiments have included observations of regular and irregular bands in neutron deficient Pb isotopes with A=194, 196--201. The bands are populated strongly in HI,xn reactions. The shared characteristics of the bands include: (1) Bandhead energies of few MeV; (2) High bandhead spin; (3) Large alignments; (4) Small dynamic moments of inertia, and (5) Strong L = 1 transitions and weaker L = 2 crossover transitions, with B(Ml/B(E2)) ∼ 20 μ 2 /e 2 b 2 . Lifetimes of band members in the 198 Pb regular band are B(Ml) ∼ 1 W.u., and B(E2) ∼ 10 W.u. (with large errors). These observations are consistent with an interpretation of the regular structures as collective oblate bands with both proton and neutron excitations involved; the closed proton shell at Z = 82 is broken, and coupled to v(i l3/2 ) -n excitations. The irregular structures may correspond to triaxial shapes, with similar orbits involved. A similar structure has been also found in 193 Hg
2013-04-03
..., and V-548 in the Vicinity of Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... airways V-68, V-76, V-194, and V-548 in the vicinity of Houston, TX. The FAA is taking this action to... vicinity of Houston, TX. Specifically, the FAA amends V-68 and V-76 to reflect the Hobby VOR/DME 289[deg...
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
Study of muon pair production in 194 GeV/c π--tungsten collisions. Deviation of Drell-Yan model
International Nuclear Information System (INIS)
Varela, J.
1984-04-01
The results of an experiment of muon pair production in π - -nucleon interactions on tungsten target at 194 GeV/c are presented. This experiment is realized at the CERN laboratories with a very strong (>10 9 π - /sec) pion beam, with a good acceptance and a good resolution in mass of muon pairs. The production cross section deviate of the Drell-Yan model. The leading logarithm approximation of QCD describe more closely the differential behaviour of the cross section but with little deviations in rapidity distribution by mass intervals. These deviations can be traducing the contribution of the multiple soft gluon emission [fr
International Nuclear Information System (INIS)
Prescott, C.Y.; Atwood, W.B.; Cottrell, R.L.A.
1977-01-01
A search for parity violating effects in the inelastic scattering of polarized electrons off an unpolarized deuterium target at 19.4 GeV has recently been performed at SLAC. Using the 20-GeV/c and 8-GeV/c spectrometers, two kinematical points with Q 2 values of 1.2 GeV/c 2 and 4.2 GeV/c 2 , respectively, have been measured. Statistical accuracy of the measurements approaches the level of the weak interactions. Systematic errors are still being studied. Techniques to measure and control systematic errors and the present status of the data analysis are discussed
International Nuclear Information System (INIS)
Nhan Hao, T.V.; Phu Dat, D.H.; Hoang Tung, N.; Tran, H.N.
2015-01-01
The left–right asymmetric deformation of normal deformed (ND) and superdeformed (SD) states of 194 Pb has been investigated in the framework of the parity-symmetry projection of the highly truncated diagonalization approach (HTDA), which is suited to treat the correlations in an explicitly particle-number conserving microscopic approach. A Skyrme energy density functional using the SIII and SkM* interactions has been considered to treat the particle–hole channel, whereas a density-independent δ force has been adopted for the residual interaction. The obtained results are compared with previous approaches. The calculated octupole phonon excitation energy is found to be in good qualitative agreement with available data in the ND state. (author)
Peptide drug stability: The anti-inflammatory drugs Pep19-2.5 and Pep19-4LF in cream formulation.
Kuhlmann, Nicole; Heinbockel, Lena; Correa, Wilmar; Gutsmann, Thomas; Goldmann, Torsten; Englisch, Uwe; Brandenburg, Klaus
2018-03-30
In previous years, we developed anti-infective drugs based on antimicrobial peptides (AMPs), which have been shown to effectively block severe infections and inflammation in vitro as well as in vivo. Besides systemic application, the occurrence of severe local infections necessitates a topical application for example in the case of severe skin and soft tissue infections (SSTI). Recent investigations show that the synthetic anti-lipopolysaccharide peptide (SALP) Pep19-2.5 (Aspidasept® I) and a variant called Pep19-4LF (Aspidasept® II) are able to supress inflammation reactions also in keratinocytes, Langerhans cells, and dendritic cells from the skin. For topical application, a possible formulation represents the drug dispersed into a pharmaceutical cream (DAC base cream). Here, we present investigations on the stability of the peptides using this formulation in dependence on time, which includes the evaluation of the extraction procedure, the quantitative analysis of the peptides after extraction, its sensitivity to protease degradation and its ability to maintain activity against LPS-induced inflammation in vitro. We have developed an extraction procedure for the peptides with an optimum yield and showed that Pep19-2.5 is present as a dimer after extraction from the cream, whereas Pep19-4LF retains its monomeric form. Both peptides show no degradation by chymotrypsin after extraction for at least 1 h, which is indicative for an attachment of constituents of the base cream, inhibiting the cutting into peptidic part structures. The extracted peptides and in particular the dimeric Pep19-2.5 are still able to inhibit the LPS-induced inflammation reaction in human mononuclear cells. Copyright © 2018 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Lei Feng
2013-10-01
Full Text Available The benzopyran compound obtained by cultivating a mangrove-derived strain, Streptomyces xiamenensis strain 318, shows multiple biological effects, including anti-fibrotic and anti-hypertrophic scar properties. To increase the diversity in the structures of the available benzopyrans, by means of biosynthesis, the strain was screened for spontaneous rifampicin resistance (Rif, and a mutated rpsL gene to confer streptomycin resistance (Str, was introduced into the S. xiamenensis strain M1-94P that originated from deep-sea sediments. Two new benzopyran derivatives, named xiamenmycin C (1 and D (2, were isolated from the crude extracts of a selected Str-Rif double mutant (M6 of M1-94P. The structures of 1 and 2 were identified by analyzing extensive spectroscopic data. Compounds 1 and 2 both inhibit the proliferation of human lung fibroblasts (WI26, and 1 exhibits better anti-fibrotic activity than xiamenmycin. Our study presents the novel bioactive compounds isolated from S. xiamenensis mutant strain M6 constructed by ribosome engineering, which could be a useful approach in the discovery of new anti-fibrotic compounds.
International Nuclear Information System (INIS)
Anon.
1995-01-01
This work deals with the Arabian OPEC countries part in the world petroleum production. It has increased to 19,4% in 1985 to 27,7% in 1994. The petroleum and natural gas reserves of arab countries are given respectively in milliards of barrels and in milliards of m 3 for 1994. The number of oil wells in the Arabian OPEC countries and the petroleum production of arab countries are given too. (O.L.). 4 tabs
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
International Nuclear Information System (INIS)
Stuchbery, A.E.; Lampard, G.J.; Bolotin, H.H.
1991-01-01
Transient field processions were measured simultaneously for levels in the nuclei 182,184,186 W and 194,196,198 Pt as their ions traversed polarized Gd hosts. These results allow a critical evaluation of conflicting g-factor values reported previously for the even Pt isotopes. Mass variations of g(2 1 + ) in the even W, Os, Pt nuclei are examined using the proton-neutron interacting boson model (IBM-2). The measured g-factors depart from the simplest IBM-2 description perhaps due to subshell effects and/or small contributions from non-collective configurations which cause the neutron-boson g-factor to vary with mass. 46 refs., 5 tabs., 7 figs
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
Feigl, Andrea B; Ding, Eric L
2013-11-01
Determinants of universal healthcare (UHC) are poorly empirically understood. We undertook a comprehensive study of UHC development using a novel Evidenced Formal Coverage (EFC) index that combines three key UHC elements: legal framework, population coverage, and accessibility. Applying the EFC index measures (legislation, ≥90% skilled birth attendance, ≥85% formal coverage) to 194 countries, aggregating time-varying data from 1880-2008, this study investigates which macro-economic, political, and social indicators are major longitudinal predictors of developing EFC globally, and in middle-income countries. Overall, 75 of 194 countries implemented legal-text UHC legislation, of which 51 achieved EFC. In a country-year prospective longitudinal analysis of EFC prediction, higher GDP-per-capita (per GDP-per-capita doubling, relative risk [RR]=1.77, 95% CI: 1.49-2.10), higher primary school completion (per +20% completion, RR=2.30, 1.65-3.21), and higher adult literacy were significantly associated with achieving EFC. Results also identify a GDP-per-capita of I$5000 as a minimum level for development of EFC. GDP-per-capita and education were each robust predictors in middle-income countries, and education remained significant even controlling for time-varying GDP growth. For income-inequality, the GINI coefficient was suggestive in its role in predicting EFC (p=0.024). For social and political indicators, a greater degree of ethnic fractionalization (per +25%, RR=0.51, 0.38-0.70), proportional electoral system (RR=2.80, 1.22-6.40), and dictatorships (RR=0.10, 0.05-0.27) were further associated with EFC. The novel EFC index and this longitudinal prospective study together indicate that investment in both economic growth and education should be seen of equal importance for development of UHC. Our findings help in understanding the social and political drivers of universal healthcare, especially for transitioning countries. Copyright © 2013 Elsevier Ireland Ltd. All
Ahmed, Jishan; Narain, Kanwar; Mukherjee, Kaustab; Majumdar, Gautam; Chenkual, Saia; Zonunmawia, Jason C.
2017-01-01
X-ray repair cross complementary group gene is one of the most studied candidate gene involved in different types of cancers. Studies have shown that X-ray repair cross complementary genes are significantly associated with increased risk of breast cancer in females. Moreover, studies have revealed that X-ray repair cross complementary gene polymorphism significantly varies between and within different ethnic groups globally. The present case–control study was aimed to investigate the association of X-ray repair cross complementary 1A (Arg194Trp) and X-ray repair cross complementary 3 (Thr241Met) polymorphism with the risk of breast cancer in females from northeastern region of India. The present case–control study includes histopathologically confirmed and newly diagnosed 464 cases with breast cancer and 534 apparently healthy neighborhood community controls. Information on sociodemographic factors and putative risk factors were collected from each study participant by conducting face-to-face interviews. Genotyping of X-ray repair cross complementary 1A (Arg194Trp) and X-ray repair cross complementary 3 (Thr241Met) was carried out by polymerase chain reaction-restriction fragment length polymorphism. For statistical analysis, both univariate and multivariate logistic regression analyses were performed. We also performed stratified analysis to find out the association of X-ray repair cross complementary genes with the risk of breast cancer stratified based on menstrual status. This study revealed that tryptophan allele (R/W-W/W genotype) in X-ray repair cross complementary 1A (Arg194Trp) gene significantly increased the risk of breast cancer (adjusted odds ratio = 1.44, 95% confidence interval = 1.06-1.97, P India which may be beneficial for prognostic purposes. PMID:29332455
An Evolving Compact Jet in the Black Hole X-Ray Binary Maxi J1836-194
Russell, D. M.; Russell, T. D.; Miller-Jones, J. C. A.; O'Brien, K.; Soria, R.; Sivakoff, G. R.; Slaven-Blair, T.; Lewis, F.; Markoff, S.; Homan, J.;
2013-01-01
We report striking changes in the broadband spectrum of the compact jet of the black hole transient MAXI J1836-194 over state transitions during its discovery outburst in 2011. A fading of the optical-infrared (IR) flux occurred as the source entered the hard-intermediate state, followed by a brightening as it returned to the hard state. The optical-IR spectrum was consistent with a power law from optically thin synchrotron emission, except when the X-ray spectrum was softest. By fitting the radio to optical spectra with a broken power law, we constrain the frequency and flux of the optically thick/thin break in the jet synchrotron spectrum. The break gradually shifted to higher frequencies as the source hardened at X-ray energies, from approx 10(exp 11) to approx 4 × 10(exp 13) Hz. The radiative jet luminosity integrated over the spectrum appeared to be greatest when the source entered the hard state during the outburst decay (although this is dependent on the high-energy cooling break, which is not seen directly), even though the radio flux was fading at the time. The physical process responsible for suppressing and reactivating the jet (neither of which are instantaneous but occur on timescales of weeks) is uncertain, but could arise from the varying inner accretion disk radius regulating the fraction of accreting matter that is channeled into the jet. This provides an unprecedented insight into the connection between inflow and outflow, and has implications for the conditions required for jets to be produced, and hence their launching process.
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
Legartová, S; Sbardella, G; Kozubek, S; Bártová, E
2015-01-01
We studied the effect of ellagic acid (EA) on the morphology of nucleoli and on the pattern of major proteins of the nucleolus. After EA treatment of HeLa cells, we observed condensation of nucleoli as documented by the pattern of argyrophilic nucleolar organizer regions (AgNORs). EA also induced condensation of RPA194-positive nucleolar regions, but no morphological changes were observed in nucleolar compartments positive for UBF1/2 proteins or fibrillarin. Studied morphological changes induced by EA were compared with the morphology of control, non-treated cells and with pronounced condensation of all nucleolar domains caused by actinomycin D (ACT-D) treatment. Similarly as ACT-D, but in a lesser extent, EA induced an increased number of 53BP1-positive DNA lesions. However, the main marker of DNA lesions, γH2AX, was not accumulated in body-like nuclear structures. An increased level of γH2AX was found by immunofluorescence and Western blots only after EA treatment. Intriguingly, the levels of fibrillarin, UBF1/2 and γH2AX were increased at the promoters of ribosomal genes, while 53BP1 and CARM1 levels were decreased by EA treatment at these genomic regions. In the entire genome, EA reduced H3R17 dimethylation. Taken together, ellagic acid is capable of significantly changing the nucleolar morphology and protein levels inside the nucleolus.
Le Pimpec, F; Laurent, Jean Michel
2003-01-01
Photon stimulated molecular desorption from a nonevaporable getter (NEG) St 707(R) (SAES Getters TM ) surface after conditioning and after saturation with isotopic carbon monoxide Ýcf. nomenclature in Handbook of Chemistry and Physics, 74th edition, edited by D. R. Lide (CRC Press, Boca Raton, 1994)¿ /sup 13/C/sup 18/O, has been studied on a dedicated beamline at the EPA ring at CERN. The synchrotron radiation of 194 eV critical energy and with an average photon intensity of ~1 * 10/sup 17/ photons s/sup -1/ was impinging on the sample at perpendicular incidence. It is found that the desorption yields eta (molecules/photon) of the characteristic gases in an UHV system (hydrogen, methane, carbon monoxide, and carbon dioxide) for a freshly activated NEG and for a NEG fully saturated with /sup 13/C /sup 18/O are lower than that of 300 degrees C baked stainless steel. (22 refs). Fully activated NEG was studied and found to desorb less as compared to a 300 degree c baked stainless-steel surface. Furthermore, it ...
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
Directory of Open Access Journals (Sweden)
Lyakhovitskii M.M.
2011-05-01
Full Text Available The structure evolution of alloys in solidification range is considered as the first-order phase transformation from the solid state to the liquid one, which occurs by the mechanism of nucleation and growth of more symmetrical phase to less symmetrical crystalline phase. The kinetic regularities of this transformation are studied by the method of the photometric analysis of structure images (PHASI, which makes it possible to establish the temperature dependence of the relationship between the solid and liquid phases and their distribution on the melt surface. The PHASI method is based on the combined analysis of the brightness spectra of the visible light reflections from the sample surface and of the distribution of its scattering centers in different intensity intervals. The data on the structure evolution of the Sn+19.4%Pb alloy upon melting and solidification were considered in parallel with the measured spectra of sound signals. It was revealed that a distinct maximum is observed in the temperature dependence of radiation energy in the temperature range of phase transformation from the liquid into the solid state and hot crack formation occurs near the transition zone in the region of the contact of the ingot with the crucible.
Energy Technology Data Exchange (ETDEWEB)
Gold, Christian
2014-02-04
In addition to the high-temperature superconductors, the so-called heavy fermion systems are among the most fascinating representatives of strongly correlated electron systems. Caused by the competition of Kondo effect, RKKY interaction and electrostatic crystal field effects these compounds reveal a wide variety of different ground state properties. For example, many of these systems are located in the vicinity of a magnetic instability. At such a quantum critical point a continuous transition between two states with different symmetry occurs at absolute zero temperature. Apart from the three classic tuning parameters (i) chemical substitution, (ii) hydrostatic pressure, and (iii) external magnetic field also the reduction of the effective spin degeneracy N, i.e. the reduction of the number of crystal field levels which are shielded by the Kondo effect seems to induce quantum critical behavior. The proximity to a quantum critical point together with an unusually high effective spin degeneracy of N=4 make the ternary 1-9-4 compound CeNi{sub 9}Ge{sub 4} the perfect starting system for experimental studies of this new parameter. For the first and so far only time such a scenario could be observed in the substitution series CeNi{sub 9-x}Cu{sub x}Ge{sub 4} (0≤x≤1). Extensive studies show that in this system quantum criticality is not only caused by the balance between Kondo effect and RKKY interaction but also by a reduction of the effective spin degeneracy. The results on the copper series provided the incentive to synthesize and analyze related systems with regard to quantum criticality in the scope of this work. The focus here was on the systems CeNi{sub 9}Ge{sub 4-x}Si{sub x}, CeNi{sub 9}Ge{sub 4-x}Ga{sub x}, CeNi{sub 9-x}Fe{sub x}Ge{sub 4} and CeNi{sub 9-x}Co{sub x}Ge{sub 4}. This thesis was methodologically supported by X-ray studies, theoretical LDA+U calculations and extensive thermodynamic and magnetic investigations on the macroscopic and microscopic
Addiss, R. R., Jr.; Lawson, P. A.
1980-06-01
The design and performance of a photovoltaic power system is discussed. The 194 kW system consists of the photovoltaic array, the inverter/control subsystem, the building and utility interface, and the monitoring subsystem. The photovoltaic array consists of 56 separate subarrays of 112 photovoltaic modules each, deployed in rows on the southerly facing slope north of the school building. The wiring scheme permits individual modules to be disconnected without a radical change in subarray output current. Power is transmitted at 4160 V from the inverters and a step up transformer to the main 4160 V utility feed line in the school. Separate metering measures power bought and sold. At the optimum tilt angle of 40 deg, the array provides 232 MWH of AC energy annually, or 17 percent of the school load. The immediate impact is an $8000 saving in the annual utility bill. Levelized busbar energy costs are reduced from $2/kWH to $1/kWH when site specific parameters are used in the analysis instead of the JPL specified nominal values. A fault detection and isolation scheme which can find a single modulus failure is incorporated into the monitoring subsystem.
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
Directory of Open Access Journals (Sweden)
Claudius Bachmann
2016-07-01
Full Text Available In the light of the far-reaching leadership failures and business scandals of the last decades, the question has often been raised of whether we are reaping the results of the practical application of abstract management theory which is actually counteracting a socially, environmentally, and economically sustainable market economy. In this sense, Pope Francis recently called for ‘new models of progress’ to reflect on ‘the meaning of the economy and its goals’ (LS 194. To answer these calls, I first provide an overview of the recent discourse in leadership and organizational studies that have critically scrutinized the established theories and models of mainstream business. Second, I draw on the Apostolic Exhortation Evangelii Gaudium and the Encyclical Laudato Si’ to derive the cornerstones of an ‘evangelizing approach’ to the guiding principles of management theory and practice suggested by Pope Francis. Third, to facilitate this renewal, I introduce the ancient idea of practical wisdom (prudence which has recently enjoyed a remarkable renaissance in the literature and is considered as a new transformative paradigm for management theory and practice.
International Nuclear Information System (INIS)
Aran, S.; Shaqdan, K.W.; Abujudeh, H.H.
2015-01-01
Aim: To report the authors' experience with the administration of four gadolinium-based contrast agents (GBCA; gadopentetate dimeglumine, gadofosveset trisodium, gadoxetate disodium and gadobenate dimeglumine) in a large study population at a single, large academic medical centre. Materials and methods: The institutional review board approved this retrospective study in which data in the electronic incident reporting system were searched. A total of 194, 400 intravenous administrations of linear ionic GBCAs were assessed for the incidence of adverse reactions and risk factors from 1 January 2007 to 14 January 2014. The severity of reactions (mild, moderate, and severe), patient type (outpatients, inpatients, and emergency), examination type, and treatment options were also investigated. Results: In total, 204/194400 (0.1%) patients (mean age 45.7 ± 14.9) showed adverse reactions, consisting of 6/746 (0.80%), 10/3200 (0.31%), 14/6236 (0.22%) and 174/184218 (0.09%), for gadofosveset trisodium, gadoxetate disodium, gadobenate dimeglumine, and gadopentetate dimeglumine, respectively. An overall significant difference was found between different GBCAs regarding the total number of reactions (p < 0.0001). When comparing the GBCAs together, significant differences were found between gadofosveset trisodium versus gadopentetate dimeglumine (p < 0.0001), gadofosveset trisodium versus gadobenate dimeglumine (p = 0.0051), gadoxetate disodium versus gadopentetate dimeglumine (p < 0.0001) and gadopentetate dimeglumine versus gadobenate dimeglumine (p = 0.0013). Rate of reaction was higher in females (F: 146/113187, 0.13%/M: 58/81213, 0.07%; p < 0.0001). Rate of reactions was higher in outpatient (180/158885, 0.11%), emergency (10/10413, 0.10%), and inpatients (14/25102, 0.05%), respectively (p < 0.0001). Most of the patients had mild symptoms 171/204 (83.8%). Abdomen–pelvis, liver, and thoracic examinations had highest rates of reactions (0.17 versus 0
Directory of Open Access Journals (Sweden)
Behera B.R.
2015-01-01
Full Text Available In this talk results of the evaporation residue (ER cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr and 16,18O+198Pt (forming compound nuclei 214,216Rn systems measured at Hybrid Recoil mass Analyzer (HYRA spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC, New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer’s fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.
Behera, B. R.
2015-01-01
In this talk results of the evaporation residue (ER) cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr) and 16,18O+198Pt (forming compound nuclei 214,216Rn) systems measured at Hybrid Recoil mass Analyzer (HYRA) spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC), New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer's fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
Energy Technology Data Exchange (ETDEWEB)
Hacklaender, Daniel
2010-07-01
With the coming into force of the Lisbon treaty, the internal measures and policies of the European Union were supplemented by the independent title ''Energy''. While the need for supranational management of energy-political task was recognized at an early stage already, the legal instruments for this purpose were lacking. Article 194 of the Treaty on the Functioning of the European Union now provides a legal basis for a comprehensive, interdisciplinary energy policy on a European scale. The author investigates the content of the energy article. He shows that the modification of the treaty has brought about greater competences of the Union, especially in the field of energy supply assurance which is greatly influenced by the new regulations on energy solidarity. The book also discusses problems of competing legislation resulting from interdependences between the energy article on the one hand and competence standards with other goals on the other hand and also attempts to define the specific limits of energy competence. (orig.)
Khella, H W Z; Bakhet, M; Allo, G; Jewett, M A S; Girgis, A H; Latif, A; Girgis, H; Von Both, I; Bjarnason, G A; Yousef, G M
2013-10-01
MicroRNAs (miRNAs) play a crucial role in tumor progression and metastasis. We, and others, recently identified a number of miRNAs that are dysregulated in metastatic renal cell carcinoma compared with primary renal cell carcinoma. Here, we investigated three miRNAs that are significantly downregulated in metastatic tumors: miR-192, miR-194 and miR-215. Gain-of-function analyses showed that restoration of their expression decreases cell migration and invasion in renal cell carcinoma cell line models, whereas knockdown of these miRNAs resulted in enhancing cellular migration and invasion abilities. We identified three targets of these miRNAs with potential role in tumor aggressiveness: murine double minute 2, thymidylate synthase, and Smad Interacting protein 1/zinc finger E-box binding homeobox 2. We observed a convergent effect (the same molecule can be targeted by all three miRNAs) and a divergent effect (the same miRNA can control multiple targets) for these miRNAs. We experimentally validated these miRNA-target interactions using three independent approaches. First, we observed that miRNA overexpression significantly reduces the mRNA and protein levels of their targets. In the second, we observed significant reduction of the luciferase signal of a vector containing the 3'UTR of the target upon miRNA overexpression. Finally, we show the presence of inverse correlation between miRNA changes and the expression levels of their targets in patient specimens. We also examined the prognostic significance of miR-215 in renal cell carcinoma. Lower expression of miR-215 is associated with significantly reduced disease-free survival time. These findings were validated on an independent data set from The Cancer Genome Atlas. These results can pave the way to the clinical use of miRNAs as prognostic markers and therapeutic targets.
2010-10-01
..., while the midsagittal plane of the dummy is in vertical orientation. (4) Push the dummy at the knees and... back until the back of the upper torso is in contact with the seat back. (5) While maintaining the...
Energy Technology Data Exchange (ETDEWEB)
Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Oh, Joo-Hee [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)
2016-05-15
The proton beam intensity of a 100-MeV proton linac at the Korea Multi-purpose Accelerator Complex (KOMAC) was measured by an Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions to determine the accuracy and precision of beam intensity measurement using Gafchromic film dosimetry method. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of Au, Al foils and Pb plates. The yields of produced radio-nuclei in Au foils were obtained by gamma-ray spectroscopy. The FLUKA code was employed to calculate the energy spectrum of protons onto the front surface of Au foils located at three different depth points of the target and also to investigate the condition of incident beam on the target. A good agreement was found between the beam intensity measurements using the activation analysis method at three different depth points of the target. An excellent agreement was also observed between the beam intensity measurements using the Au activation analysis method and the dosimetry method using Gafchromic film.
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
Publications | Page 194 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Actuaries assess risks involved in insurance and pensions, through proper product design, pricing, development of underwriting standards, determination of asset management strategies, claims analysis, ... Adding salary from the defeso to tourism earnings could encourage fishermen to restrict their fishing activities in the.
40 CFR 194.26 - Expert judgment.
2010-07-01
... CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements... experts (by name and employer) involved in any expert judgment elicitation processes used to support the... judgment elicitation processes and the reasoning behind those results. Documentation of interviews used to...
46 CFR 194.15-3 - Responsibility.
2010-10-01
... scientific party embarked may supervise the safety and operation of the chemical laboratory. (b) The laboratory supervisor shall: (1) Maintain the highest standards of safe working conditions. (2) Provide... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND...
Publications | Page 194 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
ENACQKT-ing : Caribbean nurses enhancing care, quality and knowledge through technology; final technical report (open access). Five Caribbean countries were selected to introduce, integrate and embed ICTs within their healthcare systems in a developing country context. As the project progressed there was an ...
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
Czech Academy of Sciences Publication Activity Database
Fornůsková, Alena; Vinkler, M.; Pages, M.; Galan, M.; Jousselin, E.; Cerqueira, F.; Morand, S.; Charbonnel, N.; Bryja, Josef; Cosson, J.-F.
2013-01-01
Roč. 13, č. 194 (2013), s. 194 ISSN 1471-2148 R&D Projects : GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : Arms race * Host-pathogen interaction * Pattern recognition receptors * Adaptive evolution * Pathogen-Associated Molecular Pattern (PAMP) Subject RIV: EG - Zoology Impact factor: 3.407, year: 2013 http://www.biomedcentral.com/1471-2148/13/194
Interferon production and immune response induction in pathogenic rabies virus-infected mice
Energy Technology Data Exchange (ETDEWEB)
Marcovistz, R; Leal, E C; De Souza Matos, D C [Departamento de Immunologia, Instituto Oswaldo Cruz, Caixa Postal 926, 21045 Rio de Janeiro (Brazil); Tsiang, H [Service Rage, Istitut Pasteur, Paris (France)
1994-08-01
Pathogenic parental rabies virus strain CVS (challenge virus standard) and its apathogenic variant RV194-2 were shown to differ in their ability to induce interferon (IFN) and immune response of the host. After intracerebral inoculation. IFN and antibody production was higher in the RV194-2 virus-infected mice than in the CVS infection. The enhancement of 2-5A synthetase activity, an IFN-mediated enzyme marker, showed biochemical evidence that IFN is active in both apathogenic and pathogenic infections. On the other hand, spontaneous proliferation in vitro of thymocytes and splenocytes from CVS virus-infected mice was strongly inhibited in contrast to the RV194-2 infection. In the CVS infection, the thymocyte proliferation However, in the RV194-2 infection, the thymocyte proliferation was higher than of the splenocytes. These results suggest a better performance of T-cell response to the RV194-2 infection. This fact can be critical for an enhancement of antibody production in the apathogenic infection and subsequent virus clearance from the brain of RV194-2 virus-infected mice. (author) 1 fig., 3 tabs., 32 refs.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
27 CFR 26.194 - Detention of articles.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Detention of articles. 26..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Shipment of... Detention of articles. (a) Upon receiving a notification in accordance with § 26.193(b), the appropriate TTB...
29 CFR 19.4 - Contents of request.
2010-07-01
..., business address and business phone number. The request shall also contain the following: (a) The identity of the customer or customers to whom the records pertain; (b) A reasonable description of the records... cases where customer notice is delayed by a court order, a copy of the court order shall be attached to...
40 CFR 60.194 - Monitoring of operations.
2010-07-01
... bake plant. If the owner or operator show that emissions from the primary control system or the anode bake plant have low variability during day-to-day operations, the Administrator may establish such an... the case of a primary control system, the method to be used to determine primary control system...
49 CFR 194.105 - Worst case discharge.
2010-10-01
... capacity of the pipeline), plus the largest line drainage volume after shutdown of the line section(s) in... credits for breakout tank secondary containment and other specific spill prevention measures as follows: Prevention measure Standard Credit(percent) Secondary containment > 100% NFPA 30 50 Built/repaired to API...
46 CFR 194.05-3 - Chemical stores.
2010-10-01
... shall be classed, marked and labeled in accordance with 49 CFR part 172: (1) Explosives. (2) Flammable liquids. (3) Flammable solids. (4) Oxidizing materials. (5) Corrosive materials. (6) Compressed gasses. (7) Poisons. (8) Combustible liquids. (9) Other Regulated Materials (DOT Hazard Class “ORM”). (b) Substances...
International Nuclear Information System (INIS)
Shirley, Yancy L.; Svoboda, Brian; Ellsworth-Bowers, Timothy P.; Schlingman, Wayne M.; Ginsburg, Adam; Battersby, Cara; Stringfellow, Guy; Glenn, Jason; Bally, John; Rosolowsky, Erik; Gerner, Thomas; Mairs, Steven; Dunham, Miranda K.
2013-01-01
The Bolocam Galactic Plane Survey (BGPS) is a 1.1 mm continuum survey of dense clumps of dust throughout the Galaxy covering 170 deg 2 . We present spectroscopic observations using the Heinrich Hertz Submillimeter Telescope of the dense gas tracers, HCO + and N 2 H + 3-2, for all 6194 sources in the BGPS v1.0.1 catalog between 7.°5 ≤ l ≤ 194°. This is the largest targeted spectroscopic survey of dense molecular gas in the Milky Way to date. We find unique velocities for 3126 (50.5%) of the BGPS v1.0.1 sources observed. Strong N 2 H + 3-2 emission (T mb > 0.5 K) without HCO + 3-2 emission does not occur in this catalog. We characterize the properties of the dense molecular gas emission toward the entire sample. HCO + is very sub-thermally populated and the 3-2 transitions are optically thick toward most BGPS clumps. The median observed line width is 3.3 km s –1 consistent with supersonic turbulence within BGPS clumps. We find strong correlations between dense molecular gas integrated intensities and 1.1 mm peak flux and the gas kinetic temperature derived from previously published NH 3 observations. These intensity correlations are driven by the sensitivity of the 3-2 transitions to excitation conditions rather than by variations in molecular column density or abundance. We identify a subset of 113 sources with stronger N 2 H + than HCO + integrated intensity, but we find no correlations between the N 2 H + /HCO + ratio and 1.1 mm continuum flux density, gas kinetic temperature, or line width. Self-absorbed profiles are rare (1.3%)
Role of disulphide bonds in a thermophilic serine protease aqualysin I from Thermus aquaticus YT-1.
Sakaguchi, Masayoshi; Takezawa, Makoto; Nakazawa, Rie; Nozawa, Kazutaka; Kusakawa, Taro; Nagasawa, Takeshi; Sugahara, Yasusato; Kawakita, Masao
2008-05-01
A thermophilic serine protease, Aqualysin I, from Thermus aquaticus YT-1 has two disulphide bonds, which are also found in a psychrophilic serine protease from Vibrio sp. PA-44 and a proteinase K-like enzyme from Serratia sp. at corresponding positions. To understand the significance of these disulphide bonds in aqualysin I, we prepared mutants C99S, C194S and C99S/C194S (WSS), in which Cys69-Cys99, Cys163-Cys194 and both of these disulphide bonds, respectively, were disrupted by replacing Cys residues with Ser residues. All mutants were expressed stably in Escherichia coli. The C99S mutant was 68% as active as the wild-type enzyme at 40 degrees C in terms of k(cat) value, while C194S and WSS were only 6 and 3%, respectively, as active, indicating that disulphide bond Cys163-Cys194 is critically important for maintaining proper catalytic site conformation. Mutants C194S and WSS were less thermostable than wild-type enzyme, with a half-life at 90 degrees C of 10 min as compared to 45 min of the latter and with transition temperatures on differential scanning calorimetry of 86.7 degrees C and 86.9 degrees C, respectively. Mutant C99S was almost as stable as the wild-type aqualysin I. These results indicate that the disulphide bond Cys163-Cys194 is more important for catalytic activity and conformational stability of aqualysin I than Cys67-Cys99.
Energy Technology Data Exchange (ETDEWEB)
Shirley, Yancy L.; Svoboda, Brian [Steward Observatory, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Ellsworth-Bowers, Timothy P.; Schlingman, Wayne M.; Ginsburg, Adam; Battersby, Cara; Stringfellow, Guy; Glenn, Jason; Bally, John [CASA, University of Colorado, CB 389, Boulder, CO 80309 (United States); Rosolowsky, Erik [Department of Physics, University of Alberta, 4-181 CCIS Edmonton AB T6G 2E1 (Canada); Gerner, Thomas [Max-Planck-Institut für Astronomie (MPIA), Knigstuhl 17, D-69117 Heidelberg (Germany); Mairs, Steven [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, STN CSC, Victoria, BC V8W 3P6 (Canada); Dunham, Miranda K. [Department of Astronomy, Yale University, P.O. Box 208101, New Haven, CT 06520 (United States)
2013-11-01
The Bolocam Galactic Plane Survey (BGPS) is a 1.1 mm continuum survey of dense clumps of dust throughout the Galaxy covering 170 deg{sup 2}. We present spectroscopic observations using the Heinrich Hertz Submillimeter Telescope of the dense gas tracers, HCO{sup +} and N{sub 2}H{sup +} 3-2, for all 6194 sources in the BGPS v1.0.1 catalog between 7.°5 ≤ l ≤ 194°. This is the largest targeted spectroscopic survey of dense molecular gas in the Milky Way to date. We find unique velocities for 3126 (50.5%) of the BGPS v1.0.1 sources observed. Strong N{sub 2}H{sup +} 3-2 emission (T {sub mb} > 0.5 K) without HCO{sup +} 3-2 emission does not occur in this catalog. We characterize the properties of the dense molecular gas emission toward the entire sample. HCO{sup +} is very sub-thermally populated and the 3-2 transitions are optically thick toward most BGPS clumps. The median observed line width is 3.3 km s{sup –1} consistent with supersonic turbulence within BGPS clumps. We find strong correlations between dense molecular gas integrated intensities and 1.1 mm peak flux and the gas kinetic temperature derived from previously published NH{sub 3} observations. These intensity correlations are driven by the sensitivity of the 3-2 transitions to excitation conditions rather than by variations in molecular column density or abundance. We identify a subset of 113 sources with stronger N{sub 2}H{sup +} than HCO{sup +} integrated intensity, but we find no correlations between the N{sub 2}H{sup +}/HCO{sup +} ratio and 1.1 mm continuum flux density, gas kinetic temperature, or line width. Self-absorbed profiles are rare (1.3%)
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
the development and application of a fabric objective meas
African Journals Online (AJOL)
user
the Fabric Assurance by Simple Testing (FAST). FOM system. .... and longitudinal compressional properties, or ... most likely to be the source of making-up related .... Multiple. R-sq. Adj. R-sq. Blend. 194.4533. 1. 194.4533. 146.438. 0.0000.
46 CFR 194.10-10 - Integral magazine construction.
2010-10-01
... spaces suitable approved incombustible thermal insulation shall be provided to prevent condensation of moisture. (c) Where a tank top forms the magazine deck it shall be insulated with an approved deck covering to prevent condensation of moisture. Tank top manholes shall not be installed in magazines. (d) Light...
Lifescience Database Archive (English)
Full Text Available equences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...nts: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott
40 CFR 194.34 - Results of performance assessments.
2010-07-01
... the probability of exceeding various levels of cumulative release caused by all significant processes and events. (b) Probability distributions for uncertain disposal system parameter values used in... techniques, which draw random samples from across the entire range of the probability distributions developed...
46 CFR 194.05-7 - Explosives-Detail requirements.
2010-10-01
... shall be constructed of incombustible materials; awnings and tarpaulins shall be fire-resistant and/or flame proof fabric. (3) Items shall be properly secured by using existing vessel structures such as...
South Asia | Page 194 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
It is the outcome of the collaborative PANdora research and development ... $200 US per capita, the Socialist Republic of Viet Nam is one of the world's poorest countries. ... role of foreign private-sector firms, especially from Japan and the United States, in the recent and rapid economic growth and integration in East Asia.
49 CFR 194.107 - General response plan requirements.
2010-10-01
...'s clear understanding of the function of the Federal response structure, including procedures to... organization's role and the Federal On Scene Coordinator's role in pollution response; (ii) Establish... mitigation procedures, (iv) The name, address, and telephone number of the oil spill response organization...
40 CFR 194.5 - Publications incorporated by reference.
2010-07-01
.... Nuclear Regulatory Commission, NUREG-1297 “Peer Review for High-Level Nuclear Waste Repositories... Characterization of High-Level Nuclear Waste Repositories” (excluding section 2.1 (b) and (c)); IBR approved for... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Publications incorporated by reference...
Cranial Defects and Cranioplasty. Part 8. Chapter 194,
1984-01-01
scalp incision is outlined on the skin outside the area of the defect and infiltrated with a local anesthetic containing adrenalin. (c) Margins of the...plate to repair cleft palates in the first instance of an alloplastic material to repair a defect. J. van 14eekren in 1670 is credited with the first...osteomyelitis, infected skull flaps), aseptic necrosis of skull flaps, radionecrosis and electrical burns of skull, con- genital absences of skull
South Asia | Page 194 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Language French. A most valuable contribution not only to the community of development cooperation in the world but also to academia in general for facilitating the understanding of Japan's ODA. — Kimio Fujita, President, Japan International Cooperation Agency (JICA). Until the early 1960s, Japan was a recipient of ODA ...
Pamjat teksta i tekst kak pamjat / Ülle Pärli
Pärli, Ülle
1999-01-01
Bibl. lk. 194. Kokkuvõtted eesti k. "Teksti mälu ja tekst kui mälu" ning inglise k. "The memory of a text and text as a memory", lk. 194-195. Jossif Brodski luuletusest "Järelsõna valmile" ("Posleslovije k basne")
MORPHOLOGICAL ALTERATIONS OF STAPHYLOCOCCUS AUREUS CAUSED BY ARYL ALIPHATIC AMINOALCOHOL DERIVATIVE
Directory of Open Access Journals (Sweden)
Dronova M.
2015-05-01
Full Text Available Increasing of antimicrobial resistance has created a critical need of the novel antimicrobial agents. One of the promising chemical classes for its development are aryl aliphatic aminoalcohols. New compounds of this class were synthesized at the Institute of organic chemistry (Kiev, Ukraine, by Y. Korotkiy. After the screening studies compound KVM-194 was selected as the potent antistaphylococcal agent. The aim of the study was to examine ultrastructural changes in the bacterial cells under the influence of the compound KVM-194. Materials and methods. Staphylococcus aureus ATCC 25923 was used in all experiments. The minimum inhibitory concentration was determined by serial macrodilution method in Mueller-Hinton broth. Bacteria were exposed to the 0,5 MIC and 5 MICs of the KVM- 194 for 1 h and 24 h. Ultrastructure of intact and treated Staphylococcus aureus cells was examined by transmission electron microscopy after contrasting by osmium tetraoxide and lead citrate. Results and Discussion. The compound KVM-194 possesses a distinct antibacterial activity against Staphylococcus aureus, the minimum inhibitory concentration is 1.25 μg/ml. We found that exposure to KVM-194 at a subinhibitory concentration resulted in alterations of the cell morphology even after 1 h of treatment. The roughness of the cell surface and emerging of the intracellular particles of different electron density were observed. Increase of the incubation time to 24 h led to detachment of membrane from cytoplasm, multimembrane structures within cells emergence and formation of nonpolar septum. 1 h exposition to suprainhibitory concentration of KVM-194 resulted in nucleoid fragmentation, septum abnormalities and necrosis of some cells. We found that increasing of the incubation period to 24 h led to exacerbation of alterations: cell wall rupture, leakage of cytoplasm and a large number of lysed cells were registered. Conclusion. Observed alterations, suggest the possible
Yamada, Noriaki; Martin, Lukas B; Zechendorf, Elisabeth; Purvis, Gareth S D; Chiazza, Fausto; Varrone, Barbara; Collino, Massimo; Shepherd, Joanna; Heinbockel, Lena; Gutsmann, Thomas; Correa, Wilmar; Brandenburg, Klaus; Marx, Gernot; Schuerholz, Tobias; Brohi, Karim; Thiemermann, Christoph
2017-03-10
To evaluate (1) levels of the host-defense/antimicrobial peptide LL-37 in patients with trauma and hemorrhagic shock (HS) and (2) the effects of a synthetic host-defense peptide; Pep19-4LF on multiple organ failure (MOF) associated with HS. HS is a common cause of death in severely injured patients. There is no specific therapy that reduces HS-associated MOF. (1) LL-37 was measured in 47 trauma/HS patients admitted to an urban major trauma center. (2) Male Wistar rats were submitted to HS (90 min, target mean arterial pressure: 27-32 mm Hg) or sham operation. Rats were treated with Pep19-4LF [66 (n = 8) or 333 μg/kg · h (n = 8)] or vehicle (n = 12) for 4 hours following resuscitation. Plasma LL-37 was 12-fold higher in patients with trauma/HS compared to healthy volunteers. HS rats treated with Pep19-4LF (high dose) had a higher mean arterial pressure at the end of the 4-hour resuscitation period (79 ± 4 vs 54 ± 5 mm Hg) and less renal dysfunction, liver injury, and lung inflammation than HS rats treated with vehicle. Pep19-4LF enhanced (kidney/liver) the phosphorylation of (1) protein kinase B and (2) endothelial nitric oxide synthase. Pep19-4LF attenuated the HS-induced (1) translocation of p65 from cytosol to nucleus, (2) phosphorylation of IκB kinase on Ser, and (3) phosphorylation of IκBα on Ser resulting in inhibition of nuclear factor kappa B and formation of proinflammatory cytokines. Pep19-4LF prevented the release of tumor necrosis factor alpha caused by heparan sulfate in human mononuclear cells by binding to this damage-associated molecular pattern. Trauma-associated HS results in release of LL-37. The synthetic host-defense/antimicrobial peptide Pep19-4LF attenuates the organ injury/dysfunction associated with HS.
Superdeformation in the A = 190 region. The lead nuclei
Energy Technology Data Exchange (ETDEWEB)
Henry, E A; Becker, J A; Brinkman, M J; Kuhnert, A; Stoyer, M A; Wang, T F; Yates, S W [Lawrence Livermore National Lab., CA (United States); Azaiez, F A; Beausang, C W; Burde, J; Deleplanque, M A; Diamond, R M; Draper, J E; Kelly, W H; Korton, W; Macchiavelli, A O; Oliveira, J; Rubel, E; Stephens, F S [Lawrence Berkeley Lab., CA (United States); Cizewski, J A [Rutgers--the State Univ., New Brunswick, NJ (United States)
1992-08-01
Superdeformed (SD) bands have been identified in the four even-even lead nuclei {sup 192}Pb, {sup 194}Pb, {sup 196}Pb, and {sup 198}Pb. The discovery of SD bands in these nuclei extended the region of superdeformation in the A = 190 region to Z = 82, and to neutron numbers up to N = 116. All of the SD bands in these nuclei are observed with transition energies ranging from about 250 keV to about 600 keV, with the lowest energy SD band transition for the entire region of 169 keV in {sup 194}Pb. The spins deduced for the lowest levels in the SD bands are 6, 8, and 12 for {sup 192,194,196,198}Pb, respectively. The dynamic moments of inertia of {sup 192}Pb and {sup 194}Pb are similar to each other, and to those of many other SD bands in this mass region. The dynamic moments of inertia of {sup 1}`9{sup 6}Pb and {sup 198}Pb are somewhat lower than those of {sup 192,194}Pb at a given frequency. The experimental lifetimes in {sup 194}Pb and the deduced transition quadrupole moments (Qt {approx} 20 eb) are equal to those of other nuclei in the region within errors. While SD bands have been observed in the odd-neutron Hg and Tl nuclei, SD bands have not been reported for the odd-neutron Pb nuclei. In this contribution we discuss briefly three topics on superdeformation in the lead nuclei. First, we have recent experimental data on {sup 196}Pb that extends our knowledge of the SD band in that nucleus. Next we review briefly the population of low-lying yrast levels from the decay of the SD bands in {sup 192,194,196}Pb. Finally, we summarize our efforts to identify superdeformation in the odd-A Pb nuclei. All of the experiments described here were performed using the HERA spectrometer at the 88-Inch Cyclotron facility located at Lawrence Berkeley Laboratory. (author) 9 refs., 4 figs.
Jang, Chul Ho; Piao, Yu Lan; Huang, Xiaoqin; Yoon, Eun Jeong; Park, So Hee; Lee, Kyoung; Zhan, Chang-Guo; Cho, Hoon
2016-01-01
Alginate is known to prevent elimination of Pseudomonas aeruginosa biofilms. Alginate lyase (AlgL) might therefore facilitate treatment of Pseudomonas aeruginosa-infected cystic fibrosis patients. However, the catalytic activity of wild-type AlgL is not sufficiently high. Therefore, molecular modeling and site-directed mutagenesis of AlgL might assist in enzyme engineering for therapeutic development. AlgL, isolated from Azotobacter vinelandii, catalyzes depolymerization of alginate via a β-elimination reaction. AlgL was modeled based on the crystal structure template of Sphingomonas AlgL species A1-III. Based on this computational analysis, AlgL was subjected to site-directed mutagenesis to improve its catalytic activity. The kcat/Km of the K194E mutant showed a nearly 5-fold increase against the acetylated alginate substrate, as compared to the wild-type. Double and triple mutants (K194E/K245D, K245D/K319A, K194E/K245D/E312D, and K194E/K245D/K319A) were also prepared. The most potent mutant was observed to be K194E/K245D/K319A, which has a 10-fold improved kcat value (against acetylated alginate) compared to the wild-type enzyme. The antibiofilm effect of both AlgL forms was identified in combination with piperacillin/tazobactam (PT) and the disruption effect was significantly higher in mutant AlgL combined with PT than wild-type AlgL. However, for both the wild-type and K194E/K245D/K319A mutant, the use of the AlgL enzyme alone did not show significant antibiofilm effect.
Directory of Open Access Journals (Sweden)
Chul Ho Jang
Full Text Available Alginate is known to prevent elimination of Pseudomonas aeruginosa biofilms. Alginate lyase (AlgL might therefore facilitate treatment of Pseudomonas aeruginosa-infected cystic fibrosis patients. However, the catalytic activity of wild-type AlgL is not sufficiently high. Therefore, molecular modeling and site-directed mutagenesis of AlgL might assist in enzyme engineering for therapeutic development. AlgL, isolated from Azotobacter vinelandii, catalyzes depolymerization of alginate via a β-elimination reaction. AlgL was modeled based on the crystal structure template of Sphingomonas AlgL species A1-III. Based on this computational analysis, AlgL was subjected to site-directed mutagenesis to improve its catalytic activity. The kcat/Km of the K194E mutant showed a nearly 5-fold increase against the acetylated alginate substrate, as compared to the wild-type. Double and triple mutants (K194E/K245D, K245D/K319A, K194E/K245D/E312D, and K194E/K245D/K319A were also prepared. The most potent mutant was observed to be K194E/K245D/K319A, which has a 10-fold improved kcat value (against acetylated alginate compared to the wild-type enzyme. The antibiofilm effect of both AlgL forms was identified in combination with piperacillin/tazobactam (PT and the disruption effect was significantly higher in mutant AlgL combined with PT than wild-type AlgL. However, for both the wild-type and K194E/K245D/K319A mutant, the use of the AlgL enzyme alone did not show significant antibiofilm effect.
Distribution of mecA gene amongst Staphylococcus aureus isolates
African Journals Online (AJOL)
Dr Olaleye
Antibiotics susceptibility testing including methicillin sensitivity testing, beta lactamase testing, PCR for detection of mecA gene, and minimum inhibitory concentrations to methicillin were carried out on all the 194 isolates of S. aureus. Among the 194 strains, 40 (20.6%) were MRSA using 10 µg methicillin disc. PCR analysis.
Directory of Open Access Journals (Sweden)
Ming-Hsien Chien
2013-01-01
Full Text Available Angiogenesis and lymphangiogenesis are considered to play key roles in tumor metastasis. Targeting receptor tyrosine kinases essentially involved in the angiogenesis and lymphangiogenesis would theoretically prevent cancer metastasis. However, the optimal multikinase inhibitor for metastasis suppression has yet to be developed. In this study, we evaluated the effect of NSTPBP 0100194-A (194-A, a multikinase inhibitor of vascular endothelial growth factor receptors (VEGFRs/fibroblast growth factor receptors (FGFRs, on lymphangiogenesis and angiogenesis in a mammary fat pad xenograft model of the highly invasive breast cancer cell line 4T1-Luc+. We investigated the biologic effect of 194-A on various invasive breast cancer cell lines as well as endothelial and lymphatic endothelial cells. Intriguingly, we found that 194-A drastically reduced the formation of lung, liver, and lymph node metastasis of 4T1-Luc+ and decreased primary tumor growth. This was associated with significant reductions in intratumoral lymphatic vessel length (LVL and microvessel density (MVD. 194-A blocked VEGFRs mediated signaling on both endothelial and lymphatic endothelial cells. Moreover, 194-A significantly inhibited the invasive capacity induced by VEGF-C or FGF-2 in vitro in both 4T1 and MDA-MB231 cells. In conclusion, these experimental results demonstrate that simultaneous inhibition of VEGFRs/FGFRs kinases may be a promising strategy to prevent breast cancer metastasis.
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
African Journals Online (AJOL)
Items 151 - 194 of 194 ... Vol 20, No 1 (2006), The metamorphosis of Eros: The god of love in early Greek poetry, Abstract PDF. Edward Jennar. Vol 23 (2013), The noun concordance system: some remarks on nouns' participation in Bantu languages syntactic structure, Abstract PDF. Francis Matambirofa. Vol 4, No 1 (1990) ...
African Journals Online (AJOL)
Items 151 - 194 of 194 ... Vol 26 (2010), The Antidepressant-Like Actions of Furosemide, Bumetanide and Nifedipine in the Forced Swim Test in Mice, Abstract. SE Oriaifo, EKI Omogbai. Vol 14 (1998), The antimicrobial effects of Alantisore PG 100, Abstract. R.N.P Nwankwoala, J.F Wariso. Vol 14 (1998), The cardiocascular ...
DEFF Research Database (Denmark)
Lundquist, Rasmus; Nielsen, Leif Kofoed; Jafarshad, Ali
2006-01-01
against MSP-3 residues 194 to 257 (MSP-3(194-257)) on the molecular level. mRNA from peripheral blood leukocytes from clinically immune individuals was used as a source of Fab (fragment antibody) genes. A Fab-phage display library was made, and three distinct antibodies designated RAM1, RAM2, and RAM3...
The structure of nuclei far from beta stability
International Nuclear Information System (INIS)
Zganjar, E.F.
1992-01-01
This report discusses: shape coexistence and intruder states; the electric monopole transition in nuclei; gold isotopes; platinum isotopes; iridium isotopes; search for superdeformation in 192 Hg; search for population of superformed states in 194 Pb using 194 Bi β + -decay; detailed nuclear structure studies far from stability; prototype internal pair spectrometer; and picosecond lifetime spectrometer
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
Local spectrum and local spectral radius of an operator at a fixed vector
Czech Academy of Sciences Publication Activity Database
Bračič, J.; Müller, Vladimír
2009-01-01
Roč. 194, č. 2 (2009), s. 155-162 ISSN 0039-3223 R&D Projects: GA ČR GA201/09/0473 Institutional research plan: CEZ:AV0Z10190503 Keywords : surjectivity spectrum * local spectrum * spectral radius Subject RIV: BA - General Mathematics Impact factor: 0.645, year: 2009 http://journals.impan.pl/cgi-bin/doi?sm194-2-3
40 CFR 194.14 - Content of compliance certification application.
2010-07-01
... vicinity and how these conditions are expected to change and interact over the regulatory time frame. Such... located at or near the horizon of the waste. (3) The presence and characteristics of potential pathways...) Information on materials of construction including, but not limited to: Geologic media, structural materials...
Publications | Page 194 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du ... Contribution à la cohérence de gestion des déchets d'équipements électroniques et informatiques à Dakar : typologie, circuit et valorisation (restricted access) ...
40 CFR 98.194 - Monitoring and QA/QC requirements.
2010-07-01
... Emissions Calculation Protocol for the Lime Industry English Units Version, February 5, 2008 Revision... data in monthly calculations. (e) You must follow the quality assurance/quality control procedures... Industry English Units Version, February 5, 2008 Revision—National Lime Association (incorporated by...
Disorders of sex development: a study of 194 cases
Directory of Open Access Journals (Sweden)
R Walia
2018-02-01
Full Text Available Objective: To study the clinical profile and the management of patients with disorders of sex development (DSD. Design and setting: Retrospective study from a tertiary care hospital of North India. Methods and patients: One hundred ninety-four patients of DSD registered in the Endocrine clinic of Postgraduate Institute of Medical Education and Research, Chandigarh between 1995 and 2014 were included. Results: One hundred and two patients (52.5% had 46,XY DSD and seventy-four patients (38.1% had 46,XX DSD. Sex chromosome DSD was identified in seven (3.6% patients. Of 102 patients with 46,XY DSD, 32 (31.4% had androgen insensitivity syndrome and 26 (25.5% had androgen biosynthetic defect. Of the 74 patients with 46,XX DSD, 52 (70.27% had congenital adrenal hyperplasia (CAH and eight (10.8% had ovotesticular DSD. Five patients with sex chromosome DSD had mixed gonadal dysgenesis. Excluding CAH, majority of the patients (90% presented in the post-pubertal period. One-fourth of the patients with simple virilising CAH were reared as males because of strong male gender identity and behaviour and firm insistence by the parents. Corrective surgeries were performed in twenty patients (20% of 46,XY DSD without hormonal evaluation prior to the presentation. Conclusion: Congenital adrenal hyperplasia is the most common DSD in the present series. Most common XY DSD is androgen insensitivity syndrome, while CAH is the most common XX DSD. Delayed diagnosis is a common feature, and corrective surgeries are performed without seeking a definite diagnosis.
21 CFR 1.94 - Hearing on refusal of admission.
2010-04-01
... application for authorization to relabel or perform other action to bring the article into compliance with the act or to render it other than a food, drug, device, or cosmetic, such testimony shall include...
Shape isomers: Mean-field description and beyond
International Nuclear Information System (INIS)
Bonche, P.; Krieger, S.J.; Weiss, M.S.; Dobaczewski, J.; Meyer, J.
1990-01-01
Nuclear Hartree-Fock (HF) + BCS calculations have led to predictions of shape isomerism in isotopes of Pt, Hg and Os nuclei. These have been confirmed through the observation of superdeformed rotational bands in 190,hor-ellipsis,194 Hg. Encouraged by these measurements and similar observations in 194 Pb, we have extended these calculations to a wide range of contiguous nuclei. These HF results, for 192,194 Pt, 190,hor-ellipsis,198 Hg and 194 Pb, have been employed in a Generator Coordinate Method (GCM) calculation utilizing the quadrupole deformation as the generating variable. The resulting spectra confirm the conclusions drawn from the HF results and agree with those experiments which have been performed. Adding a phenomenological assumption for the moments of inertia of our GCM states, we can construct the radiative transitions within and out of the superdeformed band. The results are in good agreement with the observed de-population of the superdeformed band built upon the shape isomer both in minimum angular momentum and in rapidity of de-population. Inferences for the existence of shape isomers will be drawn. 19 refs., 4 figs
Salz, R O; Ahern, B J; Boston, R; Begg, L M
2016-04-01
To determine the variation of tracheal mucus scores, tracheal blood scores and transendoscopic tracheal wash (TW) cytology in a population of Thoroughbred (TB) racehorses and assess their association with racing performance. A total of 220 endoscopic examinations were performed and TWs obtained from 155 TB racehorses. Samples were collected 60-120 min following gallop work. Tracheal mucus score, tracheal blood score and TW cytology were analysed and their association with racing performance assessed. Of the total examinations and samples, 194 from 135 horses fitted the criteria for inclusion. The overall prevalence of visible tracheal mucus was 2.5% (5/194) and of increased tracheal mucus was 0%. The prevalence of visible tracheal blood was 8.8% (17/194) and of increased tracheal blood was 4.6% (9/194). A total of 36% (70/194) of TWs contained elevated percentages of neutrophils and of these, 96% (67/70) occurred in the absence of any visible tracheal mucus. There was no significant association between tracheal mucus score or TW cytology and subsequent racing performance. There was a statistically significant association (P = 0.004) between increased tracheal blood scores and poor racing performance. Visible tracheal blood seen after strenuous exercise in clinically normal TB racehorses was a risk factor for poor racing performance, but the presence of airway neutrophilia was not. No horses in this study were found to have increased tracheal mucus, so the association of increased tracheal mucus with racing performance could not be assessed. © 2016 Australian Veterinary Association.
Radić, Zoran; Sit, Rakesh K.; Kovarik, Zrinka; Berend, Suzana; Garcia, Edzna; Zhang, Limin; Amitai, Gabriel; Green, Carol; Radić, Božica; Fokin, Valery V.; Sharpless, K. Barry; Taylor, Palmer
2012-01-01
We present a systematic structural optimization of uncharged but ionizable N-substituted 2-hydroxyiminoacetamido alkylamine reactivators of phosphylated human acetylcholinesterase (hAChE) intended to catalyze the hydrolysis of organophosphate (OP)-inhibited hAChE in the CNS. Starting with the initial lead oxime RS41A identified in our earlier study and extending to the azepine analog RS194B, reactivation rates for OP-hAChE conjugates formed by sarin, cyclosarin, VX, paraoxon, and tabun are enhanced severalfold in vitro. To analyze the mechanism of intrinsic reactivation of the OP-AChE conjugate and penetration of the blood-brain barrier, the pH dependence of the oxime and amine ionizing groups of the compounds and their nucleophilic potential were examined by UV-visible spectroscopy, 1H NMR, and oximolysis rates for acetylthiocholine and phosphoester hydrolysis. Oximolysis rates were compared in solution and on AChE conjugates and analyzed in terms of the ionization states for reactivation of the OP-conjugated AChE. In addition, toxicity and pharmacokinetic studies in mice show significantly improved CNS penetration and retention for RS194B when compared with RS41A. The enhanced intrinsic reactivity against the OP-AChE target combined with favorable pharmacokinetic properties resulted in great improvement of antidotal properties of RS194B compared with RS41A and the standard peripherally active oxime, 2-pyridinealdoxime methiodide. Improvement was particularly noticeable when pretreatment of mice with RS194B before OP exposure was combined with RS194B reactivation therapy after the OP insult. PMID:22343626
Description of identical superdeformed bands of the A ∝ 190 mass region
International Nuclear Information System (INIS)
Dadwal, Anshul; Mittal, H.M.
2017-01-01
The two-parameter formula/model viz. nuclear softness (NS) formula, semiclassical particle rotor model (PRM) and exponential model with pairing attenuation are used for the reliable phenomenological analysis of identical superdeformed bands. These formulae/models are employed to study the identical superdeformed bands of the A ∝ 190 mass region, {"1"9"1Hg(2), "1"9"3Hg(2)}, {"1"9"1Hg(3), "1"9"3Hg(3)}, {"1"9"3Tl(3), "1"9"3Tl(5)}, {"1"9"3Tl(1), "1"9"4Tl(3)}, {"1"9"3Tl(1), "1"9"4Tl(4)}, {"1"9"3Pb(3), "1"9"1Hg(2)}, {"1"9"3Pb(4), "1"9"1Hg(3)}, {"1"9"4Pb(1), "1"9"2Hg(1)}, {"1"9"4Pb(1), "1"9"4Hg(1)} and middle-point identical bands {"1"9"3Tl(1), "1"9"3Tl(2)}, {"1"9"3Tl(1), "1"9"5Tl(1)} and {"1"9"3Tl(2), "1"9"5Tl(2)}. Quantitatively, good results of γ-ray transitions energies and dynamic moment of inertia are obtained using the NS formula. The parameters, band-head moment of inertia (I_0), alignment (i) and effective pairing parameter (Δ_0) are calculated using the least-squares fitting of the γ-ray transitions energies in the NS formula, semiclassical PRM and exponential model with pairing attenuation, respectively. The calculated parameters are found to depend sensitively on the proposed band-head spin. (orig.)
Description of identical superdeformed bands of the A ∝ 190 mass region
Energy Technology Data Exchange (ETDEWEB)
Dadwal, Anshul; Mittal, H.M. [Dr. B.R. Ambedkar National Institute of Technology, Jalandhar (India)
2017-06-15
The two-parameter formula/model viz. nuclear softness (NS) formula, semiclassical particle rotor model (PRM) and exponential model with pairing attenuation are used for the reliable phenomenological analysis of identical superdeformed bands. These formulae/models are employed to study the identical superdeformed bands of the A ∝ 190 mass region, {"1"9"1Hg(2), "1"9"3Hg(2)}, {"1"9"1Hg(3), "1"9"3Hg(3)}, {"1"9"3Tl(3), "1"9"3Tl(5)}, {"1"9"3Tl(1), "1"9"4Tl(3)}, {"1"9"3Tl(1), "1"9"4Tl(4)}, {"1"9"3Pb(3), "1"9"1Hg(2)}, {"1"9"3Pb(4), "1"9"1Hg(3)}, {"1"9"4Pb(1), "1"9"2Hg(1)}, {"1"9"4Pb(1), "1"9"4Hg(1)} and middle-point identical bands {"1"9"3Tl(1), "1"9"3Tl(2)}, {"1"9"3Tl(1), "1"9"5Tl(1)} and {"1"9"3Tl(2), "1"9"5Tl(2)}. Quantitatively, good results of γ-ray transitions energies and dynamic moment of inertia are obtained using the NS formula. The parameters, band-head moment of inertia (I{sub 0}), alignment (i) and effective pairing parameter (Δ{sub 0}) are calculated using the least-squares fitting of the γ-ray transitions energies in the NS formula, semiclassical PRM and exponential model with pairing attenuation, respectively. The calculated parameters are found to depend sensitively on the proposed band-head spin. (orig.)
Analysis and analytical techniques
Energy Technology Data Exchange (ETDEWEB)
Batuecas Rodriguez, T [Department of Chemistry and Isotopes, Junta de Energia Nuclear, Madrid (Spain)
1967-01-01
). For any analytical technique to be efficient two pre-requisites must be met: The sample must be truly representative; and the results must be available at the time when required. The papers mentioned here are PL-194/3, PL-194/4, PL-194/6, PL-194/7, PL-194/8 and PL-194/11, of which abstracts are given in Section III.
Correlating single nucleotide polymorphisms in the myostatin gene with performance traits in rabbit
Directory of Open Access Journals (Sweden)
E.M. Abdel-Kafy
2016-09-01
Full Text Available The Myostatin (MSTN, or Growth and Differentiation Factor 8 (GDF8, gene has been implicated in the double muscling phenomenon, in which a series of mutations render the gene inactive and unable to properly regulate muscle fibre deposition. Single nucleotide polymorphisms (SNPs in the MSTN gene have been correlated to production traits, making it a candidate target gene to enhance livestock and fowl productivity. This study aimed to assess any association of three SNPs in the rabbit MSTN gene (c.713T>A in exon 2, c.747+34C>T in intron 2, and c.*194A>G in 3’-untranslated region and their combinations, with carcass, production and reproductive traits. The investigated traits included individual body weight, daily body weight gain, carcass traits and reproductive traits. The 3 SNPs were screened using PCR-restriction fragment length polymorphism (RFLP-based analysis and the effects of the different SNP genotypes and their combinations were estimated in a rabbit population. Additionally, additive and dominance effects were estimated for significant traits. The results found no significant association between the c.713 T>A SNP and all the examined traits. Allele T at the c.747+34C>T SNP was only significantly associated (PG, allele G was significantly associated (PG SNP also had positive effects on most carcass traits. The estimated additive genetic effect for the c.*194A>G SNP was significant (PA and c.747+34C>T, GG at the c.*194A>G SNP correlated with highest values in body weight and daily weight gain. In conclusion, the ‘G’ allele at the c.*194A>G SNP had positive effects on growth and carcass traits and so could be used as a favourable allele in planning rabbit selection. Further population-wide studies are necessary to test the association of the c.*194A>G SNP with carcass traits. We also recommend evaluation of the potential effects of the c.*194A>G SNP on MSTN gene expression.
Zhao, Ying; Song, Kaishan; Shang, Yingxin; Shao, Tiantian; Wen, Zhidan; Lv, Lili
2017-08-01
The spatial characteristics of fluorescent dissolved organic matter (FDOM) components in river waters in China were first examined by excitation-emission matrix spectra and fluorescence regional integration (FRI) with the data collected during September to November between 2013 and 2015. One tyrosine-like (R1), one tryptophan-like (R2), one fulvic-like (R3), one microbial protein-like (R4), and one humic-like (R5) components have been identified by FRI method. Principal component analysis (PCA) was conducted to assess variations in the five FDOM components (FRί (ί = 1, 2, 3, 4, and 5)) and the humification index for all 194 river water samples. The average fluorescence intensities of the five fluorescent components and the total fluorescence intensities FSUM differed under spatial variation among the seven major river basins (Songhua, Liao, Hai, Yellow and Huai, Yangtze, Pearl, and Inflow Rivers) in China. When all the river water samples were pooled together, the fulvic-like FR3 and the humic-like FR5 showed a strong positive linear relationship (R2 = 0.90, n = 194), indicating that the two allochthonous FDOM components R3 and R5 may originate from similar sources. There is a moderate strong positive correlation between the tryptophan-like FR2 and the microbial protein-like FR4 (R2 = 0.71, n = 194), suggesting that parts of two autochthonous FDOM components R2 and R4 are likely from some common sources. However, the total allochthonous substance FR(3+5) and the total autochthonous substances FR(1+2+4) exhibited a weak correlation (R2 = 0.40, n = 194). Significant positive linear relationships between FR3 (R2 = 0.69, n = 194), FR5 (R2 = 0.79, n = 194), and chromophoric DOM (CDOM) absorption coefficient a(254) were observed, which demonstrated that the CDOM absorption was dominated by the allochthonous FDOM components R3 and R5.
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Search for new candidates for the neutrino-oriented mass determination by electron-capture
Herfurth, F; Boehm, C; Blaum, K; Beck, D
2008-01-01
This proposal is part of an extended program dedicated to the neutrino-mass determination in the electron-capture sector, which aims at ultra-precise mass measurements by Penning traps in combination with cryogenic micro-calorimetry for atomic de-excitation measurements. Here, precise mass measurements with ISOLTRAP are proposed for the orbital electron-capture nuclides $^{194}$Hg and $^{202}$Pb, as well as their daughters, with the goal to determine accurately their Q-values. These values are expected to be the smallest ones among a great variety of known electron-capture precursors. Therefore, these nuclides are strong candidates for an improved electron-neutrino mass determination. We ask for 8 shifts of on-line beam at ISOLDE for mass measurements of $^{194}$Hg, $^{194}$ Au, $^{202}$Pb, and $^{202}$Tl at ISOLTRAP.
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
Polymorphisms of XRCC1 genes and risk of nasopharyngeal carcinoma in the Cantonese population
International Nuclear Information System (INIS)
Cao, Yun; Miao, Xiao-Ping; Huang, Ma-Yan; Deng, Ling; Hu, Li-Fu; Ernberg, Ingemar; Zeng, Yi-Xin; Lin, Dong-Xin; Shao, Jian-Yong
2006-01-01
Nasopharyngeal carcinoma (NPC) is one of the most common cancers in southern China. In addition to environmental factors such as Epstein-Barr virus infection and diet, genetic susceptibility has been reported to play a key role in the development of this disease. The x-ray repair cross-complementing group 1 (XRCC1) gene is important in DNA base excision repair. We hypothesized that two common single nucleotide polymorphisms of XRCC1 (codons 194 Arg→Trp and 399 Arg→Gln) are related to the risk of NPC and interact with tobacco smoking. We sought to determine whether these genetic variants of the XRCC1 gene were associated with the risk of NPC among the Cantonese population in a hospital-based case control study using polymerase chain reaction-restriction fragment length polymorphism analysis. We conducted this study in 462 NPC patients and 511 healthy controls. After adjustment for sex and age, we found a reduced risk of developing NPC in individuals with the Trp194Trp genotype (OR = 0.48; 95% CI, 0.27–0.86) and the Arg194Trp genotype (OR = 0.79; 95% CI, 0.60–1.05) compared with those with the Arg194Arg genotype. Compared with those with the Arg399Arg genotype, the risk for NPC was not significantly different in individuals with the Arg399Gln genotype (OR = 0.82; 95% CI, 0.62–1.08) and the Gln399Gln genotype (OR = 1.20; 95% CI, 0.69–2.06). Further analyses stratified by gender and smoking status revealed a significantly reduced risk of NPC among males (OR = 0.32; 95% CI, 0.14–0.70) and smokers (OR = 0.34; 95% CI, 0.14–0.82) carrying the XRCC1 194Trp/Trp genotype compared with those carrying the Arg/Arg genotype. No association was observed between Arg399Gln variant genotypes and the risk of NPC combined with smoking and gender. Our findings suggest that the XRCC1 Trp194Trp variant genotype is associated with a reduced risk of developing NPC in Cantonese population, particularly in males and smokers. Larger studies are needed to confirm our findings
Uranium Mining and Nuclear Facilities (Prohibitions) Act 1986 No. 194
International Nuclear Information System (INIS)
1986-01-01
The purpose of this Act is to protect the health and safety of the people of New South Wales and its environment. Accordingly it prohibits prospecting or mining for uranium and the construction and operation of nuclear reactors and other facilities in the nuclear fuel cycle. (NEA) [fr
People and things. CERN Courier, Jun 1979, v. 19(4)
International Nuclear Information System (INIS)
Anon.
1979-01-01
On 1 April, six months ahead of schedule, electrons were injected into the 8 GeV electron-positron storage ring, CESR, at Cornell. Two weeks later beam was accumulated at an energy of 5.5 GeV. The contract for the management and construct/on of the conventional facilities of the ISABELLE 400 GeV proton storage rings to be built at the Brookhaven Laboratory has been awarded to the New York firm of Ammann and Whitney. Greatly helped by the quality of the beams from the new linac, the CERN 800 MeV four-ring Booster has achieved several new records which bode well for the role it has to play with the PS in feeding the high energy machines in the coming years
People and things. CERN Courier, Jun 1979, v. 19(4)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1979-06-15
On 1 April, six months ahead of schedule, electrons were injected into the 8 GeV electron-positron storage ring, CESR, at Cornell. Two weeks later beam was accumulated at an energy of 5.5 GeV. The contract for the management and construct/on of the conventional facilities of the ISABELLE 400 GeV proton storage rings to be built at the Brookhaven Laboratory has been awarded to the New York firm of Ammann and Whitney. Greatly helped by the quality of the beams from the new linac, the CERN 800 MeV four-ring Booster has achieved several new records which bode well for the role it has to play with the PS in feeding the high energy machines in the coming years.
Spaceflight 1.94 Micron Tm Fiber Laser Transmitter, Phase II
National Aeronautics and Space Administration — Fibertek will develop a spaceflight prototype 1940 nm, 100 W thulium (Tm) laser suitable for NASA spaceflight and long-duration unmanned aerial vehicle (UAV)...
Spaceflight 1.94 micron Tm Fiber Laser Transmitter, Phase I
National Aeronautics and Space Administration — Fibertek proposes to develop a spaceflight prototype 1940 nm, 100 W thulium (Tm) laser suitable for NASA spaceflight and long-duration unmanned aerial vehicle (UAV)...
Between Truth and Beauty. Symposium 194e – 201c
Czech Academy of Sciences Publication Activity Database
Boháček, Kryštof
2010-01-01
Roč. 2, International Issue 1 (2010), s. 173-195 ISSN 1803-7860 Institutional support: RVO:67985955 Keywords : Plato * Symposium * Gorgias * Agathon * tragic thought * rhetoric * philosophy of power Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0236437
34 CFR 222.194 - Are “in-kind” contributions permissible?
2010-07-01
.... (b) Third party in-kind contributions mean property or services that benefit this grant program and... indirect costs, the provisions of 34 CFR 80.24 govern the allowability and valuation of in-kind contributions, except that it is permissible for a third party to contribute real property to a grantee for a...
49 CFR 194.103 - Significant and substantial harm; operator's statement.
2010-10-01
... located within a 5 mile (8 kilometer) radius of potentially affected public drinking water intakes and could reasonably be expected to reach public drinking water intakes, or (5) Is located within a 1 mile...) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE...
Genomic and proteomic analysis of soybean heritable variations induced by space flight
Institute of Scientific and Technical Information of China (English)
HE Jie; GAO Yong; SUN Ye-qing
2009-01-01
To analyze the biological effects of space environment, the diversity of genomic DNA between the space flight soybean 194(4126) with phenotype of good yield and good fruit quality induced by space flight and the soybean with ground control was studied by amplified fragment length polymorphism (AFLP) method, and the polymorphism of space flight soybean 194(4126) was 3.56%. The differences of protein expression of seeds and leaves between the two kinds of soybeans were analysed by two-dimensional electrophoresis, PDQuest software and MALDI-TOF mass spectrometry. Results show that the loss and decrease of protein expression in 194(4126) soybean are subjected to the space fight of seeds, and three special proteins including Dehydrin, MAT1 and ceQORH are identified. It is concluded that the space environment changes the phenotype and geno-type of soybeans due to the space flight of seeds.
Skliros, E; Sotiropoulos, A; Vasibossis, A; Xipnitos, C; Chronopoulos, I; Razis, N; Merkouris, Panagiotis
2007-01-01
This study aimed to determine hypertension prevalence and levels of awareness, treatment and control of hypertension among diabetic patients using data from the VANK study. The sample consisted of 221 men and women (122/99) diagnosed with type 2 diabetes. Semi-structured interviews were conducted with all participants. Controlled hypertension definition was based on having a systolic blood pressure (BP) of hypertension was 194/221 (87.7%). In total, 34.1% of patients (66/194) were not aware of having hypertension. Of those who were aware of having hypertension (n = 128, 65.9%), all were treated. Among those treated, only 11 persons (11/194, 5.6%) had systolic BP hypertensive patients (n = 128) received antihypertensive drug therapy, in only 8.6% (11/128) the treatment was effective (BP hypertension from primary care physicians, as well as regular surveillance to detect developing hypertension in diabetic patients.
Bogdanos, Dimitrios-Petrou; Baum, Harold; Sharma, Umesh C; Grasso, Alessandro; Ma, Yun; Burroughs, Andrew K; Vergani, Diego
2002-01-01
Antibodies to caseinolytic protease P(177-194) (ClpP(177-194)) of the proteolytic subunit of the Clp complex of Escherichia coli (E. coli) are uniquely present in primary biliary cirrhosis (PBC). Molecular mimicry between the regulatory subunit ClpX and the principal T-cell epitope of pyruvate dehydrogenase complex (PDC-E2) in PBC, has been proposed to account for this. Since ClpP is highly conserved among bacteria we investigated whether the micro-organisms triggering these antibodies may be other than E. coli. E. coli ClpP(177-194) is homologous with ClpP peptides of Yersinia enterocolitica (YEREN) and Haemophilus influenzae (HAEIN). Enzyme linked immunosorbent assay (ELISA) reactivity to these peptides was tested in 45 patients with PBC, 44 pathological and 32 healthy controls. Reactivity to at least one of the ClpP peptides was observed in 21 (47%) PBC patients, 5.8% pathological and 3.1% healthy controls (PECOLI ClpP(177-194), alone or in association with YEREN and/or HAEIN peptides, compared to three (14.2%) reactive with YEREN, two (9.5%) with YEREN/HAEIN and one (4.7%) with HAEIN peptide. Simultaneous reactivity to homologous sequences was due to cross-reactivity as confirmed by competition ELISAs. The PBC-specificity of anti-microbial ClpP reactivity is confirmed: the questions as to primary trigger(s) and relevance to PBC pathogenesis remain open.
Gamma bands in doubly odd rhenium and iridium nuclei
Directory of Open Access Journals (Sweden)
Balodis M.
2015-01-01
Full Text Available Structure of the |K ± 2| bands in doubly-odd nuclei belonging to the transitional deformation region at A∼190 is discussed. Relation of these quasi gamma-bands with the non-axial deformation of the parent two-quasiparticle configurations is studied. Using available experimental information, new tentative |K ± 2| bands are proposed in 188Re, and 192,194Ir nuclei. Coexistence of two-quasiparticle states with different deformation modes is considered in the case of 188Re and 194Ir.
Kim, Yong-Hak; Song, Wooseok; Kim, Jin-Sik; Jiao, Li; Lee, Kangseok; Ha, Nam-Chul
2015-08-01
The bacterial 2-nitroreductase NbaA is the primary enzyme initiating the degradation of 2-nitrobenzoate (2-NBA), and its activity is controlled by posttranslational modifications. To date, the structure of NbaA remains to be elucidated. In this study, the crystal structure of a Cys194Ala NbaA mutant was determined to a 1.7-Å resolution. The substrate analog 2-NBA methyl ester was used to decipher the substrate binding site by inhibition of the wild-type NbaA protein. Tandem mass spectrometry showed that 2-NBA methyl ester produced a 2-NBA ester bond at the Tyr193 residue in the wild-type NbaA but not residues in the Tyr193Phe mutant. Moreover, covalent binding of the 2-NBA methyl ester to Tyr193 reduced the reactivity of the Cys194 residue on the peptide link. The Tyr193 hydroxyl group was shown to be essential for enzyme catalysis, as a Tyr193Phe mutant resulted in fast dissociation of flavin mononucleotide (FMN) from the protein with the reduced reactivity of Cys194. FMN binding to NbaA varied with solution NaCl concentration, which was related to the catalytic activity but not to cysteine reactivity. These observations suggest that the Cys194 reactivity is negatively affected by a posttranslational modification of the adjacent Tyr193 residue, which interacts with FMN and the substrate in the NbaA catalytic site. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Control of key pecan insect pests using biorational pesticides.
Shapiro-Ilan, David I; Cottrell, Ted E; Jackson, Mark A; Wood, Bruce W
2013-02-01
Key pecan insect pests include the black pecan aphid, Melanocallis caryaefoliae (Davis), pecan weevil, Curculio caryae (Horn), and stink bugs (Hemiptera: Pentatomidae). Alternative control tactics are needed for management of these pests in organic and conventional systems. Our objective was to evaluate the potential utility of several alternative insecticides including three plant extract formulations, eucalyptus extract, citrus extract-8.92%, and citrus extract-19.4%, and two microbial insecticides, Chromobacterium subtsugae (Martin et al.) and Isaria fumosorosea (Wize). In the laboratory, eucalyptus extract, citrus extract-8.92%, citrus extract-19.4%, and C. subtsugae caused M. caryaefoliae mortality (mortality was reached approximately 78, 83, and 96%, respectively). In field tests, combined applications of I. fumosorosea with eucalyptus extract were synergistic and caused up to 82% mortality in M. caryaefoliae. In laboratory assays focusing on C. caryae suppression, C. subtsugae reduced feeding and oviposition damage, eucalyptus extract and citrus extract-19.4% were ineffective, and antagonism was observed when citrus extract-19.4% was combined with the entomopathogenic nematode, Steinernema carpocapsae (Weiser). In field tests, C. subtsugae reduced C. caryae damage by 55% within the first 3d, and caused 74.5% corrected mortality within 7 d posttreatment. In the laboratory, C. subtsugae and eucalyptus extract did not cause mortality in the brown stink bug, Euschistus servus (Say). Applications of C. subtsugae for suppression of C. caryae, and eucalyptus extract plus I. fumosorosea for control of M. caryaefoliae show promise as alternative insecticides and should be evaluated further.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SFTTLTN 60 ... Query: 135 PKGLAKCVDMNYIELTSNEFEEFPDVICELRKVTILMLQQNRIKEVPDSISKLEKLSGLY 194 ... PKGLAKCVDMNYIELTS...NEFEEFPDVICELRKVTILMLQQNRIKEVPDSISKLEKLSGLY Sbjct: 121 PKGLAKCVDMNYIELTSNEFEEFPDVICELRKVTILMLQQNRIKE
ORF Alignment: NC_003074 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 8 ... Query: 194 GERCVICQLKYKIGERQMNLPCKHVYHSECISKWLSINKVCPVCNSEV 241 ... GE...RCVICQLKYKIGERQMNLPCKHVYHSECISKWLSINKVCPVCNSEV Sbjct: 1 ... GERCVICQLKYKIGERQMNLPCKHVYHSECISKWLSINKVCPVCNSEV 48 ...
MITLL 2015 Language Recognition Evaluation System Description
2016-01-27
912 8.18 qsl-rus Russian 2021 37.80 ara-ary Maghrebi 919 46.91 spa-car Carib. Spa. 194 30.59 ara-arz Egyptian 440 97.27 spa-eur Eur. Spa. 366 8.55...qsl-pol Polish 695 32.14 ara-arb MSA 912 8.18 qsl-rus Russian 2021 37.80 ara-ary Maghrebi 919 46.91 spa-car Carib. Spa. 194 30.59 ara-arz Egyptian ...BOTTLENECK I-VECTOR SYSTEM (BNF1) The Deep Neural Network architecture that we used for this system was composed of seven hidden layers. The sixth
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 57 ... Query: 138 PGERVEPPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRI...LAKRAPK 194 ... PGERVEPPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK Sbjct: 1 ... PGERVEPPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK 57
Quaternary and tertiary aldoxime antidotes for organophosphate exposure in a zebrafish model system
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Hayden R. [Department of Biology, Whittier College, Whittier, CA 90608 (United States); Radić, Zoran; Taylor, Palmer [Department of Pharmacology, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California at San Diego, La Jolla, CA 92093-0650 (United States); Fradinger, Erica A., E-mail: efrading@whittier.edu [Department of Biology, Whittier College, Whittier, CA 90608 (United States)
2015-04-15
The zebrafish is rapidly becoming an important model system for screening of new therapeutics. Here we evaluated the zebrafish as a potential pharmacological model for screening novel oxime antidotes to organophosphate (OP)-inhibited acetylcholinesterase (AChE). The k{sub i} values determined for chlorpyrifos oxon (CPO) and dichlorvos (DDVP) showed that CPO was a more potent inhibitor of both human and zebrafish AChE, but overall zebrafish AChE was less sensitive to OP inhibition. In contrast, aldoxime antidotes, the quaternary ammonium 2-PAM and tertiary amine RS-194B, showed generally similar overall reactivation kinetics, k{sub r}, in both zebrafish and human AChE. However, differences between the K{sub ox} and k{sub 2} constants suggest that zebrafish AChE associates more tightly with oximes, but has a slower maximal reactivation rate than human AChE. Homology modeling suggests that these kinetic differences result from divergences in the amino acids lining the entrance to the active site gorge. Although 2-PAM had the more favorable in vitro reactivation kinetics, RS-194B was more effective antidote in vivo. In intact zebrafish embryos, antidotal treatment with RS-194B rescued embryos from OP toxicity, whereas 2-PAM had no effect. Dechorionation of the embryos prior to antidotal treatment allowed both 2-PAM and RS-194B to rescue zebrafish embryos from OP toxicity. Interestingly, RS-194B and 2-PAM alone increased cholinergic motor activity in dechorionated embryos possibly due to the reversible inhibition kinetics, K{sub i} and αK{sub i}, of the oximes. Together these results demonstrate that the zebrafish at various developmental stages provides an excellent model for investigating membrane penetrant antidotes to OP exposure. - Highlights: • Zebrafish AChE shares significant structural similarities with human AChE. • OP-inhibited zebrafish and human AChE exhibit similar reactivation kinetics. • The zebrafish chorion is permeable to BBB penetrant and not
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
International Nuclear Information System (INIS)
Schulz, S.; Westerterp, K.R.; Brueck, K.
1989-01-01
Average daily energy expenditure determined by the doubly labeled water technique (dlwEE) was compared in six subjects (aged 20-30 y) over 2 wk under usual living conditions; average food energy intake and energy expenditure estimated from individual diary records of physical activity. In addition, energy expenditure was estimated from 24-h heart rate recordings carried out on two randomly chosen days of the 2-wk period. The group means of the dlwEE were 1.94 +/- 0.24 (means +/- SD) times larger than resting metabolic rate (= 1.94 met) and nearly identical to the average daily energy intake (1.93 +/- 0.23 met). Energy expenditure estimated from the diaries of activity and from the 24-h heart rate recording varied between 1.67 and 2.24 met depending on the calculation procedure. The dlwEE (1.94 +/- 0.24 met) is much higher than that recently determined for sedentary people (1.25 met) and thus explains that young students may achieve body weight balance with a relatively high daily food energy intake
Sud du Sahara | Page 194 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Read more about Child Soldiers Initiative. Langue English. Read more about Enfants soldats. Langue French. Read more about Transfert du modèle prédictif d'épidémie de paludisme aux utilisateurs de l'Afrique de l'Est. Langue French. Read more about Transferring the Malaria Epidemic Prediction Model to Users in East ...
40 CFR 194.33 - Consideration of drilling events in performance assessments.
2010-07-01
... assessments. (a) Performance assessments shall examine deep drilling and shallow drilling that may potentially affect the disposal system during the regulatory time frame. (b) The following assumptions and process... process shall be documented in any compliance application: (1) Inadvertent and intermittent intrusion by...
Asie du sud | Page 194 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Increased soil erosion, reduced water-storage capacity, changes in microclimates, and loss of nutrients have led to a decline in the productivity of marginal lands and the impoverishment of local communities. Read more about Deforestation in Viet Nam. Langue English. Au tout début du siècle, les gibbons, qui étaienttrès ...
Yucca Mountain Site Characterization Project Bibliography, July, December 194: An update
International Nuclear Information System (INIS)
1995-03-01
Following a reorganization of the Office of Civilian Radioactive Waste Management in 1990, the Yucca Mountain Project was renamed Yucca Mountain Site Charactrization Project. The title of this bibliography was also changed to Yucca Mountain Site Characterization Project Bibliography. Prior to August 5, 1988, this project was called the Nevada Nuclear Waste Storage Investigations. This bibliography contains information on this ongoing project that was added to the Department of Energy's Science and Technology Database from July 1, 1994 through December 31, 1994. The bibliography is categorized by principal project participating organization. Participant-sponsored subcontractor reports, papers, and articles are included in the sponsoring organization's list. Another section contains information about publications on the Energy Science and Technology Database that were not sponsored by the project but have some relevance to it
Execution spaces for simple higher dimensional automata
DEFF Research Database (Denmark)
Raussen, Martin
2012-01-01
Higher dimensional automata (HDA) are highly expressive models for concurrency in Computer Science, cf van Glabbeek (Theor Comput Sci 368(1–2): 168–194, 2006). For a topologist, they are attractive since they can be modeled as cubical complexes—with an inbuilt restriction for directions of allowa......Higher dimensional automata (HDA) are highly expressive models for concurrency in Computer Science, cf van Glabbeek (Theor Comput Sci 368(1–2): 168–194, 2006). For a topologist, they are attractive since they can be modeled as cubical complexes—with an inbuilt restriction for directions...
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available in) ... Length = 194 ... Query: 3 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMP...PEIFAKAGGKTQNAPVAT 62 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVAT Sbjct: 1 ... KI...LVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVAT 60 ... Query: 123 XXXXXWTTLAHHGMVIVPIGYAAQELFDVSQVRG
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available esorhizobium ... loti MAFF303099] ... Length = 291 ... Query: 194 YTFATLVDPHEELPPSEISSLRYWAKIAEKM...GVEIEPITRKDLAKLANYDALFIRETTSI 253 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIE...PITRKDLAKLANYDALFIRETTSI Sbjct: 1 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIEPITRKDLAKLANYDALFIRETTSI 60 ... Query:
International Nuclear Information System (INIS)
Li, Haijun; You, Yanjie; Lin, Canfeng; Zheng, Mingzhang; Hong, Chaoqun; Chen, Jiongyu; Li, Derui; Au, William W; Chen, Zhijian
2013-01-01
To evaluate the association between single nucleotide polymorphisms (SNPs) at the 194 and 399 codons of XRCC1, and the risk of severe acute skin and oral mucosa reactions in nasopharyngeal carcinoma patients in China. 114 patients with nasopharyngeal carcinoma were sequentially recruited in this study. Heparinized peripheral blood samples were taken for SNPs analysis before the start of radiation treatment. SNPs in XRCC1 (194Arg/Trp and 399Arg/Gln) gene were analyzed by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP). Dermatitis at upper neck and oral mucositis were clinically recorded according to the Common Terminology Criteria for Adverse Events v.3.0. The variant allele frequencies were 0.289 for XRCC1 194Trp and 0.263 for XRCC1 399Gln. Of the 114 patients, 24 experienced grade 3 acute dermatitis and 48 had grade 3 acute mucositis. The XRCC1 399Arg/Gln was significantly associated with the development of grade 3 dermatitis (Odds Ratio, 2.65; 95% CI, 1.04–6.73; p = 0.037, χ2 = 4.357). In addition, it was also associated with higher incidence of grade 3 mucositis with a borderline statistical significance (Odds Ratio, 2.11; 95% CI, 0.951–4.66; p = 0.065, χ2 = 3.411). The relationship between XRCC1 194Arg/Trp and acute dermatitis, and mucositis was not found. Our investigation shows, for the first time, that patients with the XRCC1 399Arg/Gln genotype were more likely to experience severe acute dermatitis and oral mucositis. With further validation, the information can be used to determine personalized radiotherapy strategy
Acute Toxicity and Neurotoxicity of Chlorpyrifos in Black Tiger Shrimp, Penaeus monodon
Directory of Open Access Journals (Sweden)
Tassanee Eamkamon
2012-01-01
Full Text Available Acute toxicity and neurotoxicity of chlorpyrifos were determined in black tiger shrimp, P. monodon. LC50 values after 24 to 96 h of exposure were between 149.55 and 59.16 nmol/L. To determine the neurotoxicity of chlorpyrifos, the inhibition of acetylcholinesterase was monitored in the gill of the shrimps exposed to lethal (0.019, 0.194, and 1.942 µmol/L and sub-lethal (0.019, 0.194, and 1.942 nmol/L concentrations of chlorpyrifos. In lethal dose exposure, the AChE activities observed in shrimp exposed to 0.194, and 1.942 µmol/L of chlorpyrifos were significantly lower (1.7 and 3.3 times than that of control shrimp after 30 min of exposure (p<0.05. In sub-lethal exposure tests, the AChE activity of shrimp was significantly lower (1.9 times than that of control shrimp after exposure to 1.942 nmol/L of chlorpyrifos for 72 h (p<0.05. The sensitive reduction of AChE activity at the sub-lethal concentration, which was 30 times lower than 96 h LC50 value found in this study, indicates the potential use as a biomarker of chlorpyrifos exposure.
International Nuclear Information System (INIS)
Umar, Datin Fatia; Muta'alim; Usui, Hiromoto; Komoda, Yoshiyuki
2009-01-01
Upgraded brown coal water mixture (UBCWM) preparation by using an Indonesian upgraded coal produced by upgraded brown coal (UBC) process, was carried out to study the effect of dispersing and stabilizing additives on rheological behavior of the UBCWM. Three kinds of anionic dispersing additives, naphthalene sulfonic formaldehyde condensate (NSF), poly (meth) acrylate (PMA) and poly styrene sulfonic acid (PSS) and three kinds of stabilizing additives, carboxyl methyl cellulose (CMC), rhansam gum (S-194) and gellan gum (S-60) were used in this study. Results indicate that the addition of NSF 0.3 wt.% together with S-194 0.01 wt.% is effective in preparing UBCWM with good slurryability and stability, based on its rheological characteristics with the apparent viscosity at shear rate of 100 s - 1 and yield stress at zero point of shear rate. The rheological behavior of all of the UBCWM that prepared, exhibits non-Newtonian Bingham plastic. From the economical point of view, the price of S-194 is expensive. On the other hand, CMC is cheap and abundant. Therefore, the addition of CMC 0.01 wt.% together with NSF 0.3 wt.% is also effective in preparing UBCWM with good fluidity and stability. (author)
Energy Technology Data Exchange (ETDEWEB)
Trukhanov, A.V., E-mail: truhanov86@mail.ru [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and Practical Materials Research Centre of NAS of Belarus”, P. Brovki str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanov, S.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and Practical Materials Research Centre of NAS of Belarus”, P. Brovki str., 19, 220072 Minsk, Belorussia (Belarus); Panina, L.V.; Kostishyn, V.G. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); Kazakevich, I.S. [SSPA “Scientific and Practical Materials Research Centre of NAS of Belarus”, P. Brovki str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanov, An.V. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); SSPA “Scientific and Practical Materials Research Centre of NAS of Belarus”, P. Brovki str., 19, 220072 Minsk, Belorussia (Belarus); Trukhanova, E.L.; Natarov, V.O. [SSPA “Scientific and Practical Materials Research Centre of NAS of Belarus”, P. Brovki str., 19, 220072 Minsk, Belorussia (Belarus); Turchenko, V.A. [Joint Institute for Nuclear Research, Joliot-Curie Str., 6, 141980 Dubna (Russian Federation); Donetsk Institute of Physics and Technology named after A.A. Galkin of the NAS of Ukraine, 72 R.Luxemburg Str., 83114 Donetsk (Ukraine); Salem, M.M. [National University of Science and Technology MISiS, Leninsky Prospekt, 4, 119049 Moscow (Russian Federation); and others
2017-03-15
M-type BaFe{sub 11.9}Al{sub 0.1}O{sub 19} hexaferrite was successfully synthesized by solid state reactions. Precision investigations of crystal and magnetic structures of BaFe{sub 11.9}Al{sub 0.1}O{sub 19} powder by neutron diffraction in the temperature range 4.2–730 K have been performed. Magnetic and electrical properties investigations were carried out in the wide temperature range. Neutron powder diffraction data were successfully refined in approximation for both space groups (SG): centrosymmetric #194 (standard non-polar phase) and non-centrosymmetric #186 (polar phase). It has been shown that at low temperatures (below room temperature) better fitting results (value χ{sup 2}) were for the polar phase (SG: #186) or for the two phases coexistence (SG: #186 and SG: #194). At high temperatures (400–730 K) better fitting results were for SG: #194. It was established coexistence of the dual ferroic properties (specific magnetization and spontaneous polarization) at room temperature. Strong correlation between magnetic and electrical subsystems was demonstrated (magnetoelectrical effect). Temperature dependences of the spontaneous polarization, specific magnetization and magnetoelectrical effect were investigated.
International Nuclear Information System (INIS)
Almisned, Ghada
2010-01-01
Monte Carlo simulations were carried out using the dependence of gamma ray yield on the bulk density and moisture content for five different lengths of Portland cement samples in a thermal neutron capture based Prompt Gamma ray Neutron Activation Analysis (PGNAA) setup for source inside moderator geometry using an 241 Am-Be neutron source. In this study, yields of 1.94 and 6.42 MeV prompt gamma rays from calcium in the five Portland cement samples were calculated as a function of sample bulk density and moisture content. The study showed a strong dependence of the 1.94 and 6.42 MeV gamma ray yield upon the sample bulk density but a weaker dependence upon sample moisture content. For an order of magnitude increase in the sample bulk density, an order of magnitude increase in the gamma rays yield was observed, i.e., a one-to-one correspondence. In case of gamma ray yield dependence upon sample moisture content, an order of magnitude increase in the moisture content of the sample resulted in about 16-17% increase in the yield of 1.94 and 6.42 MeV gamma rays from calcium. (author)
Strength distribution of γ-transitions deexciting superdeformed rotational bands
International Nuclear Information System (INIS)
Lopez-Martens, A.P.; Doesing, T.; Khoo, T.L.; Korichi, A.; Hannachi, F.; Calderin, I.J.; Lauritsen, T.; Ahmad, I.; Carpenter, M.P.; Fischer, S.M.; Hackman, G.; Janssens, R.V.F.; Nisius, D.; Reiter, P.; Amro, H.; Moore, E.F.
1999-01-01
The strength distribution of the γ rays in the decay-out from superdeformed (SD) states is investigated by applying the maximum likelihood method, with special emphasis on the influence of the lower threshold given by experimental conditions. Clear graphical solutions are found, and a careful estimation of the dispersion in the values of the number of degrees of freedom and of the average strength of the most likely χ 2 distribution is carried out. For the 194 Hg nucleus, 41 primary transitions from the decay-out of SD states are identified above 2600 keV. It is concluded that they represent the strongest 10% of the transitions selected stochastically from a Porter-Thomas distribution. This would support the scenario of a statistical decay of SD states via coupling to a compound state at normal deformation. However, the occurrence of several very strong direct one-step transitions as previously observed in 194 Hg has a very small probability of the order of 10 -4 . This may indicate special selection rules governing the decay. However, based on the absence of strong primary transitions from SD states in adjacent nuclei, the situation in 194 Hg is viewed as a very lucky incidence
New distances to and peculiar motions of two Abell clusters -evidence for spurious motions?
International Nuclear Information System (INIS)
Lucey, J.R.; Terlevich, R.J.
1991-01-01
We present redshifts and central velocity dispersions (σ) from observations with the FLEX-based multi-object system on the William Herschel 4.2-m telescope for early-type galaxies in three rich clusters, Abell 194, Abell 2199 and Abell 2634. For Abell 194, the new measurements are in excellent agreement with those previously derived with the AAT's FOCAP multi-object system. Photometric diameters (D) derived from CCD observations made with the Isaac Newton 2.5-m telescope and Jacobus Kapteyn 1.0-m telescope are also presented. Relative distances to Abell 2199 and Abell 2634 are derived via the application of the D-σ relation. (author)
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available i A str. ATCC 9150] ... Length = 194 ... Query: 3 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMP...PEIFAKAGGKTQNAPVAT 62 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPV...AT Sbjct: 1 ... KILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVAT 60 ... Query: 123 XXXXXWTTLAHHGMVIVP
Андреева, Г. Н.
2002-01-01
Tutv. art.: Thiele, Carmen. Minderheitenschutz in Estland : werden die Rechtsnormen der politischen Wirklichkeit gerecht? // Moderner Minderheitenschutz : rechtliche oder politische Absicherung? Bonn, 1998, lk. 185-194
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 05] ... Length = 133 ... Query: 62 ... SAGYPTPKLDTRAAIFDEEGRILMTHENSGEWSLPGGWVDENQSIRSNAVKEVKEETGLD 121 ... ... ... SAGYPTPKLDTRAAIFDEEGRILMTHENSGEWSLPGGWVDENQSIRSNAVKEVKEETGLD Sbjct: 1 ... S...AGYPTPKLDTRAAIFDEEGRILMTHENSGEWSLPGGWVDENQSIRSNAVKEVKEETGLD 60 ... Query: 182 TRNTAEQIAMCFA 194 ... TRNTAEQIAMCFA Sbjct: 121 TRNTAEQIAMCFA 133
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
Allergic conjunctivitis and dry eye syndrome.
Hom, Milton M; Nguyen, Andrew L; Bielory, Leonard
2012-03-01
Allergic conjunctivitis (AC) and dry eye syndrome (DES) are 2 of the most common anterior inflammatory disorders of the ocular surface and one does not preclude the coexistence of the other. To examine the potential overlap between AC and DES as comorbidities. Using the validated questionnaire known as Subjective Evaluation of Symptom of Dryness, we studied self-reported itchiness, dryness, and redness. In an outpatient optometric setting, 689 patients treated from January 1, 2007, to January 1, 2011, were surveyed for their ocular history and categorized according to their reported level of discomfort of itchiness, dryness, and redness. Patients ranged in age from 5 to 90 years (median age, 25 years; 39.5% male; 60.5% female). In the studied 689 patients, clinically significant itchiness was found in 194 (28.2%), dry eyes in 247 (35.8%), and redness in 194 (28.2%). Symptom overlap was demonstrated in many of the patients. Of the 194 patients with itchiness, 112 (57.7%) had clinically significant dryness. In the 247 patients with dry eyes, 112 (45.3%) had clinically significant itch. Redness was apparent in 120 of the 194 patients with itch (61.9%) and 122 of the 247 patients with dryness (49.4%). Statistical analysis demonstrated that self-reported itchiness, dryness, and redness were not independent of each other (Peyes" also experiencing dry eyes were 2.11 times and the odds of these patients also experiencing redness were 7.34 times that of patients with nonitchy eyes. Most patients with "itchy eyes" consistent with AC also have dry eyes and redness. These results suggest that some symptomatic patients concomitantly have features of AC and DES. Copyright © 2012 American College of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.
Biosynthesis of amidated joining peptide from pro-adrenocorticotropin-endorphin
Energy Technology Data Exchange (ETDEWEB)
Cullen, E.I.; Mains, R.E. (Johns Hopkins Univ. School of Medicine, Baltimore, MD (USA))
1987-09-01
Joining peptide is the major alpha-amidated product of pro-ACTH/endorphin (PAE) in AtT-20 corticotropic tumor cells. To study intracellular joining peptide synthesis, affinity purified antibodies directed against gamma-MSH, joining peptide, and ACTH were used to immunoprecipitate extracts from biosynthetically labeled AtT-20 cells. Immunoprecipitates were analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and by tryptic peptide mapping on HPLC. In steady labeling experiments, radioactivity in amidated joining peptide (JP) increased roughly linearly with time, in the manner of a final product, whereas radioactivity associated with PAE (1-94)NH2 reached a constant value after 2-4 h, indicating that PAE(1-94)NH2 is an intermediate in the biosynthesis of JP. Radioactivity appeared in ACTH(1-39) well before JP, consistent with a cleavage order in which ACTH is cleaved from PAE(1-95) before JP sequences are cleaved from PAE(1-74). This conclusion was supported by tryptic peptide analyses of immunoprecipitates, which indicated that less than 5% of JP-related material is cleaved from PAE(1-74) before being cleaved from ACTH-related sequences. After a pulse label, radioactivity in PAE(1-94)NH2 reached a peak value after 1 h of chase and declined with a half-life of less than 1 h. Amidated JP increased to a constant level after 2 h of chase. Enough radiolabeled PAE(1-94)NH2 was detected to account for about half of the radioactivity found in amidated JP, indicating that about half of JP-related material is first cleaved from PAE(1-95) before being amidated. This result was corroborated using HPLC purification to determine both amidated and glycine-extended forms of JP.
Biosynthesis of amidated joining peptide from pro-adrenocorticotropin-endorphin
International Nuclear Information System (INIS)
Cullen, E.I.; Mains, R.E.
1987-01-01
Joining peptide is the major alpha-amidated product of pro-ACTH/endorphin (PAE) in AtT-20 corticotropic tumor cells. To study intracellular joining peptide synthesis, affinity purified antibodies directed against gamma-MSH, joining peptide, and ACTH were used to immunoprecipitate extracts from biosynthetically labeled AtT-20 cells. Immunoprecipitates were analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and by tryptic peptide mapping on HPLC. In steady labeling experiments, radioactivity in amidated joining peptide (JP) increased roughly linearly with time, in the manner of a final product, whereas radioactivity associated with PAE (1-94)NH2 reached a constant value after 2-4 h, indicating that PAE(1-94)NH2 is an intermediate in the biosynthesis of JP. Radioactivity appeared in ACTH(1-39) well before JP, consistent with a cleavage order in which ACTH is cleaved from PAE(1-95) before JP sequences are cleaved from PAE(1-74). This conclusion was supported by tryptic peptide analyses of immunoprecipitates, which indicated that less than 5% of JP-related material is cleaved from PAE(1-74) before being cleaved from ACTH-related sequences. After a pulse label, radioactivity in PAE(1-94)NH2 reached a peak value after 1 h of chase and declined with a half-life of less than 1 h. Amidated JP increased to a constant level after 2 h of chase. Enough radiolabeled PAE(1-94)NH2 was detected to account for about half of the radioactivity found in amidated JP, indicating that about half of JP-related material is first cleaved from PAE(1-95) before being amidated. This result was corroborated using HPLC purification to determine both amidated and glycine-extended forms of JP
VIDAL FUENTES, JORGE ARTURO
2013-01-01
Diariamente, las industrias textiles descargan grandes volúmenes de aguas que contienen altas concentraciones de colorantes y aditivos, los cuales ocasionan daños considerables al medio ambiente. Muchos de estos colorantes son estables a la luz y a la biodegradación, siendo considerados como compuestos orgánicos persistentes (COPs). Es por esto que es necesario aplicar métodos que permitan la eliminación de estos contaminantes desde las aguas. Una metodología efectiva para la eliminación de C...
19 CFR 19.4 - CBP and proprietor responsibility and supervision over warehouses.
2010-04-01
... or their authorized agent. (4) Records maintenance—(i) Maintenance. The proprietor shall: (A... proprietor shall maintain the warehouse facility in a safe and sanitary condition and establish procedures... seals. (7) Storage conditions. Merchandise in the bonded area shall be stored in a safe and sanitary...
19 CFR 191.194 - Action on application to participate in compliance program.
2010-04-01
... to coordinate its decision making on the package both with CBP Headquarters and with the other field drawback offices as appropriate. CBP processing of the package will consist of the review of the information contained therein as well as any additional information requested (see paragraph (a)(2) of this...
Lifescience Database Archive (English)
Full Text Available 16358-7 ... PMID:19568388 (drug) ... AUTHORS ... Marian AJ ... TITLE ... Contemporary treatment of hypertrophic cardiomyopathy. ... JOURNAL ... Tex Heart Inst J 36:194-204 (2009) ...
Dicty_cDB: Contig-U13692-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available D504Z ,194,812 Translated Amino Acid sequence mv*lqsiwvvvvwigy*livtf*lnkiqywlgiwqsq*hvacfiymignqiqyfieiyqq r...fvf*nsckylskk Frame C: mv*lqsiwvvvvwigy*livtf*lnkiqywlgiwqsq*hvacfiymignqiqyfieiy
Moguilevsky, N; Varsalona, F; Guillaume, J P; Noyer, M; Gillard, M; Daliers, J; Henichart, J P; Bollen, A
1995-01-01
A cDNA clone for the human histamine H1 receptor was isolated from a lung cDNA library and stably expressed in CHO cells. The recombinant receptor protein present in the cell membranes, displayed the functional and binding characteristics of histamine H1 receptors. Mutation of Ser155 to Ala in the fourth transmembrane domain did not significantly change the affinity of the receptor for histamine and H1 antagonists. However, mutation of the fifth transmembrane Asn198 to Ala resulted in a dramatic decrease of the affinity for histamine binding, and for the histamine-induced polyphosphoinositides breakdown, whereas the affinity towards antagonists was not significantly modified. In addition, mutation of another fifth transmembrane amino acid, Thr194 to Ala also diminished, but to a lesser extent, the affinity for histamine. These data led us to propose a molecular model for histamine interaction with the human H1 receptor. In this model, the amide moiety of Asn198 and the hydroxyl group of Thr194 are involved in hydrogen bonding with the nitrogen atoms of the imidazole ring of histamine. Moreover, mutation of Thr194 to Ala demonstrated that this residue is responsible for the discrimination between enantiomers of cetirizine.
Correction to: Biores Open Access 2016;5:137–145
Directory of Open Access Journals (Sweden)
Walter H. Moos
2017-05-01
Full Text Available In the 2016 volume of BioResearch Open Access (vol. 5, no. 1; 137–145, the article entitled “Microbiota and Neurological Disorders: A Gut Feeling” by Moos et al. requires a correction. Reference 98 was incorrectly cited in the first paragraph of page 142; this should be reference 194, which was inadvertently omitted from the article. The corrected text and newly added reference are below: The mouth, being an extension of the digestive tract, presents a readily accessible diagnostic site for the early detection of potential unhealthy pathogens resident in the gut. Salivanomics is a rapidly emerging tool in the arsenal of salivary diagnostics.194 Collecting saliva or swabbing the inside cheek of the mouth is noninterventional, making it a highly attractive diagnostic procedure, particularly for infants and young children. It is not unlikely that regular visits to your dentist may soon be as important to your gut as it is to your oral hygiene, white teeth, and a nice smile. 194. Zhang Y, Sun J, Lin CC, et al. The emerging landscape of salivary diagnostics. Periodontol 2000. 2016;70:38–52. The article has been corrected to reflect this change. The authors apologize for this error.
Eimuntas Nekroshiuse teatripoeetika / Ruta Mazheikiene ; tõlk. Tiina Kattel
Mazheikiene, Ruta
2004-01-01
E. Nekroshiuse lavastustele iseloomulikest joontest, toetudes tema lavastustele "Hamlet" "Macbeth", "Othello", "Onu Vanja", "Nina". Samuti näitlejatega töötamise strateegiast. Kasut. kirjandus, lk. 194-195
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity, conductivity, pressure, and transmissivity data gathered by CTD from the Alpha Helix (cruise HX194), September 1996
Effect of Family Structure on Marital Attitudes of Adolescents.
Ganong, Lawrence; And Others
1981-01-01
Assesses the effect of exposure to different family structures (single parent families, reconstituted families, intact families) on the marital socialization of 127 males and 194 female adolescents. (Author/CM)
African Journals Online (AJOL)
userpc
November, 2017 ... nt of Mathematical Sciences, Bayero University, Kano, Nigeria. *Correspondence author: yusufbashir230@gmail.com preventive maintenance model for an operating system that works ..... industrial engineering, 185-194.
International Nuclear Information System (INIS)
Menges, R.; Dinger, U.; Boos, N.; Huber, G.; Schroeder, S.
1992-01-01
The hyperfine structure, isotope and isomeric shifts in the atomic transition 6p 2 P 3/2 -7s 2 S 1/2 , λ=535 nm have been measured for the I=7 and I=2 states of 190,192,194,196 Tl, the I=1/2 and I=9/2 states of 191 Tl and the I=7 isomer of 188 Tl. The thallium isotopes were prepared as fast atomic beams at the GSI on-line mass separator following fusion reactions and - in some cases - subsequent β-decay. The nuclear dipole moments, electric quadrupole moments and the change in the nuclear mean square charge radius are evaluated. The uu-isotopes show an isomeric shift which changes sign between 192 Tl and 194 Tl. (orig.)
A comparison of radiative transfer models for predicting the microwave emission from soils
Schmugge, T. J.; Choudhury, B. J.
1981-01-01
Noncoherent and coherent numerical models for predicting emission from soils are compared. Coherent models use the boundary conditions on the electric fields across the layer boundaries to calculate the radiation intensity, and noncoherent models consider radiation intensities directly. Interference may cause different results in the two approaches when coupling between soil layers in coherent models causes greater soil moisture sampling depths. Calculations performed at frequencies of 1.4 and 19.4 GHz show little difference between the models at 19.4 GHz, although differences are apparent at the lower frequency. A definition for an effective emissivity is also given for when a nonuniform temperature profile is present, and measurements made from a tower show good agreement with calculations from the coherent model.
Band crossings in mercury nuclei: effect of occupation of i13/2 neutron orbits
International Nuclear Information System (INIS)
Khadkikar, S.B.; Praharaj, C.R.
1984-04-01
The K=0 + ground band and two rotation-aligned bands (K=1 + or K2 + two quasi-particle band and K=2 + four quasi-particle band) are studied in 198 Hg, 194 Hg and 190 Hg by angular momentum projection from Hartree-Fock and particle-hole intrinsic states. There is a first anomaly in these three nuclei around 8(h/2π) due to the crossing of the ground band and the two quasi-particle band. Because of the nature of occupation of i13/2 orbitals the four quasi-particle band is too highlying in 198 Hg and does not cross the two quasi-particle bands, while such a second crossing occurs in 194 Hg and 190 Hg near 20 (h/2π). (author)
Directory of Open Access Journals (Sweden)
Mehmet Demir Kaya
2012-03-01
Full Text Available Salinity reduces germination, delays emergence, and inhibits seedling growth of linseed (Linum usitatissimum L. while some varieties are less affected by salinity than others. In this study, we aimed to determine the effects of NaCl levels (0, 5, 10, 20 and 30 dS m-1 on germination and seedling growth of 10 linseed genotypes (lines 87, 89, 104, 114, 193, 194, 209, 215, C-90 and cv. San-85 and to classify the genotypes for salinity tolerance using germination and seedling characteristics. Germination percentage, mean germination time, root and shoot length, seedling fresh and dry weight, Na+ content and Na:K ratio of seedlings were investigated. Classification of linseed genotypes for salinity tolerance was done according to (i combination of Principal Component and Cluster Analysis, (ii Na+ content, and (iii Na:K ratio of seedling. The results showed that the highest values were obtained from lines 193, 194 and 215 except for mean germination time, while germination percentage was not adversely influenced by NaCl up to 20 dS m-1. Seedling growth was inhibited at 20 dS m-1 although genotypes exhibited varying responses. Na+ content was enhanced by NaCl, but seedling from lines 194, 193 and 215 had the lowest Na+ content at all NaCl levels. Cluster analysis performed by multiple parameters revealed three groups for salinity tolerance. It was concluded that lines 193, 194, and 215 were tolerant, lines 87, 209, C-90, and cv. Sari-85 were moderately tolerant and lines 89, 104, and 114 were salt-sensitive genotypes. Classification of genotypes for Na+ content and Na:K ratio showed similar result for tolerant genotypes while different genotypes for sensitive group were detected.La salinidad reduce germinación, retrasa emergencia, e inhibe el crecimiento de plántulas de lino (Linum usitatissimum L. mientras algunas variedades son menos afectadas por la salinidad que otras. El objetivo de este estudio fue determinar los efectos de niveles de NaCl (0, 5
Glossary of Organization Development Terminology.
Krepner-Tregoe and Associates, Inc., Princeton, NJ.
Ranging from Action Sequence to Zero Defects, this Kepner-Tregoe glossary defines 194 terms (including some specifically Kepner-Tregoe) relevant to the fields of management development, organization development, and industrial training. (LY)
Kardinální ctnosti v Husově Komentáři Sentencí
Czech Academy of Sciences Publication Activity Database
Machula, Tomáš
2015-01-01
Roč. 17, č. 4 (2015), s. 185-194 ISSN 1212-8570 Institutional support: RVO:67985955 Keywords : Hus * cardinal virtues * moral virtues * commentary on the Sentences * ethics Subject RIV: AA - Philosophy ; Religion
Inoculum of arbuscular mycorrhizal fungi for production systems: science meets business
Czech Academy of Sciences Publication Activity Database
Gianinazzi, S.; Vosátka, Miroslav
2004-01-01
Roč. 82, - (2004), s. 1264-1271 ISSN 0008-4026 Institutional research plan: CEZ:AV0Z6005908 Keywords : Inoculum production * mycorrhiza applications Subject RIV: EF - Botanics Impact factor: 1.194, year: 2004
A case of partial melanism in Lacerta agilis (Linnaeus, 1758) from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Smolinský, Radovan
2016-01-01
Roč. 29, 1-2 (2016), s. 110-112 ISSN 1013-4425 Institutional support: RVO:68081766 Keywords : Lacerta agilis * partial melanism * Czech Republic Subject RIV: EG - Zoology Impact factor: 1.194, year: 2016
Directory of Open Access Journals (Sweden)
Valeria Ianni
2013-01-01
Full Text Available Dicósimo, Daniel y Simonassi, Silvia (comp., Trabajadores y empresarios en la Argentina del siglo XX: indagaciones desde la historia social, Prohistoria ediciones, Rosario, 2011 (194 págs..
K pojmu psychospirituální krize
Czech Academy of Sciences Publication Activity Database
Říčan, Pavel
2012-01-01
Roč. 56, č. 2 (2012), s. 194-196 ISSN 0009-062X Institutional support: RVO:68081740 Keywords : psychospiritual crisis * spirituality * transpersonal psychology Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
African Journal for Physical Activity and Health Sciences - Vol 22 ...
African Journals Online (AJOL)
Factors that predispose South African rural university students with disabilities to HIV infections · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A.H. Mavhandu-Mudzusi, 182-194 ...
Šedesát let českého bádání o emblematice (1956–2016). Anotovaná bibliografie
Czech Academy of Sciences Publication Activity Database
Konečný, Lubomír
2016-01-01
Roč. 65, č. 2 (2016), s. 180-194 ISSN 1211-7390 Institutional support: RVO:68378033 Keywords : emblem atic * emblem * emblem book * bibliography * applied emblem atic Subject RIV: AL - Art, Architecture, Cultural Heritage
Annual Change Report 2003/2004
International Nuclear Information System (INIS)
2004-01-01
As part of continuing compliance, the U.S. Environmental Protection Agency (EPA) requires the U.S. Department of Energy (DOE) to provide any change in information since the most recent compliance application. This requirement is identified in Title 40 Code of Federal Regulations (CFR), Section 194.4(b)(4), which states: 'No later than six months after the administrator issues a certification, and at least annually thereafter, the Department shall report to the Administrator, in writing, any changes in conditions or activities pertaining to the disposal system that were not required to be reported by paragraph (b)(3) of this section and that differ from information contained in the most recent compliance application.' In meeting the requirement, the DOE provides an annual report of all changes applicable under the above requirement each November. This annual report informs the EPA of changes to information in the most recent compliance application, or for this report the 1996 Compliance Certification Application (CCA). Significant planned changes must be reported to the EPA prior to implementation by the DOE. In addition, Title 40 CFR, Section 194.4(b)(3) requires that significant unplanned changes be reported to the EPA within 24 hours or ten days, depending on the severity of the activity or condition. To date, there have been no significant unplanned changes to the certification basis. Planned changes have been submitted on an individual basis. All other changes are reported annually. The period covered by this Annual Change Report includes changes that occurred between July 1, 2003, and June 30, 2004. Changes in activities or conditions are reviewed to determine if 40 CFR Section 194.4(b)(3) reporting is necessary. As indicated above, no significant unplanned changes were identified for the time period covered by this report. The enclosed tables list those items identified for reporting under 40 CFR Section 194.4(b)(4). The majority of the changes described in
Annual Change Report 2006/2007
International Nuclear Information System (INIS)
2007-01-01
As part of continuing compliance, the U.S. Environmental Protection Agency (EPA) requires the U.S. Department of Energy (DOE) to provide information on any change in conditions or activities pertaining to the disposal system since the most recent compliance application. This requirement is identified in Title 40 Code of Federal Regulations (CFR), Section 194.4(b)(4), which states: 'No later than six months after the administrator issues a certification, and at least annually thereafter, the Department shall report to the Administrator, in writing, any changes in conditions or activities pertaining to the disposal system that were not required to be reported by paragraph (b)(3) of this section and that differ from information contained in the most recent compliance application.' In meeting the requirement, the DOE provides an annual report each November of all applicable changes under the above requirement. This annual report informs the EPA of changes to information in the most recent compliance recertification (the 2004 Compliance Recertification). Significant planned changes must be reported to the EPA prior to implementation by the DOE. In addition, Title 40 CFR, Section 194.4(b)(3) requires that significant unplanned changes be reported to the EPA within 24 hours or ten days, depending on the severity of the activity or condition. To date, there have been no significant unplanned changes to the certification basis. Planned changes have been submitted on an individual basis. All other changes are reported annually. Changes in activities or conditions are reviewed to determine if 40 CFR Section 194.4(b)(3) reporting is necessary. As indicated above, no significant unplanned changes were identified for the time period covered by this report. The enclosed tables list those items identified for reporting under 40 CFR Section 194.4(b)(4). The majority of the items described in this report are inspections, reports, and modifications to written plans and procedures for
Koc, Arzuhan; Batar, Bahadir; Celik, Ozlem; Onaran, Ilhan; Tasan, Ertugrul; Sultuybek, Gonul Kanigur
2014-07-01
Hashimoto thyroiditis (HT) is a chronic inflammatory autoimmune disease of thyroid gland affected by interaction of multiple genes and various cytokines. Variants in the genes coding for the NFKB and IKB proteins can be potentially involved in the development of the inflammatory diseases. NFKB, a key transcription factor of the regulation of immune responses, is interesting candidate for association studies about autoimmune disorder. The aim of the present study was to investigate the relationship between NFKB1 and NFKBIA (NFKB1 inhibitor gene) polymorphisms, and the risk of HT in a Turkish Population in the context of IL-6 serum levels which may contribute to susceptibility to the disease. We analyzed the distribution of NFKB1-94ins/del ATTG and NFKBIA 3'UTR A→G polymorphisms using PCR-RFLP method and IL-6 serum levels using ELISA method in 120 HT patients and 190 healthy controls in Turkish population. Although, there was no statistical significant difference in distribution of the genotypes and alleles of NFKB1-94ins/del ATTG or NFKBIA 3'UTR A→G polymorphisms in patients and control subjects as single, ins/ins/GG combined genotype had protective effect on the disease when compared to ins/ins/AG combined genotype as combined genotypes of both polymorphisms. In addition to this finding, IL-6 serum levels in HT patients with del/del genotype were significantly higher than in patients with del/ins genotype (p<0.001). According to the combined genotype analysis of NFKB1-94ins/del ATTG and NFKBIA 3'UTR A→G polymorphisms, IL-6 levels were also higher in patients with del/del genotype when at least one G allele existing (p=0.007). Therefore, our findings suggest that the functional promoter NFKB1-94ins/del ATTG polymorphism was significantly associated with population HT disease through acting by directly modulating IL-6 serum levels. Copyright © 2014 Elsevier GmbH. All rights reserved.
The effect of lactose-in-saline infusion on packed cell volume ...
African Journals Online (AJOL)
STORAGESEVER
2008-06-03
Jun 3, 2008 ... concluded that lactose ameliorated anaemia, by inhibiting the sequestration of desialylated ..... lactose infusion further supports the conclusion that lactose played ... statistics. 3rd. Ed. Chapman and Hall, London, pp. 191-194.
Hodnocení státní podpory stavebního spoření: dopad na úspory a příjmovou nerovnost
Czech Academy of Sciences Publication Activity Database
Dušek, Libor; Janský, Petr
2012-01-01
Roč. 60, č. 10 (2012), s. 991-1004 ISSN 0013-3035 Institutional support: RVO:67985998 Keywords : building savings * Czech Republic * evidence-based policy Subject RIV: AH - Economics Impact factor: 0.194, year: 2012
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
org/10.21010/ajtcam.v13i6.9 .... Muhammad Abuzar Ghaffari, Bashir Ahmed Chaudhary, Muhammad Uzair, Khuram Ashfaq, 194-198 ... Abdelkader Benhelima, Zohra Kaid-Omar, Houari Hemida, Tarek Benmahdi, Ahmed Addou, 204-214.
Prefixálně-sufixální adjektiva v pomístních jménech v Čechách
Czech Academy of Sciences Publication Activity Database
Štěpán, Pavel
2011-01-01
Roč. 94, č. 4 (2011), s. 194-203 ISSN 0027-8203 Institutional research plan: CEZ:AV0Z90610518 Keywords : minor place-names * adjectives * prefixal-suffixal formation * word-formation Subject RIV: AI - Linguistics
Search for low spin superdeformed states by transfer reactions
Energy Technology Data Exchange (ETDEWEB)
Blons, J; Goutte, D; Lepretre, A; Lucas, R; Meot, V; Paya, D; Phan, X H [DAPNIA SPhN CE Saclay 91191 Gif sur Yvette (France); Barreau, G; Doan, T P; Pedemay, G [CENBG, 33175 Gradignan (France); Becker, J A; Stoyer, M A [LLNL, Livermore, CA (United States)
1992-08-01
We present a specific experimental technique aiming to observe superdeformed isomeric states. Preliminary results on two proton transfer reaction on platinum targets leading to {sup 194}Hg are shown. (author). 6 refs., 5 figs.
Innovaatiline mõtlemine nõuab juhilt julgust kastist välja tulla / Alexander Kotchubei
Kotchubei, Alexander, 1963-
2005-01-01
Ilmunud ka: Juhi ideelaegas. - Tallinn, 2006, lk. 194-196. Uuenduslikkuse aluseks on konkurentidest efektiivsem mõtlemine. Vt. samas: Tänapäeva juht peab olema avatud ja riskijulge; Uusi ideid soodustavad muudatused mõtteviisis
Czech Academy of Sciences Publication Activity Database
Mikuláš, Radek
2008-01-01
Roč. 87, č. 3 (2008), s. 194-195 ISSN 0042-4544 Institutional research plan: CEZ:AV0Z30130516 Keywords : scientometry * impact factor * scientists evaluation * polemic Subject RIV: AF - Documentation, Librarianship, Information Studies
Excitation functions for deuterium-induced reactions on 194Pt near the coulomb barrier
Czech Academy of Sciences Publication Activity Database
Kulko, A. A.; Skobelev, N. K.; Kroha, Václav; Penionzhkevich, Y. E.; Mrázek, Jaromír; Burjan, Václav; Hons, Zdeněk; Šimečková, Eva; Piskoř, Štěpán; Kugler, Andrej; Demekhina, N. A.; Sobolev, Yu. G.; Chuvilskaya, T. V.; Shirokova, K.; Kuterbekov, K.
2012-01-01
Roč. 9, 6-7 (2012), s. 502-507 ISSN 1547-4771 R&D Projects: GA MŠk LA08002 Institutional support: RVO:61389005 Keywords : nucelar reactions * excitation functions * charged particle activation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders
194 Évaluation de l'efficacité de l'insecticide Tricel 480 EC ...
African Journals Online (AJOL)
PR BOKO
phytosanitaires par les agriculteurs, induit l'apparition de populations résistantes de ravageurs tel que. Plutellaxylostella [4], des risques sanitaires importants tels que les résidus de pesticides et de nitrates dans les produits alimentaires et les sols [5]. Parmi ces cultures maraichères, le chou fait partie des plus attaquées par ...
XRCC1 Arg194Trp polymorphism is no risk factor for skin cancer ...
African Journals Online (AJOL)
Rouf Maqbool
(most often caused by ultraviolet radiation from sunshine) triggers mutations, or genetic ... of melanoma, as with all skin cancers, is sun exposure, but this is ... Currently, it is esti- .... The standard protocol for restriction digestion was used.
Anomalous Fluctuations of s-Wave Reduced Neutron Widths of 192,194Pt Resonances
International Nuclear Information System (INIS)
Koehler, P. E.; Harvey, J. A.; Becvar, F.; Krticka, M.; Guber, K. H.
2010-01-01
We obtained an unprecedentedly large number of s-wave neutron widths through R-matrix analysis of neutron cross-section measurements on enriched Pt samples. Careful analysis of these data rejects the validity of the Porter-Thomas distribution with a statistical significance of at least 99.997%.
SU-F-J-194: Development of Dose-Based Image Guided Proton Therapy Workflow
Energy Technology Data Exchange (ETDEWEB)
Pham, R; Sun, B; Zhao, T; Li, H; Yang, D; Grantham, K; Goddu, S; Santanam, L; Bradley, J; Mutic, S; Kandlakunta, P; Zhang, T [Washington University School of Medicine, Saint Louis, MO (United States)
2016-06-15
Purpose: To implement image-guided proton therapy (IGPT) based on daily proton dose distribution. Methods: Unlike x-ray therapy, simple alignment based on anatomy cannot ensure proper dose coverage in proton therapy. Anatomy changes along the beam path may lead to underdosing the target, or overdosing the organ-at-risk (OAR). With an in-room mobile computed tomography (CT) system, we are developing a dose-based IGPT software tool that allows patient positioning and treatment adaption based on daily dose distributions. During an IGPT treatment, daily CT images are acquired in treatment position. After initial positioning based on rigid image registration, proton dose distribution is calculated on daily CT images. The target and OARs are automatically delineated via deformable image registration. Dose distributions are evaluated to decide if repositioning or plan adaptation is necessary in order to achieve proper coverage of the target and sparing of OARs. Besides online dose-based image guidance, the software tool can also map daily treatment doses to the treatment planning CT images for offline adaptive treatment. Results: An in-room helical CT system is commissioned for IGPT purposes. It produces accurate CT numbers that allow proton dose calculation. GPU-based deformable image registration algorithms are developed and evaluated for automatic ROI-delineation and dose mapping. The online and offline IGPT functionalities are evaluated with daily CT images of the proton patients. Conclusion: The online and offline IGPT software tool may improve the safety and quality of proton treatment by allowing dose-based IGPT and adaptive proton treatments. Research is partially supported by Mevion Medical Systems.
Hyatt, M.W.; Hubert, W.A.
2001-01-01
We developed a standard-weight (Ws) equation for brown trout (Salmo trutta) in lentic habitats by applying the regression-line-percentile technique to samples from 49 populations in North America. The proposed Ws equation is log10 Ws = -5.422 + 3.194 log10 TL, when Ws is in grams and TL is total length in millimeters. The English-unit equivalent is log10 Ws = -3.592 + 3.194 log10 TL, when Ws is in pounds and TL is total length in inches. The equation is applicable for fish of 140-750 mm TL. Proposed length-category standards to evaluate fish within populations are: stock, 200 mm (8 in); quality, 300 mm (12 in); preferred, 400 mm (16 in); memorable, 500 mm (20 in); and trophy, 600 mm (24 in).
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
Epstein-Barr Virus Neurologic Complications
Directory of Open Access Journals (Sweden)
J. Gordon Millichap
2015-12-01
Full Text Available Investigators at the Karol Marcinkowski University of Medical Sciences, Poznan, Poland, analyzed the records of 194 children diagnosed with Epstein-Barr virus infection and having the viral capsid antigen IgM antibody.
TDM-pumped RFA Assisted Transmission of 20x10 GE Channels over 364 km in a Three Span Link
Czech Academy of Sciences Publication Activity Database
Karásek, Miroslav; Vojtěch, M.; Radil, J.
2010-01-01
Roč. 31, č. 4 (2010), s. 194-197 ISSN 0173-4911 Institutional research plan: CEZ:AV0Z20670512 Keywords : Distributed Raman amplification * Long fiber * Fiber spans Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
EPA's Review of DOE's Inventory Tracking for TRU Wastes at Waste Control Specialists
On April 9, 2014, EPA's Waste Isolation Pilot Plant (WIPP) waste characterization team visited Waste Control Specialists (WCS) to determine whether DOE was meeting EPA's waste inventory tracking requirements at 40 CFR 194.24(c)(4).
Provenance and tectonic setting of the Triassic Yidun Group, the Yidun Terrane, Tibet
Directory of Open Access Journals (Sweden)
Bai-Qiu Wang
2013-11-01
Prominently high Zr/Sc ratio or Hf concentration and Paleoproterozoic Nd modal ages (1.94–2.21 Ga point to input of recycling components derived from old sedimentary source in a relatively stable tectonic setting.
Radioimmunoassays for cyclic AMP cross-react with phosphodiesterase inhibitors and buffer components
Sinha, B; Semmler, J; Haen, E; Moeller, J; Endres, S
We addressed the issue of cross-reactivity of several commonly used phosphodiesterase inhibitors with radioimmunoassays for cyclic AMP, after we had observed a considerably high cross-reactivity with a noncommercial antibody. Theophylline, pentoxifylline, penthydroxifylline (BL 194), albifylline
Czech Academy of Sciences Publication Activity Database
Šturma, Pavel
2010-01-01
Roč. 18, č. 6 (2010), s. 191-194 ISSN 1210-6410 Institutional research plan: CEZ:AV0Z70680506 Keywords : the Lisbon Treaty * the Charter of Fundamental Rights of the EU Subject RIV: AG - Legal Sciences
Polysome Profile Analysis - Yeast
Czech Academy of Sciences Publication Activity Database
Pospíšek, M.; Valášek, Leoš Shivaya
2013-01-01
Roč. 530, č. 2013 (2013), s. 173-181 ISSN 0076-6879 Institutional support: RVO:61388971 Keywords : grow yeast cultures * polysome profile analysis * sucrose density gradient centrifugation Subject RIV: CE - Biochemistry Impact factor: 2.194, year: 2013
Injury and mechanism of recombinant E. coli expressing STa on piglets colon.
Lv, Yang; Li, Xueni; Zhang, Lin; Shi, Yutao; DU, Linxiao; Ding, Binying; Hou, Yongqing; Gong, Joshua; Wu, Tao
2018-02-09
Enterotoxigenic Escherichia coli (ETEC) is primary pathogenic bacteria of piglet diarrhea, over two thirds of piglets diarrhea caused by ETEC are resulted from STa-producing ETEC strains. This experiment was conducted to construct the recombinant E. coli expressing STa and study the injury and mechanism of recombinant E. coli expressing STa on 7 days old piglets colon. Twenty-four 7 days old piglets were allotted to four treatments: control group, STa group (2 × 10 9 CFU E. coli LMG194-STa), LMG194 group (2 × 10 9 CFU E. coli LMG194) and K88 group (2 × 10 9 CFU E. coli K88). The result showed that E. coli infection significantly increased diarrhea rates; changed DAO activity in plasma and colon; damaged colonic mucosal morphology including crypt depth, number of globet cells, density of lymphocytes and lamina propria cell density; substantially reduced antioxidant capacity by altering activities of GSH-Px, SOD, and TNOS and productions of MDA and H 2 O 2 ; obviously decreased AQP3, AQP4 and KCNJ13 protein expression levels; substantially altered the gene expression levels of inflammatory cytokines. Conclusively, STa group had the biggest effect on these indices in four treatment groups. These results suggested that the recombinant strain expressed STa can induce piglets diarrhea and colonic morphological and funtional damage by altering expression of proteins connect to transportation function and genes associated with intestinal injury and inflammatory cytokines.
Patterson, Richard; Hammoud, Ahmad
2011-01-01
A new commercial-off-the-shelf (COTS) gate driver designed to drive both the high-side and the low-side enhancement-mode GaN FETs, National Semiconductor's type LM5113, was evaluated for operation at temperatures beyond its recommended specified limits of -40 C to +125 C. The effects of limited thermal cycling under the extended test temperature, which ranged from -194 C to +150 C, on the operation of this chip as well as restart capability at the extreme cryogenic and hot temperatures were also investigated. The driver circuit was able to maintain good operation throughout the entire test regime between -194 C and +150 C without undergoing any major changes in its outputs signals and characteristics. The limited thermal cycling performed on the device also had no effect on its performance, and the driver chip was able to successfully restart at each of the extreme temperatures of -194 C and +150 C. The plastic packaging of this device was also not affected by either the short extreme temperature exposure or the limited thermal cycling. These preliminary results indicate that this new commercial-off-the-shelf (COTS) halfbridge eGaN FET driver integrated circuit has the potential for use in space exploration missions under extreme temperature environments. Further testing is planned under long-term cycling to assess the reliability of these parts and to determine their suitability for extended use in the harsh environments of space.
Jung, Dawoon E; Park, Soo Been; Kim, Kahee; Kim, Chanyang; Song, Si Young
2017-09-07
Cholangiocarcinoma is a devastating malignancy with fatal complications that exhibits low response and resistance to chemotherapy. Here, we evaluated the anticancer effects of CG200745, a novel histone deacetylase inhibitor, either alone or in combination with standard chemotherapy drugs in cholangiocarcinoma cells. CG200745 dose-dependently reduced the viability of cholangiocarcinoma cells in vitro and decreased tumour volume and weight in a xenograft model. Administering CG200745 along with other chemotherapeutic agents including gemcitabine, 5-fluorouracil (5-FU), cisplatin, oxaliplatin, or gemcitabine plus cisplatin further decreased cholangiocarcinoma cell viability, with a combination index CG200745 also enhanced the sensitivity of gemcitabine-resistant cells to gemcitabine and 5-FU, thereby decreasing cell viability and inducing apoptosis. This was accompanied by downregulation of YAP, TEAD4, TGF-β2, SMAD3, NOTCH3, HES5, Axl, and Gas6 and upregulation of the miRNAs miR-22-3p, miR-22-5p, miR-194-5p, miR-194-3p, miR-194-5p, miR-210-3p, and miR-509-3p. The Ingenuity Pathway Analysis revealed that CG200745 mainly targets the Hippo signalling pathway by inducing miR-509-3p expression. Thus, CG200745 inhibits cholangiocarcinoma growth in vitro and in vivo, and acts synergistically when administered in combination with standard chemotherapeutic agents, enabling dose reduction. CG200745 is therefore expected to improve the outcome of cholangiocarcinoma patients who exhibit resistance to conventional therapies.
Isolement et identification de microorganismes indigènes de ...
African Journals Online (AJOL)
user
The management strategy is based on the development of an ...... France.194 p. Duijff BJ., Gianinazzi-Pearson V. & Lemanceau P. ... Wood G.A.R.,. & Lass R. A. Eds. 4th edition, Longman, ... 13th International Cocoa Research Conference.
Book Reviews/ Notes de lecture
African Journals Online (AJOL)
sulaiman.adebowale
2006-08-29
Aug 29, 2006 ... 189–194. © Council for the Development of Social Science Research in Africa, 2006 ... Globalization, for instance, has undermined the legitimacy and power .... The third chapter by Anna Madoeff examines the role of Moulids.
ORF Alignment: NC_000909 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta
I nducin ng and d ident ifying in b artifici banana ially-in as nduced d ...
African Journals Online (AJOL)
SAM
520. Stover RH, Simmonds NW(1987). Bananas. Third Edition. Longman,. London. Vakili NG (1962). Colchicine-induced polyploidy in Musa. Nature 194: 453-454. Van Duren M, Morpurgo R, Dolezel J Afza R (1996). Induction and verification of ...
Czech Academy of Sciences Publication Activity Database
Smith, D.; Chippendale, T. W. E.; Španěl, Patrik
2013-01-01
Roč. 9, č. 4 (2013), s. 550-557 ISSN 1573-4110 Institutional support: RVO:61388955 Keywords : selected ion flow tube mass spectrometry * SIFT-MS * acetaldehyde Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013
Czech Academy of Sciences Publication Activity Database
Chang, H.-C.; Li, F.; Shao, K.-T.; Lin, Y.-S.; Morosawa, T.; Kim, S.; Koo, H.; Kim, W.; Lee, J.-S.; He, S.; Smith, Carl; Reichard, Martin; Miya, M.; Sado, T.; Uehara, K.; Lavoué, S.; Chen, W.-J.; Mayden, R. L.
2014-01-01
Roč. 81, December (2014), s. 182-194 ISSN 1055-7903 Institutional support: RVO:68081766 Keywords : Acheilognathinae * Cyprinidae * Cryptic species * Nuclear loci * Cytochrome b * European bitterling Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.916, year: 2014
African Journals Online (AJOL)
Items 51 - 100 of 194 ... ... Cotecxin and Amalar in Human Plasmodium falciparum in Malaria, Abstract ... Induced in the Germ and Bone Marrow Cells of Mice by Caffeine ... crude oil, oil spill dispersant and lindane in chick embryo, Abstract.
Breast Cancer Basics and You: Introduction | NIH MedlinePlus the Magazine
... of this page please turn Javascript on. Feature: Breast Cancer Breast Cancer Basics and You: Introduction Past Issues / Spring - Summer ... were more than 194,000 new cases of breast cancer in the United States in 2009. More than ...
Vascular epiphyte vegetation in rocky savannas of southeastern Brazil
Czech Academy of Sciences Publication Activity Database
Alves, R. J. V.; Kolbek, Jiří; Becker, J.
2008-01-01
Roč. 26, 1-2 (2008), s. 101-117 ISSN 0107-055X Institutional research plan: CEZ:AV0Z60050516 Keywords : epiphytic communities * campo rupestre * Minas Gerais Subject RIV: EF - Botanics Impact factor: 0.194, year: 2008
Association study between XRCC1 gene polymorphisms and sporadic amyotrophic lateral sclerosis.
Coppedè, Fabio; Migheli, Francesca; Lo Gerfo, Annalisa; Fabbrizi, Maria Rita; Carlesi, Cecilia; Mancuso, Michelangelo; Corti, Stefania; Mezzina, Nicoletta; del Bo, Roberto; Comi, Giacomo P; Siciliano, Gabriele; Migliore, Lucia
2010-01-01
The aim of the present study was to investigate the possible contribution of three common functional polymorphisms in the DNA repair protein X-ray repair cross-complementing group 1 (XRCC1), namely Arg194Trp (rs1799782), Arg280His (rs25489) and Arg399Gln (rs25487), to sporadic amyotrophic lateral sclerosis (SALS). We genotyped 206 Italian SALS patients and 203 matched controls for XRCC1 Arg194Trp, Arg280His and Arg399Gln polymorphisms by means of PCR/RFLP technique, searching for association between any of the studied polymorphisms and disease risk, age and site of onset. We observed a statistically significant difference in XRCC1 Gln399 allele frequencies between SALS cases and controls (0.39/0.28; p=0.001). The present study suggests that the XRCC1 Arg399Gln polymorphism might contribute to SALS risk.
Magnetically modified Sargassum horneri biomass as an adsorbent for organic dye removal
Czech Academy of Sciences Publication Activity Database
Angelova, R.; Baldíková, E.; Pospíšková, K.; Maděrová, Z.; Šafaříková, Miroslava; Šafařík, Ivo
2016-01-01
Roč. 137, November (2016), s. 189-194 ISSN 0959-6526 Institutional support: RVO:60077344 Keywords : Sargassum horneri * brown seaweed * magnetic adsorbent * microwave synthesis * magnetic iron oxide Subject RIV: DJ - Water Pollution ; Quality Impact factor: 5.715, year: 2016
DEFF Research Database (Denmark)
Flintholm Raft, Kristoffer; Frestad, Daria; Michelsen, Marie Mide
2017-01-01
PURPOSE: We investigated whether impaired flow-mediated dilation (FMD) and plasma biomarkers reflecting endothelial dysfunction are associated with coronary microvascular dysfunction (CMD) in women with angina and no obstructive coronary artery disease (CAD). METHODS: Patients (n = 194) were rand...
African Journals Online (AJOL)
Items 1 - 50 of 194 ... Journal Home > Advanced Search > Browse Title Index ... Vol 14, No 1 (2000), A functional categoriality of adjectives in ... Vol 1, No 1 (1987), Alienation and affirmation: The humanistic vision of Bessie Head, Abstract PDF.
Czech Academy of Sciences Publication Activity Database
Szydlowski, A.; Badziak, A.; Parys, P.; Wolowski, J.; Woryna, E.; Jungwirth, Karel; Králiková, Božena; Krása, Josef; Láska, Leoš; Pfeifer, Miroslav; Rohlena, Karel; Skála, Jiří; Ullschmied, Jiří; Boody, F. D.; Gammino, S.; Torrisi, L.
2004-01-01
Roč. 7, č. 3 (2004), s. 327-332 ISSN 1093-3611 Institutional research plan: CEZ:AV0Z1010921 Keywords : iodine laser * nuclear track detectors * ions Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.194, year: 2004
Southern African Journal of Anaesthesia and Analgesia - Vol 19, No ...
African Journals Online (AJOL)
Pioneers in South African Anaesthesia: Professor Arthur Bull and the Taurus Radiofrequency Blood Warmer · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PC Gordon, ND Hauser, J Marais, 194-196 ...
Full Text Available ... 029 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 412,404 ... 081,511 views 4:50 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 25,194 views ...
Thermal optimality of net ecosystem exchange of carbon dioxide and underlying mechanisms
Czech Academy of Sciences Publication Activity Database
Niu, S.; Luo, Y.; Fei, S.; Marek, Michal V.
2012-01-01
Roč. 194, č. 3 (2012), s. 775-783 ISSN 0028-646X Institutional support: RVO:67179843 Keywords : climate change * optimum temperature * temperature acclimation * temperature adaptation * thermal optimality Subject RIV: EH - Ecology, Behaviour Impact factor: 6.736, year: 2012
Distribution of local anesthetics between aqueous and liposome phases
Czech Academy of Sciences Publication Activity Database
Ruokonen, S. K.; Duša, Filip; Rantamäki, A. H.; Robciuc, A.; Holma, P.; Holopainen, J. M.; Abdel-Rehim, M.; Wiedmer, S. K.
2017-01-01
Roč. 1479, JAN (2017), s. 194-203 ISSN 0021-9673 Institutional support: RVO:68081715 Keywords : liposome electrokinetic chromatography * distribution constants * EOF markers Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.981, year: 2016
2010-07-26
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-72,194] Pendleton Woolen Mills, Inc., Washougal, WA; Notice of Negative Determination Regarding Application for Reconsideration By application dated May 4, 2010, a petitioner requested administrative reconsideration of the Department's...
Digital Repository Service at National Institute of Oceanography (India)
Vizakat, L.; Harkantra, S.N.; Parulekar, A.H.
(Shannon Wiener index) varied from 0.44 to 3.58 (X = 1.94, SD = + or - 0.89). Population and community structure were more stable in premonsoon months. Carnivorous species Glycera alba modified the community structure mainly due to prey...
African Journals Online (AJOL)
Items 101 - 150 of 194 ... Vol 26 (2010), Lipid-Lowering Activity of the Leaf Extracts of Vitex ... effect(s)of potash on the antimicrobial efficacy of crude extracts of ... Vol 20 (2004), Pharmacological profile of Caesalpinia bonducella Flem, Abstract.
Growth of preschool coloured children in CaRe Town
African Journals Online (AJOL)
1991-06-01
Jun 1, 1991 ... ... the environment is unfavourable, particularly if the diet is deficient or unbalanced, ..... The reasons for discontinuing breast-feeding ... returning to work in 19,4%, and maternal illness or being advised .... {lfSt 6 months of life.
Full Text Available ... 362 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 412,404 ... 219,427 views 1:27 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 25,194 views ...
SIFT-MS Analysis of Nose-Exhaled Breath; Mouth Contamination and the Influence of Exercise
Czech Academy of Sciences Publication Activity Database
Smith, D.; Chippendale, T. W. E.; Dryahina, Kseniya; Španěl, Patrik
2013-01-01
Roč. 9, č. 2013 (2013), s. 565-575 ISSN 1573-4110 Institutional support: RVO:61388955 Keywords : selected ion flow tube mass spectrometry * breath analysis * nose exhalation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.194, year: 2013
Ajaleht Pravda ja 40 keisri hullu : "40 kiri" sündis siis, kui teisiti enam ei saanud / Lauri Vahtre
Vahtre, Lauri, 1960-
2005-01-01
Eesti kultuuritegelaste kirjutatud "40 kirjast" 1980. aastal, kus tunti muret Eesti ühiskonna ja kultuuri tuleviku pärast. Artikkel sisaldab kirjale allakirjutanute nimesid. Ilmunud ka rmt.: Vahtre, Lauri. Ajaloo pööripäevad. Tallinn, 2006, lk. 190-194
Czech Academy of Sciences Publication Activity Database
Jia, Dong-Rui; Abbott, R.J.; Liu, T.-L.; Mao, K.-S.; Bartish, Igor V.; Liu, J.-Q.
2012-01-01
Roč. 194, č. 4 (2012), s. 1123-1133 ISSN 0028-646X Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : intraspecefic evolution * migration * phylogeography Subject RIV: EF - Botanics Impact factor: 6.736, year: 2012
Retrospective Geospatial Modeling of PM10 Exposures from Open Burning at Joint Base Balad, Iraq
2011-03-01
Gullett & Linak, 2007), and complex munitions (Wilcox, Entezam, Molenaar , & Shreeve, 1996). Documentation on emissions from the open burning of typical...of a Petrochemical Refinery: a Cross- sectional Study. Environmental Health , 8 (45). 194 Wilcox, J., Entezam, B., Molenaar , B., & Shreeve, T
Carriage, antimicrobial susceptibility profiles and genetic diversity of ...
African Journals Online (AJOL)
All isolates were susceptible to nitrofurantoin and linezolid and resistant in high numbers (194, 81.9%) to ampicillin. Resistances to amoxicillin-clavulanic acid, erythromycin, chloramphenicol, gentamicin, ciprofloxacin, norfloxacin and trimethoprimsulfamethoxazole were below 20%. The overall prevalence of MRSA among ...
Czech Academy of Sciences Publication Activity Database
Miovský, Michal; Šťastná, L.; Řehan, V.
2004-01-01
Roč. 8, č. 3 (2004), s. 194-199 ISSN 1211-7579 R&D Projects: GA ČR GA406/02/1449 Institutional research plan: CEZ:AV0Z7025918 Keywords : Cannabis * epidemiological indicators * drug use Subject RIV: AN - Psychology
First report on trichomonads from true bugs
Czech Academy of Sciences Publication Activity Database
Smejkalová, P.; Votýpka, Jan; Lukeš, Julius; Čepička, I.
2014-01-01
Roč. 61, č. 3 (2014), s. 189-194 ISSN 0015-5683 Institutional support: RVO:60077344 Keywords : Parabasalia * intestinal endosymbionts * Simplicimonas * Monocercomonas * phylogeny * SSU rDNA * Heteroptera * Insecta * host-parasite association Subject RIV: EG - Zoology Impact factor: 1.147, year: 2014
Grand Tour: Kolem světa za tři roky
Czech Academy of Sciences Publication Activity Database
Suchomelová, Marcela
-, č. 12 (2017), s. 194-201 ISSN 1804-9257 Institutional support: RVO:68378076 Keywords : journey around the world * trade and cultural relations * collection of photographs Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: 6.5 Other Humanities and the Arts
Sources of Microbial Contamination of Local Herbal Medicines Sold ...
African Journals Online (AJOL)
Four hundred traditional herbalists operating in an open air market in Ilala, Dar es. Salaam ... The containers in which the medicines were handled were washed .... Pots. 186 (60.0). -. Pans. 306 (86.0). -. Bottles. 194 (44.7). 315 (81.1). Cans.
Telomere Length in Circulating Lymphocytes: Association with Chromosomal Aberrations
Czech Academy of Sciences Publication Activity Database
Hemminki, K.; Rachakonda, S.; Musak, L.; Vymetálková, Veronika; Halasová, E.; Forsti,, A.; Vodičková, Ludmila; Buchancová, J.; Vodička, Pavel; Kumar, R.
2015-01-01
Roč. 54, č. 3 (2015), s. 194-196 ISSN 1045-2257 Institutional support: RVO:68378041 Keywords : structural chromosome aberrations * healthy subjects * relative telomere length * genotoxicity * telomere biology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.960, year: 2015
Hydroxycalciopyrochlore from a regionally metamorphic marble at Bližná, Southwestern Czech Republic
Czech Academy of Sciences Publication Activity Database
Drábek, M.; Frýda, J.; Šarbach, M.; Skála, Roman
2017-01-01
Roč. 194, č. 1 (2017), s. 49-59 ISSN 0077-7757 Institutional support: RVO:67985831 Keywords : hydroxycalciopyrochlore * pyrochlore * carbonatite-like marble * marble * Moldanubian Varied Group Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 0.811, year: 2016
Enzyme Hydrolysis of Soybean Oil in a Slug Flow Microsystem
Czech Academy of Sciences Publication Activity Database
Čech, J.; Schrott, W.; Slouka, Z.; Přibyl, M.; Brož, M.; Kuncová, Gabriela; Šnita, D.
2012-01-01
Roč. 67, AUG 15 (2012), s. 194-202 ISSN 1369-703X R&D Projects: GA MŠk ME 892 Institutional support: RVO:67985858 Keywords : lipase * microemulsion * micromixing Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.579, year: 2012
Presence of the amphibian chytrid pathogen confirmed in Cameroon
Czech Academy of Sciences Publication Activity Database
Baláž, V.; Kopecký, O.; Gvoždík, Václav
2012-01-01
Roč. 22, č. 3 (2012), s. 191-194 ISSN 0268-0130 R&D Projects: GA MŠk LC06073 Institutional support: RVO:67985904 Keywords : Afromontane * chytridiomycosis * Congolian lowland rainforests Subject RIV: EG - Zoology Impact factor: 1.081, year: 2012
Advances in On-line Absolute Trace Gas Analysis by SIFT-MS
Czech Academy of Sciences Publication Activity Database
Španěl, Patrik; Smith, D.
2013-01-01
Roč. 9, č. 4 (2013), s. 525-539 ISSN 1573-4110 Institutional support: RVO:61388955 Keywords : selected ion flow tube mass spectrometry * SIFT-MS * volatile organic compounds Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.194, year: 2013
A new structural technique for examining ion-neutral association in aqueous solution
Czech Academy of Sciences Publication Activity Database
Mason, Philip E.; Neilson, G. W.; Price, D. L.; Saboungi, M. L.; Brady, J. W.
2013-01-01
Roč. 160, 07 January (2013), s. 161-170 ISSN 1359-6640 Grant - others:NIH(US) GM63018 Institutional support: RVO:61388963 Keywords : aqueous solutions * neutron diffraction * molecular dynamics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.194, year: 2013
Particulate Matter deposition on Quercus ilex leaves in an industrial city of central Italy
Czech Academy of Sciences Publication Activity Database
Sgrigna, G.; Saebo, A.; Gawronski, S.; Popek, R.; Calfapietra, Carlo
2015-01-01
Roč. 197, FEB 2015 (2015), s. 187-194 ISSN 0269-7491 Institutional support: RVO:67179843 Keywords : PM10 * PM2.5 * Leaf deposition * Quercus ilex * urban environment * atmospheric pollution Subject RIV: EH - Ecology, Behaviour Impact factor: 4.839, year: 2015
Czech Academy of Sciences Publication Activity Database
Staněk, Martin; Géraud, Y.; Lexa, O.; Špaček, P.; Ulrich, S.; Diraison, M.
2013-01-01
Roč. 194, č. 1 (2013), s. 383-394 ISSN 0956-540X Institutional support: RVO:67985530 Keywords : magnetic fabrics and anisotropy * microstructures * seismic anisotropy * fractures and faults Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.724, year: 2013
Burgmeijer, R.J.F.; Jonge, G.A. de
1995-01-01
Objective: To determine whether the sleeping position and the use of duvets in infants in 1994 had changed in comparison with earlier years. Design: Questionnaire survey. Setting: Nationwide investigation in infant welfare centres. Method: 194 infant welfare centres participated in the
Ultrafine and Fine Particles and Hospital Admissions in Central Europe Results from the UFIREG Study
Czech Academy of Sciences Publication Activity Database
Lanzinger, S.; Schneider, A.; Breitner, S.; Stafoggia, M.; Erzen, I.; Dostál, Miroslav; Pastorková, Anna; Bastian, S.; Cyrys, J.; Zscheppang, A.; Kolodnitská, T.; Peters, A.
2016-01-01
Roč. 194, č. 10 (2016), s. 1233-1241 ISSN 1073-449X Institutional support: RVO:68378041 Keywords : ultrafine particles * particulate matter * hospital admissions * respiratory Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 13.204, year: 2016
Czech Academy of Sciences Publication Activity Database
Bombi, G.; Lora, S.; Zancato, M.; D'Archivio, A. A.; Jeřábek, Karel; Corain, B.
2003-01-01
Roč. 194, 1-2 (2003), s. 273-281 ISSN 1381-1169 Institutional research plan: CEZ:AV0Z4072921 Keywords : palladium nanoclusters * gel-type resins * catalyst Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.264, year: 2003
Why is the Bond Multiplicity in C2 so Elusive?
Czech Academy of Sciences Publication Activity Database
Cooper, D.L.; Penotti, F.E.; Ponec, Robert
2015-01-01
Roč. 1053, SI (2015), s. 189-194 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : bond multiplicity in C2 * spin correlation matrices * full GVB and spin-coupled Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015
75 FR 67077 - Television Broadcasting Services; Huntsville, AL
2010-11-01
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [DA 10-2000; MB Docket No. 08-194; RM-11488] Television Broadcasting Services; Huntsville, AL AGENCY: Federal Communications Commission. ACTION: Proposed... 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal...
Journal for Language Teaching - Vol 47, No 2 (2013)
African Journals Online (AJOL)
Scaffolded Code-switching: A resource for achieving academic literacy? EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R-M McCabe, 159-194. http://dx.doi.org/10.4314/jlt.v47i2.9 ...
Directory of Open Access Journals (Sweden)
Xi-hua LI
2015-05-01
Full Text Available Background China is one of the countries that have the largest number of patients suffering from Duchenne and Becker muscular dystrophy (DMD/BMD. Although the building of international DMD/BMD databases has laid a foundation for clinical drug development and clinical trials, it has not yet been carried out in China. In this study, a modified registry form of Remudy was applied to 229 DMD/BMD patients in order to establish a comprehensive database, which will lay the groundwork for international cooperation. Methods A total of 229 DMD/BMD patients diagnosed by genetic testing or muscle biopsy admitted in Children's Hospital of Fudan University (CHFU during the period of August 2011 to December 2013 were enrolled in this study. The data included sex, age, age at diagnosis, geographic distribution of patients, DMD gene mutation types, family history, walking capability, cardiac and respiratory function, steroid treatment and rehabilitation intervention. Results There were 194 DMD and 35 BMD male patients who were diagnosed at the age of 0-18 years, and among them, most patients were diagnosed at the age of > 3-4 (16.59%, 38/229 and > 7-8 (14.85%, 34/229 years. Exon deletion was the most frequent genetic mutations for DMD/BMD [65.46% (127/194 and 74.29% (26/35], respectively. Patients with a family history accounted for 23.14% (53/229. The rate of DMD registrants losing walking capability was 17.53% (34/194, and all the BMD registrants were able to walk. Cardiac functions were examined in 46.29% (106/229 DMD/BMD boys and respiratory functions were examined in 17.90% (41/229 DMD/BMD boys. The proportion of DMD patients receiving prednisone with dosage of 0.75 mg/(kg·d was 26.29% (51/194. Conclusions This database describes in detail the genotype, clinical manifestation, diagnosis and treatment and rehabilitation status of 229 DMD/BMD patients in China. The database not only provides comprehensive information for DMD/BMD patient management
Czech Academy of Sciences Publication Activity Database
Davies, S. J.; Engel, B.; Chan, C.; Tan, B. K.; Yu, Z.; Asghar, R. B.; John, B.; Španěl, Patrik; Smith, D.
2013-01-01
Roč. 9, č. 4 (2013), s. 593-599 ISSN 1573-4110 R&D Projects: GA ČR GA203/00/0632 Institutional support: RVO:61388955 Keywords : bioimpedance * body composition * dialysis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013
Patterns of bone loss around teeth restored with endodontic posts
Katsamakis, S.; Timmerman, M.; van der Velden, U.; de Cleen, M.; van der Weijden, F.
2009-01-01
Objectives: This retrospective study described the pattern of bone loss around teeth with endodontic posts in periodontitis patients, and compared it with contra-lateral teeth without posts. Material and Methods: From full-mouth radiographic surveys of 146 periodontitis patients (35 years), 194
Schwartz, Orli S.; Dudgeon, Paul; Sheeber, Lisa B.; Yap, Marie B. H.; Simmons, Julian G.; Allen, Nicholas B.
2012-01-01
This study investigated the prospective, longitudinal relations between parental behaviors observed during parent-adolescent interactions, and the development of depression and anxiety symptoms in a community-based sample of 194 adolescents. Positive and negative parental behaviors were examined, with negative behaviors operationalized to…
Normal lymphographic findings and diagnostic errors in the retroperitoneal space
International Nuclear Information System (INIS)
Klein, U.; Heinze, H.G.
1980-01-01
Diagnostic erros in the lymphograms of 194 normal patients are shown to be due to topographical variations of the lymph system, influx and distribution of contrast media in the lymph ducts and nodes, and degenerative changes caused by old age. (orig.) [de
Mihhailova, Gerda
2006-01-01
Ettevõtte kasvu- ja küpsusfaasis vajatakse autorite hinnangul enam nn. klassikalisi juhte, karismaatilised juhid sobivad pigem radikaalseid muutusi nõudvatesse situatsioonidesse, nagu näiteks ettevõtte rajamine või selle langusfaasist välja toomine. Skeemid. Tabel. Lisa lk. 194
Yu šien yuan cha dzu czha t šia lie kutí
Czech Academy of Sciences Publication Activity Database
Chen, W.; Křížek, Michal
2009-01-01
Roč. 39, č. 15 (2009), s. 159-194 ISSN 1000-0984 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional research plan: CEZ:AV0Z10190503 Keywords : uniform partition * superconvergence * Céa's lemma Subject RIV: BA - General Mathematics
Czech Academy of Sciences Publication Activity Database
Vacek, J.; Buchler, P.; Navrátil, Oldřich
2012-01-01
Roč. 60, č. 9 (2012), s. 194-199 ISSN 0139-6013 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : transgenic potato * reducing sugars * chips/crisps colour Subject RIV: EB - Genetics ; Molecular Biology
2007-06-01
to chalking. Fluorinated polymers are recognized as the most durable coatings in terms of preservation of appearance. Architectural building panels...phosphate) 19.4 Percent by Weight Film-Former phenolic varnish 55.3 Percent by Weight Antioxidant butylated hydroxytoluene (BHT) 0.43 Percent
Apers, Silke; Dancet, Eline A. F.; Aarts, Johanna W. M.; Kluivers, Kirsten B.; D'Hooghe, Thomas M.; Nelen, Willianne L. D. M.
2018-01-01
In this cross-sectional study, we investigated whether patient-centred endometriosis care (PCEC) is associated with health-related quality of life (HRQOL). Dutch-speaking women with endometriosis, treated by laparoscopy in a university clinic between 2009 and 2010, were eligible (n = 194).
EXPERIMENTAL STUDY IN NATURAL CONVECTION
African Journals Online (AJOL)
PROF. BARTH EKWEME
often heavily depend on imports of oil and gas. However, they have one of ... Table 1: Main features of the Manzanares power plant Sclaich et al., (2005). Tower height. 194.6 m ..... chimney cycle analysis with system loss and solar collector ...
Prevalence Of Overweight And Obesity Among Urban Nigeria Adults ...
African Journals Online (AJOL)
Prevalence Of Overweight And Obesity Among Urban Nigeria Adults In Jos. ... to be associated with non-communicable disease (NCDS) like type 2 Diabetes, ... and obesity was 21.4% (19.4%) in males and 23.5% in females (M:F= 1:1.3, ...
Suid...Afrikaanse Tydskrif vir Geneeskunde South African Medical ...
African Journals Online (AJOL)
Postpartum blood loss had not been excessive and she had regular menses for ... Therapy was started with a high-protein diet, vitamin supple- ments and ... coupled with the fine kin and scanty secondary sex hair, raised the .... 1n 194 D ngelo.
Search Results | Page 104 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
In January 2016, shortly after 194 countries signed on to the Sustainable Development Goals (SDGs) ... Economists, social scientists root for basic income in India ... Development INCLUSIVE GROWTH WOMEN'S EMPLOYMENT Poverty Gender ... Ending economic inequality is one of the biggest policy challenges today.
African Journals Online (AJOL)
Items 301 - 350 of 506 ... Vol 79, No 2 (2017), Overview of restoration and management ... by vegetation control when felled at nine years in KwaZulu-Natal, South Africa, Abstract ... Vol 194 (2002), Post fire indicators of fire intensity at indigenous ...
Evaluation of respiration of mitochondria in cancer cells exposed to mitochondria-targeted agents.
Czech Academy of Sciences Publication Activity Database
Klučková, Katarína; Dong, L. F.; Bajziková, Martina; Rohlena, Jakub; Neužil, Jiří
2015-01-01
Roč. 1265, 07 Oct 2015 (2015), s. 181-194 ISSN 1940-6029 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : Animals * Antineoplastic Agents * drug effects * *pharmacology Subject RIV: EB - Genetics ; Molecular Biology
Witteveen, Anke B.; Bramsen, Inge; Twisk, Jos W. R.; Huizink, Anja C.; Slottje, Pauline; Smid, Tjabe; van der Ploeg, Henk M.
2007-01-01
This study examined specific and general psychological distress 8.5 years following the 1992 cargo aircraft crash in Amsterdam. Participants included 334 occupationally exposed fire fighters and 834 occupationally exposed police officers compared with reference groups of 194 fire fighters and 634
DEFF Research Database (Denmark)
Bandello, Francesco; Tejerina, Amparo Navea; Vujosevic, Stela
2015-01-01
PURPOSE: To identify the retinal layer predominantly affected in eyes with subclinical and clinical macular edema in diabetes type 2. METHODS: A cohort of 194 type 2 diabetic eyes/patients with mild nonproliferative diabetic retinopathy (ETDRS levels 20/35) were examined with Cirrus spectral......-domain optical coherence tomography (OCT) at the baseline visit (ClinicalTrials.gov identifier: NCT01145599). Automated segmentation of the retinal layers of the eyes with subclinical and clinical macular edema was compared with a sample of 31 eyes from diabetic patients with normal OCT and an age......-matched control group of 58 healthy eyes. RESULTS: From the 194 eyes in the study, 62 had subclinical macular edema and 12 had clinical macular edema. The highest increases in retinal thickness (RT) were found in the inner nuclear layer (INL; 33.6% in subclinical macular edema and 81.8% in clinical macular edema...
75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116
2010-09-09
... Guide 1.38, ``Quality Assurance Requirements for Packaging, Shipping, Receiving, Storage, and Handling....116, ``Quality Assurance Requirements for Installation, Inspection, and Testing of Mechanical... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research, U.S. Nuclear Regulatory...
National Research Council Canada - National Science Library
Kannicht, Christoph
2002-01-01
... single glycosylation sites in a protein. Additional powerful techniques facilitate the analysis of glycosylphosphatidylinositols, lipid modifications, protein phosphorylation and sulfation, protein methylation and acetylation, a-amidation...
IMPRISONMENT AS A RESULT OF WOMEN SUBORDINATION 194 REFLECTED IN MAYA ANGELOU‘S POEMS
Directory of Open Access Journals (Sweden)
Fatikha Amalina
2017-12-01
Full Text Available This research is aimed to describe the imprisonment of African American people, especially women, in the case of patriarchy and women subordination through Maya Angelou‘s selected poems entitled ―Caged Bird‖, ―Still I Rise‖ and ―Woman Work‖. This research discusses the meaning behind the poems that reflected Maya Angelou‘s life experience relating to women subordination and freedom. Feminism approach is applied to analyze the concept of freedom in women subordination and patriarchy in this research. The paper points to how the concept of gender intertwines with labor, ethnics, kinship and gender domination. Without aiming to paint a detailed picture of feminism, the paper explores how ideas developed in these inquiries question the taken-for-granted assumption about the universality of women‘s subordination and challenge the emancipation prerequisite of feminist agenda.
Social Gains from Female Education: A Cross-National Study. World Bank Discussion Papers 194.
Subbarao, K.; Raney, Laura
This paper on the social gains from female education is part of a series, prepared by the World Bank, on the benefits of improving opportunities for women. The paper suggests that expanding women's opportunities enhances their productivity and earning potential and thus contributes to better economic performance and poverty alleviation. Education…
SU-E-T-194: From Dicom-RT to Radiobiological Dose Metrics in 5 Minutes
Energy Technology Data Exchange (ETDEWEB)
Whelan, B; Holloway, L
2014-06-01
Purpose: To develop a flexible and standalone framework for batch calculation of radiobiological dose metrics from Dicom-RT. Methods: Software has been developed which allows (1) The calculation of DVH data from DICOM dose and structure files (DVHgenerator), (2) Calculation of a wide range of radiobiological metrics from this data (CompPlanGui). Both these tools are run via graphical user interface (GUI), making them fast and simple. Part 1 is a new tool which has not previously been published, whilst part 2 is a GUI overlay for the previously published software ‘Comp-Plan’ (Holloway et. al., Medical Dosimetry, 2012), previously reliant on command line interface. The time taken for an experienced user to evaluate a test case of 6 plans with and without CompPlanGUI was quantified. Results: The DVH-generator has been found to be faster, more robust and require far less physical memory then using alternative software solutions for the same purpose. The Comp Plan GUI significantly reduces the amount of time required to set up a base directory, eliminates code crashes arising from typographical errors, and renders the code far more accessible to non-expert users. It took an experienced user of the code around 3 minutes to set up a base directory of 6 plans compared around 8 minutes without, indicating that using CompPlanGUI reduced setup time by over 50%. Conclusion: A standalone GUI based framework has developed which allows for the batch calculation of radiobiological dose metrics directly from Dicom-RT files. As with the original code, this work will be made freely available on request, as well as via matlab file exchange.
2013-01-01
The list of occupational diseases established in the international and national legal system has played important roles in both prevention of and compensation for workers’ diseases. This report reviewed the historical development in the ILO list of occupational diseases and suggested implications of the trends. Since the first establishment of the ILO list of occupational diseases in 1925, the list has played a key role in harmonizing the development of policies on occupational diseases at the international level. The three occupational diseases (anthrax, lead poisoning, and mercury poisoning) in the first ILO list of occupational diseases, set up in 1925 as workmen’s compensation convention represented an increase of occupational diseases from the Industrial Revolution. Until the 1960s, 10 occupational diseases had been representative compensable occupational diseases listed in Convention No. 121, which implies that occupational diseases in this era were equated to industrial poisoning. Since 1980, with advancements in diagnostic techniques and medical science, noise-induced hearing loss, and several bronchopulmonary diseases have been incorporated into the ILO occupational list. Since 2002, changes in the structure of industries, emerging new chemicals, and advanced national worker’s compensation schemes have provoked the ILO to revise the occupational disease list. A new format of ILO list appended in Recommendation 194 (R194) was composed of two dimensions (causes and diseases) and subcategories. Among 50 member states that had provided their national lists of occupational diseases, until 2012 thirty countries were found to have the list occupational diseases having similar structure to ILO list in R194. PMID:24472440
Kim, Eun-A; Kang, Seong-Kyu
2013-08-05
The list of occupational diseases established in the international and national legal system has played important roles in both prevention of and compensation for workers' diseases. This report reviewed the historical development in the ILO list of occupational diseases and suggested implications of the trends. Since the first establishment of the ILO list of occupational diseases in 1925, the list has played a key role in harmonizing the development of policies on occupational diseases at the international level. The three occupational diseases (anthrax, lead poisoning, and mercury poisoning) in the first ILO list of occupational diseases, set up in 1925 as workmen's compensation convention represented an increase of occupational diseases from the Industrial Revolution. Until the 1960s, 10 occupational diseases had been representative compensable occupational diseases listed in Convention No. 121, which implies that occupational diseases in this era were equated to industrial poisoning. Since 1980, with advancements in diagnostic techniques and medical science, noise-induced hearing loss, and several bronchopulmonary diseases have been incorporated into the ILO occupational list. Since 2002, changes in the structure of industries, emerging new chemicals, and advanced national worker's compensation schemes have provoked the ILO to revise the occupational disease list. A new format of ILO list appended in Recommendation 194 (R194) was composed of two dimensions (causes and diseases) and subcategories. Among 50 member states that had provided their national lists of occupational diseases, until 2012 thirty countries were found to have the list occupational diseases having similar structure to ILO list in R194.
International Nuclear Information System (INIS)
Yoon, Sang Min; Hong, Yun-Chul; Park, Heon Joo; Lee, Jong-Eun; Kim, Sang Yoon; Kim, Jong Hoon; Lee, Sang-Wook; Park, So-Yeon; Lee, Jung Shin; Choi, Eun Kyung
2005-01-01
Purpose: The X-ray repair cross-complementing Group 1 (XRCC1) protein is involved mainly in the base excision repair of the DNA repair process. This study examined the association of 3 polymorphisms (codon 194, 280, and 399) of XRCC1 and lung cancer in terms of whether or not these polymorphisms have an effect on the survival of lung cancer patients who have received radiotherapy. Methods and Materials: Between January 2000 and April 2004, 229 lung cancer patients with non-small-cell lung cancer in Stages I-III were enrolled. Genotyping was performed by single base primer extension assay using the SNP-IT Kit with genomic DNA samples from all patients. The haplotype of the XRCC1 polymorphisms was estimated by PHASE version 2.1. Results: The patients consisted of 191 (83.4%) males and 38 (16.6%) females with a median age of 62 (range, 26-88 years). Sixty percent of the patients were included in Stage I-IIIa. The median progression-free and overall survival was 13 months and 16 months, respectively. The XRCC1 codon 194, histology, and stage were shown to be significant predictors of the progression-free survival. The 6 haplotypes among the XRCC1 polymorphisms (194, 280, and 399) were estimated by PHASE v.2.1. The patients with haplotype pairs other than the homozygous TGG haplotype pairs survived significantly longer (p = 0.04). Conclusions: Polymorphisms of XRCC1 have an effect on the survival of lung cancer patients treated with radiotherapy, and this effect seems to be more significant after the haplotype pairs are considered
Koseki, Takuya; Otsuka, Motohiro; Mizuno, Toshiyuki; Shiono, Yoshihito
2017-01-22
Aspergillus oryzae tannase (AoTanA), which contains two Kex2 recognition sites at positions Arg311 and Arg316, consists of two subunits that are generated by the cleavage of tannase gene product by the Kex2 protease. Based on the crystal structure of feruloyl esterase from Aspergillus oryzae (AoFaeB), which has been classified as a member of the fungal tannase family, the catalytic triad residues of AoTanA are predicted to be Ser195, Asp455, and His501, with the serine and histidine residues brought together by a disulfide bond of the neighboring cysteines, Cys194 and Cys502. In this study, we investigated the functional role of the Kex2 recognition sites and disulfide bond between the neighboring cysteines in AoTanA. We constructed a double variant (R311A/R316A), a seven amino-acid deletion variant of region Lys310-Arg316 (ΔKR), and two single variants (C194A and C502A). While the R311A/R316A variant exhibited the two bands similar to wild type by SDS-PAGE after treatment with endoglycosidase H, the ΔKR variant exhibited only one band. R311A/R316A variation had no effect on tannase activity and stability. Meanwhile, the ΔKR variant exhibited higher activity compared to the wild-type. The activities of the C194A and C502A variants decreased considerably (<0.24% of the wild-type) toward methyl gallate. Copyright © 2016 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.
2010-01-01
Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.
Carcass feeding as a cryptic foraging mode in round goby Neogobius melanostomus
Czech Academy of Sciences Publication Activity Database
Polačik, Matej; Jurajda, Pavel; Blažek, Radim; Janáč, Michal
2015-01-01
Roč. 87, č. 1 (2015), s. 194-199 ISSN 0022-1112 R&D Projects: GA ČR(CZ) GAP505/11/1768 Institutional support: RVO:68081766 Keywords : diet * food web * necrophagy * trophic ecology Subject RIV: EG - Zoology Impact factor: 1.246, year: 2015
DEFF Research Database (Denmark)
Thirstrup, Janne Pia; Ruiz-Gonzalez, Aritz; Pujolar, José Martin
2015-01-01
Feral American mink populations (Neovison vison), derived from mink farms, are widespread in Europe. In this study we investigated genetic diversity and genetic differentiation between feral and farm mink using a panel of genetic markers (194 SNP) generated from RAD sequencing data. Sampling incl...
Collins, Kirsten; Gratton, Caroline; Heneage, Celia; Dagnan, Dave
2017-01-01
Background: This study aimed to develop a self-report measure of paid caregivers' empathy towards people with intellectual disabilities. Materials and Methods: Following questionnaire development, 194 staff working in services for people with intellectual disabilities completed self-report questionnaires, including the new empathy measure. The…
Childbearing among Canadian Stepfamilies
Czech Academy of Sciences Publication Activity Database
Heintz-Martin, V.; Le Bourdais, C.; Hamplová, Dana
2014-01-01
Roč. 41, 1-2 (2014), s. 61-77 ISSN 0380-1489 R&D Projects: GA ČR(CZ) GAP404/11/0145 Institutional support: RVO:68378025 Keywords : stepfamilies * child bearing * life course Subject RIV: AO - Sociology, Demography Impact factor: 0.194, year: 2014
Zacharia, Zacharias C.; de Jong, Ton
2014-01-01
This study investigates whether Virtual Manipulatives (VM) within a Physical Manipulatives (PM)-oriented curriculum affect conceptual understanding of electric circuits and related experimentation processes. A pre-post comparison study randomly assigned 194 undergraduates in an introductory physics course to one of five conditions: three…
Maia, L. G.; Bastos, A. V. B.; Solinger, O.N.
2016-01-01
Previous studies on newcomer socialization have evidenced quite consistently that newcomers' affective commitment tends to decline in the first years of employment. In this paper, we attempt to explain why a minority of Brazilian newcomers in a governmental organization (N=194) display growth in
Czech Academy of Sciences Publication Activity Database
Bryja, J.; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, T.; Bryjová, A.; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.
2017-01-01
Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : Arvicanthini * coastal forests * late Miocene Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.248, year: 2016
Brouwers, E.P.M.; Tiemens, B.G.; Terluin, B.; Verhaak, P.F.M.
2006-01-01
OBJECTIVE: The purpose of this study was to evaluate the effectiveness of an activating intervention designed to reduce sick leave duration in patients with emotional distress or minor mental disorders. METHOD: In a 1.5-year randomized controlled trial, 194 patients with minor mental disorders
Caractérisation physico-chimique et contamination métallique des ...
African Journals Online (AJOL)
Au Sénégal, les eaux usées domestiques et industrielles sont versées directement dans le milieu aquatique sans ..... Thèse de doctorat, université Mohamed V,. Faculté des Sciences, Rabat, pp. 194. ... International journal of Innovation and.
Histidine as a catalyst in organic synthesis: A facile in situ synthesis ...
Indian Academy of Sciences (India)
Unknown
They are also used in the synthesis of many nitrogen-containing biologically ... addition to hydroxylamine, results in formation of an imine, azoxy compound 15, ... GC-MS, m/z: 211 (M+), 194 (base peak); 13C NMR (DMSO-d6) δ : 31⋅14 ...
Czech Academy of Sciences Publication Activity Database
Hyánková, L.; Novotná, Božena; Starosta, F.
2015-01-01
Roč. 56, č. 2 (2015), s. 184-194 ISSN 0007-1668 Institutional support: RVO:68378041 Keywords : chick juvenile growth * egg storage * sex-differences * body-weight * hatchability * age * quality * hatch * fluid * time Subject RIV: FP - Other Medical Disciplines Impact factor: 0.933, year: 2015
Catalytic applications and FTIR investigation of zeolite SSZ-33 after isomorphous substitution
Czech Academy of Sciences Publication Activity Database
Vitvarová, Dana; Kurfiřtová, Lenka; Kubů, Martin; Žilková, Naděžda
2014-01-01
Roč. 194, AUG 2014 (2014), s. 174-182 ISSN 1387-1811 R&D Projects: GA ČR GAP106/11/0819 Institutional support: RVO:61388955 Keywords : SSZ-33 * acidity * toluene alkylation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.453, year: 2014
Digest: Ant workers might use ancient regulatory pathways to divide labor
Czech Academy of Sciences Publication Activity Database
Ernst, Ulrich R.
2017-01-01
Roč. 71, č. 1 (2017), s. 193-194 ISSN 0014-3820 Institutional support: RVO:61388963 Keywords : regulatory pathways * social insect * ants Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.201, year: 2016
GloptiPoly: Global optimization over polynomials with Matlab and SeDuMi
Czech Academy of Sciences Publication Activity Database
Henrion, Didier; Lasserre, J.-B.
č. 2 (2003), s. 165-194 ISSN 0098-3500 R&D Projects: GA MŠk ME 496 Institutional research plan: CEZ:AV0Z1075907 Keywords : polynomial programming * semidefinite programming * linear matrix inequality Subject RIV: BC - Control Systems Theory Impact factor: 0.979, year: 2003
van Harten, Peter N.; Hoek, Hans W.; Matroos, Glenn E.; van Os, Jim
Lithium may have neuroprotective properties and therefore could affect the occurrence of tardive dyskinesia (TD). We conducted a nine-year follow-up study with one baseline and six follow-up assessments including all psychiatric inpatients in Curacao (N = 194). TD was measured with the Abnormal
Assessment of awareness on food borne zoonosis and its relation ...
African Journals Online (AJOL)
zoonosis and its relation with Veterinary Public Health Services in Addis Ababa ... appropriate communication media, and to strengthen the contribution of public .... professionals was considered important in their selection of inspected meat ... inter194 professional role of veterinary medicine in human health promotion and.
Professional Competence of Teachers: Effects on Instructional Quality and Student Development
Kunter, Mareike; Klusmann, Uta; Baumert, Jürgen; Richter, Dirk; Voss, Thamar; Hachfeld, Axinja
2013-01-01
This study investigates teachers' pedagogical content knowledge, professional beliefs, work-related motivation, and self-regulation as aspects of their professional competence. Specifically, it examines how these aspects impact instruction and, in turn, student outcomes. In a nationally representative sample of 194 German secondary school…
The Case of NTC's Dictionary of Proverbs and Clichés
African Journals Online (AJOL)
What makes the groups or units of fixed expressions distinct from one .... as to cut off your nose to spite your face and to throw the baby out with the bathwater would be .... meanings. Procedure ...... The biggest frog/toad in the pud- dle (p. 194).
International Nuclear Information System (INIS)
Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.
1994-01-01
The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs
Risk factors for HIV infection at enrollment in an urban male factory cohort in Harare, Zimbabwe
Bassett, M. T.; McFarland, W. C.; Ray, S.; Mbizvo, M. T.; Machekano, R.; van de Wijgert, J. H.; Katzenstein, D. A.
1996-01-01
Between March 1993 and March 1995, volunteers at 40 Harare factories were interviewed regarding sociodemographic characteristics and behavior; HIV serostatus was also determined. Among 2,691 men enrolled, HIV prevalence was 19.4%. Prevalence rose 2-fold with each year of age in young men ( <23
The dark side of romantic relationships: Aggression in adolescent couples and links to attachment
Seiffge-Krenke, I.; Burk, W.J.
2015-01-01
This study focuses on romantic relationships from the perspective of both partners. This dyadic approach was chosen to account for the fact that both partners may differently contribute to the escalation of aggression. In a sample of 194 romantic partner dyads, differences between female and male
Czech Academy of Sciences Publication Activity Database
Myjavcová, R.; Marhol, Petr; Křen, Vladimír; Šimánek, V.; Ulrichová, J.; Palíková, I.; Papoušková, B.; Lemr, Karel; Bednář, P.
2010-01-01
Roč. 1217, č. 51 (2010), s. 7932-7941 ISSN 0021-9673 R&D Projects: GA MPO FT-TA3/024 Institutional research plan: CEZ:AV0Z50200510 Keywords : anthocyanin * blueberry honeysuckle * chromatography Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.194, year: 2010
Identification of accelerated evolution in the metalloproteinase ...
African Journals Online (AJOL)
U
2016-02-24
Feb 24, 2016 ... rich (about 194 residues long) domains are aligned separately. Cys- switch sites (PKMCGV) and Zn2+ binding motifs (HEXXHXXGXXH) are marked in the box of black color. Phylogenetic tree and homology construction. Phylogenetic tree of 12 SVMPs sequences was done using. *Corresponding author.
Anatase–CMK-3 nanocomposite development for hydrogen uptake ...
Indian Academy of Sciences (India)
at a hydrogen pressure up to 1.05 bar and at different temperatures (77, 194.5 ... area, high chemical stability, uniform pore diameter, acces- ... vation effect in ordered porous carbon CMK-3 applied to .... 298 to 473 K with a slope of 4 K min. −1.
Dicty_cDB: Contig-U16263-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 66 |pid:none) Thulinius stephaniae clone Thul320... 192 3e-47 EU020863_1( EU02086...194 7e-48 EU020862_1( EU020862 |pid:none) Narceus americanus clone Nam3202f1... 192 3e-47 EU020866_1( EU0208
Czech Academy of Sciences Publication Activity Database
Biswas, A.; Wilmanski, J.; Forsman, H.; Hrnčíř, Tomáš; Hao, L.; Tlaskalová-Hogenová, Helena; Kobayashi, K.
2011-01-01
Roč. 41, č. 1 (2011), s. 182-194 ISSN 0014-2980 R&D Projects: GA ČR GP310/09/P182 Institutional research plan: CEZ:AV0Z50200510 Keywords : Caspase-1 * Colitis * IL-10 Subject RIV: EC - Immunology Impact factor: 5.103, year: 2011
Social Withdrawal Subtypes during Early Adolescence in India
Bowker, Julie C.; Raja, Radhi
2011-01-01
The overarching goal of this study was to examine the associations between three social withdrawal subtypes (shyness, unsociability, avoidance), peer isolation, peer difficulties (victimization, rejection, exclusion, low acceptance), and loneliness in India during early adolescence. Participants were 194 adolescents in Surat, India (M age=13.35…
Hazardous Waste Cleanup: Reynolds Metals Company in Massena, New York
The Reynolds Metals Company is located at 194 County Route 45 in Massena, New York. The facility has been an active aluminum production plant since 1958. The 1,600-acre facility is bordered on the north by the St. Lawrence River and on the south by the
Czech Academy of Sciences Publication Activity Database
Wallgren, M.; Beranová, Lenka; Pham, Q. D.; Linh, K.; Lidman, M.; Procek, J.; Cyprych, K.; Kinnunen, P. K. J.; Hof, Martin; Gröbner, G.
2013-01-01
Roč. 161, DEC 2013 (2013), s. 499-513 ISSN 1359-6640 R&D Projects: GA AV ČR GEMEM/09/E006 Institutional support: RVO:61388955 Keywords : ACYL-CHAIN REVERSAL * MOLECULAR SIMULATIONS * LIPID-MEMBRANES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.194, year: 2013
Czech Academy of Sciences Publication Activity Database
Bryja, Josef; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, Tatiana; Bryjová, Anna; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.
2017-01-01
Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:68081766 Keywords : Arvicanthini * coastal forests * late Miocene * lowland forests * mountain forests * phylogeography * Plio-Pleistocene climate changes * Rodentia * tropical Africa Subject RIV: EG - Zoology OBOR OECD: Ecology Impact factor: 4.248, year: 2016
African Journals Online (AJOL)
Items 51 - 100 of 194 ... Vol 23 (2013), Cosmic tragedy in Steve Chimombo's The Python, Abstract PDF ... to the special issue: Rethinking the humanities in twenty-first century ... soleil qui m'a brûlée et Comment cuisiner son mari à l'africaine de ...
Foster Youth and Social Support: The First RCT of Independent Living Services
Greeson, Johanna K. P.; Garcia, Antonio R.; Kim, Minseop; Courtney, Mark E.
2015-01-01
Objective: Conduct secondary data analysis to evaluate the effectiveness of Massachusetts' Adolescent Outreach Program for Youths in Intensive Foster Care (Outreach) for increasing social support (SS) among enrolled youth. Participants: 194 youth in intensive foster care under the guardianship of the Massachusetts Department of Children and…
Czech Academy of Sciences Publication Activity Database
Dalimier, E.; Oks, E.; Renner, Oldřich
2014-01-01
Roč. 2, č. 2 (2014), s. 178-194 ISSN 2218-2004 Grant - others:AVČR(CZ) M100101208 Institutional support: RVO:68378271 Keywords : Laser-matter interaction * spectral line profiles * Langmuir waves * plasma electron density * charge exchange rates Subject RIV: BL - Plasma and Gas Discharge Physics
Indian Academy of Sciences (India)
25, 191–194; reprinted in this issue as a J. Genet. classic, pages 3–7) ... 1932, starts with Punnett explaining that he started his work on ducks as he was asked ... text of Punnett's later comments on genes and human mental disease. Punnett's ...
Mohelno – A terminal Last Glacial Maximum industry with microlithic tools made on carenoidal blanks
Czech Academy of Sciences Publication Activity Database
Škrdla, Petr; Nejman, L.; Bartík, J.; Rychtaříková, Tereza; Nikolajev, Pavel; Eigner, J.; Nývltová Fišáková, Miriam; Novák, J.; Polanská, M.
2016-01-01
Roč. 406, 25 June 2016 (2016), s. 184-194 ISSN 1040-6182 R&D Projects: GA ČR GA15-19170S Keywords : Moravia * Mohelno * Epi-Gravettian * Epi-Aurignacian * Microlithic tools * Carenoidal blanks Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.199, year: 2016
Czech Academy of Sciences Publication Activity Database
Dvořánková, B.; Szabo, P.; Lacina, L.; Gál, P.; Uhrová, J.; Zima, T.; Kaltner, H.; André, S.; Gabius, H. J.; Syková, Eva; Smetana Jr., K.
2011-01-01
Roč. 194, č. 6 (2011), s. 469-480 ISSN 1422-6405 Grant - others:GA MŠk(CZ) 1M0538 Program:1M Institutional research plan: CEZ:AV0Z50390703 Keywords : extracellular matrix * fibronectin * keratinocyte Subject RIV: FH - Neurology Impact factor: 2.203, year: 2011
Auxin transport routes in plant development
Czech Academy of Sciences Publication Activity Database
Petrášek, Jan; Friml, J.
2009-01-01
Roč. 136, č. 16 (2009), s. 2675-2688 ISSN 0950-1991 R&D Projects: GA AV ČR KJB600380604 Institutional research plan: CEZ:AV0Z50380511 Keywords : ROOT- HAIR DEVELOPMENT * ARABIDOPSIS-THALIANA * LATERAL ROOT Subject RIV: ED - Physiology Impact factor: 7.194, year: 2009
78 FR 54472 - Proposed Data Collections Submitted for Public Comment and Recommendations
2013-09-04
... interview. Among the pediatric group, we estimate that 141 and 194 parents of children between 1 and 5 years..., the U.S. Food and Drug Administration issued a communication advising physicians to consider the... evaluate these associations and focus future investigations and prevention strategies on those factors...
Solutions to muscle fiber equations and their long time behaviour
Czech Academy of Sciences Publication Activity Database
Krejčí, Pavel; Sainte-Marie, J.; Sorine, M.; Urquiza, J.M.
2006-01-01
Roč. 7, č. 4 (2006), s. 535-558 ISSN 1468-1218 Institutional research plan: CEZ:AV0Z10190503 Keywords : existence * uniqueness * muscle and cardiac mechanics Subject RIV: BA - General Mathematics Impact factor: 1.194, year: 2006 http://www.sciencedirect.com/science/article/pii/S1468121805000507
Dibaryon resonances in photo- and electrodisintegration of the deuteron
International Nuclear Information System (INIS)
Rekalo, M.P.; Gakh, G.I.; Kulish, Yu.V.; Rekalo, A.P.
1989-01-01
Special attention is given to the consideration of the polarization effects in e - d->e : -np which are most sensitive to the dibaryon constructions. The inclusion of the dibaryon resonances improves the agreement with experimental data on the reaction observables. 194 refs.; 26 figs.; 1 tab
Glaciation in the surroundings of Prášilské Lake (Bohemian Forest, Czech Republic)
Czech Academy of Sciences Publication Activity Database
Mentlík, P.; Minár, J.; Břízová, E.; Lisá, Lenka; Tábořík, P.; Stacke, V.
2010-01-01
Roč. 117, 1/2 (2010), s. 181-194 ISSN 0169-555X Institutional research plan: CEZ:AV0Z30130516 Keywords : Bohemian Forest * Pleistocene glaciations * Prášilské Lake * Šumava * sedimentology * chronology Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.352, year: 2010
Prevalence of Mycobacterium bovis in Cattle Slaughtered at Sokoto ...
African Journals Online (AJOL)
This study was undertaken to screen cattle slaughtered at the Sokoto Central Abattoir for antibodies against Mycobacterium bovis. By the lateral flow technique (immunochromatography), using monoclonal antibodies for M. bovis (BioNote, Inc. Gyeonggi-do, Korea) and by post mortem examination. A total of 194 slaughtered ...
Polyaniline: Aniline oxidation with strong and weak oxidants under various acidity
Czech Academy of Sciences Publication Activity Database
Bláha, Michal; Trchová, Miroslava; Bober, Patrycja; Morávková, Zuzana; Prokeš, J.; Stejskal, Jaroslav
2017-01-01
Roč. 194, 15 June (2017), s. 206-218 ISSN 0254-0584 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : aniline * oxidants * polyaniline Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.084, year: 2016
Bozionelos, Nikos; Bozionelos, Giorgos; Kostopoulos, Konstantinos; Polychroniou, Panagiotis
2011-01-01
Purpose: This study aims to investigate the relationship of mentoring provided with career success and organizational commitment in the general managerial population. Design/methodology/approach: Participants were 194 native British who were employed in a variety of jobs, professions and industries in the United Kingdom. Findings: Mentoring…
Beyer, Jürgen, 1965-
2004-01-01
Autor analüüsib arhiivimaterjalide ja tekstide erinevusi juhtumitest, kus kaheksa Vormsi ja Noarootsi meest sattusid merel tormi kätte, kuid pääsesid õnnelikult. Lisad lk. 194-195 : Eesti kaart (Andree 1893-96 : 91) ja Haapsalu kihelkond (Mellin 1798 : Der Hapsalsche Kreis)
Knowledge and use of asthma control measurement tools in the ...
African Journals Online (AJOL)
Objective: To investigate the knowledge and use of asthma control measurement (ACM) tools in the management of asthma among doctors working in family and internal medicine practice in Nigeria. Method: A questionnaire based on the global initiative on asthma (GINA) guideline was self-administered by 194 doctors.
African Journal of Biomedical Research - Vol 20, No 2 (2017)
African Journals Online (AJOL)
Organosomatic indices, haematological and histological assessment as biomarkers of health status in feral and cultured Clarias gariepinus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A. Adeniran, O.K. Adeyemo, B.O. Emikpe, S.A. Alarape, 189- 194 ...
Psychosocial Correlates of Academic Performance among Primary ...
African Journals Online (AJOL)
This was a correlational design study that explored the relationship between pupils' psychosocial variables such as self-esteem, hearing status, attitude towards teachers and school; and between these and academic performance. A total of 194 pupils, 110 hearing normally and 84 hearing impaired were compared in ...
African Journals Online (AJOL)
Mr Olusoji
Christianity was the religion of 87.8% with 12.2% being Muslims. ... was a mean weight gain among 900 of the women who came for follow up of 2.4 kg. ... the influence of the media and perceived general. 17-19 ..... Social Biol, 1998; 45: 194-.
Dynamical moments of inertia for superdeformed nuclei
International Nuclear Information System (INIS)
Obikhod, T.V.
1995-01-01
The method of quantum groups has been applied for calculation the dynamical moments of inertia for the yrast superdeformed bands in 194 Hg and 192 Hg as well as to calculation of the dynamical moments of inertia of superdeformed bands in 150 Gd and 148 Gd
Treatment of aortic stenosis with a self-expanding transcatheter valve
DEFF Research Database (Denmark)
Linke, Axel; Wenaweser, Peter; Gerckens, Ulrich
2014-01-01
and cerebrovascular events (MACCE; all-cause mortality, myocardial infarction, stroke, or reintervention) and mortality at 30 days and 1 year. Endpoint-related events were independently adjudicated based on Valve Academic Research Consortium definitions. A total of 1015 patients [mean logistic EuroSCORE 19.4 ± 12...
Search Results | Page 19 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 181 - 190 of 194 ... Tobacco consumption in Tanzania rose by 20% between 2002 and 2007, and is predicted to increase by a further 46% by 2016. The impact of this increase in consumption on public health and economic development is likely to be serious. Project ...
Czech Academy of Sciences Publication Activity Database
Osterlund, L.; Štengl, Václav; Mattsson, A.; Bakardjieva, Snejana; Andersson, P.O.; Opluštil, F.
2009-01-01
Roč. 88, 1-2 (2009), s. 194-203 ISSN 0926-3373 Grant - others:Swedish Defence Materials Administration(SE) FMV E46484 Institutional research plan: CEZ:AV0Z40320502 Keywords : CEES * TiO2 * Photocatalysis Subject RIV: CA - Inorganic Chemistry Impact factor: 5.252, year: 2009
African Journals Online (AJOL)
Items 1 - 50 of 194 ... Vol 22 (2007), Acute Effect of Caffeine on Amplitude of Accommodation and Near Point of Convergence, Abstract ... Vol 24 (2008), Analysis of Molecular Marker Compounds from Vitexagnus cactus Using the High Performance Liquid Chromatography and Evaporative Light Scattering Detector Techniques ...
Pauwels, D B; Lane, J
2008-01-01
In our recent experiment (March 2007) at the velocity filter SHIP(GSI) we observed the electron-capture delayed fission of the odd-odd isotope $^{194}$At. This is the first unambiguous identification of this phenomenon in the very neutron-deficient nuclei in the vicinity of the proton shell closure at Z=82. In addition, the total kinetic energy (TKE) for the daughter nuclide $^{194}$Po was measured, despite the fact that this isotope does not decay via spontaneous fission. Semi-empirical analysis of the electron-capture Q$_{EC}$ values and fission barriers B$_{f}$ shows that a relatively broad island of ECDF must exist in this region of the Nuclide Chart, with some of the nuclei having unusually high ECDF probabilities. Therefore, this Proposal is intended to initiate the systematic identification and study of $\\beta$-delayed fission at ISOLDE in the very neutron-deficient lead region. Our aim is to provide unique low-energy fission data (e.g. probabilities, TKE release, fission barriers and their isospin dep...
Synergy of decay spectroscopy and mass spectrometry for the study of exotic nuclides
Stanja, Juliane
With only two ingredients, atomic nuclei exhibit a rich structure depending on the ordering of the different proton- and neutron-occupied states. This ordering can give rise to excited states with exceptionally long half-lives, also known as isomers, especially near shell closures. On-line mass spectrometry can often be compromised by the existence of such states that may even be produced in higher proportion than the ground state. This thesis presents the first results obtained from a nuclear spectroscopy setup coupled with the high-resolution Penning-trap mass spectrometer ISOLTRAP, at CERN’s radioactive ion beam facility ISOLDE. The isomerism in the neutron-deficient thallium isotopes was investigated. The data on $^{184,190,193−195}$Tl allow an improvement of existing mass values as well as a mass-spin- state assignment in $^{ 190,193,194}$Tl. Due to the presence of the ground and isomeric state for $^{ 194}$Tl the excitation energy of the latter was determined for the first time experimentally. Syste...
Directory of Open Access Journals (Sweden)
Fanny Karlina
2017-07-01
Full Text Available The aim of this research is to improve the student’s ecoliteracy in waste managing activities on social studies trough group investigation based outdoor study. This research is Classroom Action Research toward fourth graders have been held on two cycles. The conclusion of this research is student’s ecoliteracy cognitive aspect increases is 20%, application aspect increases is 49,6%, and attitude aspect increases is 19,4% after the two cycle action with group investigation based outdoor study. Penelitian ini bertujuan mendeskripsikan peningkatan ecoliteracy siswa dalam kegiatan pengelolaan sampah dalam pembelajaran IPS melalui group investigation berbasis outdoor study. Penelitian ini menerapkan jenis Penelitian Tindakan Kelas (PTK terhadap siswa kelas IV SD yang dilaksanakan dalam dua siklus. Hasil penelitian menyimpulkan adanya peningkatan ecoliteracy siswa dari aspek pengetahuan sebesar 20%, aspek aplikasi sebesar 49,6%, dan aspek sikap sebesar 19,4% setelah mengikuti dua siklus pembelajaran dengan group investigation berbasis outdoor study.
Molecular evidence and high genetic diversity of shrew-borne Seewis virus in Slovenia.
Resman, Katarina; Korva, Miša; Fajs, Luka; Zidarič, Tanja; Trilar, Tomi; Zupanc, Tatjana Avšič
2013-10-01
Seewis virus, the shrew-borne hantavirus from Sorex araneus, has been molecularly detected in reservoir hosts in many different central European countries and Russia. Slovenia is a known endemic country for rodent-borne hantaviruses, therefore the aim of the study was to investigate the presence of shrew-borne hantaviruses in insectivores. Viral L, S and M segment have been recovered only from tissue samples of 7 S. araneus, despite several shrew species were tested. Phylogenetic analysis showed high genetic diversity of SWSV in Slovenia, ranging from 3 to 19.4% for different viral segments. The most divergent were M segment sequences, with 19.4% nucleotide divergence among Slovenian strains. Above that, different SWSV strains from Slovenia do not group into separate geographic clusters. While three separate genetic clades were determined, two of them were simultaneously present in one location at the same time. Copyright © 2013 Elsevier B.V. All rights reserved.
Towards complete spectroscopy of 193Os
International Nuclear Information System (INIS)
Eisermann, Y.; Graw, G.; Metz, A.; Hertenberger, R.; Wirth, H.-F.
2002-01-01
Strong evidence for the existence of supersymmetry in atomic nuclei has been found in the quartet of nuclei 194,195 Pt, 195,196 Au. Our attention is now focused a second quartet of nuclei, that is 193,194 Ir, 192,193 Os where the model is applicable. We investigate the heaviest osmium isotope which is accessible in a single neutron transfer reaction: 193 Os. Excitation energies are known from (d,p) and (n,γ) measurements, but there is limited information about quantum numbers, To measure absolute cross-sections and asymmetries of the 192 Os(d(tilde),p) 193 Os reaction we used our facilities at the Munich tandem accelerator. The 22 MeV beam of vector-polarised deuterons was produced by our new Stern-Gerlach-Source. Outgoing protons were analysed by the Q3D magnetic spectrograph and detected with a strip-detector. The target consisted of a metallic foil of 146 μg/cm 2 highly enriched 192 Os (99%). (author)
Jin, Lily L.; Wybenga-Groot, Leanne E.; Tong, Jiefei; Taylor, Paul; Minden, Mark D.; Trudel, Suzanne; McGlade, C. Jane; Moran, Michael F.
2015-01-01
Src homology 2 (SH2) domains are modular protein structures that bind phosphotyrosine (pY)-containing polypeptides and regulate cellular functions through protein-protein interactions. Proteomics analysis showed that the SH2 domains of Src family kinases are themselves tyrosine phosphorylated in blood system cancers, including acute myeloid leukemia, chronic lymphocytic leukemia, and multiple myeloma. Using the Src family kinase Lyn SH2 domain as a model, we found that phosphorylation at the conserved SH2 domain residue Y194 impacts the affinity and specificity of SH2 domain binding to pY-containing peptides and proteins. Analysis of the Lyn SH2 domain crystal structure supports a model wherein phosphorylation of Y194 on the EF loop modulates the binding pocket that engages amino acid side chains at the pY+2/+3 position. These data indicate another level of regulation wherein SH2-mediated protein-protein interactions are modulated by SH2 kinases and phosphatases. PMID:25587033
DEFF Research Database (Denmark)
Strange, T.; Ask, B.; Nielsen, B.
2013-01-01
This study aimed to estimate genetic parameters for the mortality causes stillborn, weak at birth, starvation, crushing, and miscellaneous in crossbred piglets produced by crossbred dams. Data were collected in a single Danish commercial herd from October 2006 to July 2008 and consisted of 34......,194 piglets (2,152 litters), which originated from 195 Danish Duroc sires and 955 crossbreds between Danish Landrace and Danish Yorkshire dams. Of the 34,194 piglets born, 11.5% were stillborn, 4.2% were crushed by the sow, 2.7% died due to starvation, 2.3% were weak at birth, and 2.2% died of miscellaneous...... traits based on the sire component ranged from -0.05 between stillborn and starvation to 0.35 between stillborn and weak at birth whereas genetic correlations based on the dam component ranged from -0.11 between weak at birth and starvation to 0.76 between crushing and starvation. There seemed...
The degradation of lining of rotary furnaces in the production of zinc oxide
Czech Academy of Sciences Publication Activity Database
Luptáková, Natália; Pešlová, F.; Anisimov, E.
2014-01-01
Roč. 21, č. 3 (2014), s. 116-121 ISSN 1335-0803 Institutional support: RVO:68081723 Keywords : zinc oxide * the production of zinc oxide * zinc slag * refractories * the degradation of rotary furnace linings Subject RIV: JG - Metallurgy http://ojs.mateng.sk/index.php/Mateng/article/view/133/194
Abstinence, Social Norms, and Drink Responsibly Messages: A Comparison Study
Glassman, Tavis J.; Kruger, Jessica Sloan; Deakins, Bethany A.; Paprzycki, Peter; Blavos, Alexis A.; Hutzelman, Erin N.; Diehr, Aaron
2016-01-01
Objective: The purpose of this study was to determine which type of prevention message (abstinence, social norms, or responsible drinking) was most effective at reducing alcohol consumption. Participants: The subjects from this study included 194 college students from a public university. Methods: Researchers employed a quasi-experimental design,…
Czech Academy of Sciences Publication Activity Database
Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.
2015-01-01
Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015
2013-12-03
... of the shaft seals. The parameters used to represent the changes in performance assessment were... panel are filled with waste, the DOE intends to seal the drifts with engineered structures called panel... seal these drifts with engineered structures called panel closures. 40 CFR part 194, Criteria for the...
Czech Academy of Sciences Publication Activity Database
Kharlamov, Alexander; Rolón-Garrido, V. H.; Filip, Petr
2010-01-01
Roč. 19, č. 4 (2010), s. 190-194 ISSN 1022-1344 R&D Projects: GA ČR GA103/09/2066 Institutional research plan: CEZ:AV0Z20600510 Keywords : polymer chains * molecular modeling * shear * stress Subject RIV: BK - Fluid Dynamics Impact factor: 1.440, year: 2010
Czech Academy of Sciences Publication Activity Database
Mikuláš, Radek; Budil, P.
2013-01-01
Roč. 2012, Prosinec (2013), s. 192-194 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : Upper Ordovician * trace fossils * trinucleoid trilobites * Barrandian area Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-37.pdf
Studies of base pair sequence effects on DNA solvation based on all ...
Indian Academy of Sciences (India)
pdb1. 2.00. CATGGCCATG. 158d.pdb1. 1.90. CCAAGCTTGG. 167d.pdb1. 2.30. CCATTAATGG. 194d.pdb1. 2.30. CGCGTTAACGCG. 196d.pdb1. 1.70. CTCTCGAGAG. 1bd1.pdb1. 1.60. CCAGGCCTGG. 1bdn.pdb1. 2.60. CGCAAAAATGCG.
An ECVAG inter-laboratory validation study of the comet assay
DEFF Research Database (Denmark)
Ersson, Clara; Møller, Peter; Forchhammer, Lykke
2013-01-01
of ionising radiation, inter-laboratory variation, intra-laboratory variation and residual variation contributed to 60.9, 19.4, 0.1 and 19.5%, respectively, of the total variation. In the coded PBMC samples, the inter-laboratory variation explained the largest fraction of the overall variation of DNA strand...
Analysis of final year DVM research projects submitted to the Faculty ...
African Journals Online (AJOL)
This study analyzed the intellectual output of the undergraduate final year students. research projects submitted to the Faculty of Veterinary Medicine, Usmanu Danfodiyo University, Sokoto, from 1994 to 2004. The findings of the study show that a total of 194 research projects were produced within the period under study.
The use of lipids as phase change materials for thermal energy storage
Phase change materials (PCMs) are substances capable of absorbing and releasing large 2 amounts of thermal energy (heat or cold) as latent heat over constant temperature as they 3 undergo a change in state of matter (phase transition), commonly, between solid and 4 liquid phases. Since the late 194...
Czech Academy of Sciences Publication Activity Database
Kameník, Zdeněk; Hadacek, F.; Marečková, M.; Ulanová, Dana; Kopecký, J.; Chobot, V.; Plháčková, Kamila; Olšovská, Jana
2010-01-01
Roč. 1217, č. 51 (2010), s. 8016-8025 ISSN 0021-9673 R&D Projects: GA MŠk 2B08064 Institutional research plan: CEZ:AV0Z50200510 Keywords : UHPLC * high - throughput fingerprinting * secondary metabolites Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.194, year: 2010
Amyloid in basal cell carcinoma and seborrheic keratosis
DEFF Research Database (Denmark)
Olsen, K E; Westermark, Per
1994-01-01
The frequency of amyloid substance was studied in two different types of skin tumours: basal cell carcinoma and seborrheic keratosis. In 9 out of 49 cases of seborrheic keratosis amyloid substance was found. In the basal cell carcinomas, 194 out of 260 cases showed amyloid deposits, a rate...
Social network site use among Dutch students: Effects of time and platform
Utz, S.; Comunello, F.
2011-01-01
This chapter compares the SNS use of Dutch students across time and platforms. Between 2009 (n = 194) and 2010 (n = 212), many users migrated from Hyves, the hitherto largest Dutch SNS, to Facebook. Comparisons between the two years showed that SNS use remained relatively stable over time; only
Czech Academy of Sciences Publication Activity Database
Čejková, Jitka; Ardan, Taras; Šimonová, Zuzana; Čejka, Čestmír; Malec, J.; Dostřelová, D.; Brůnová, B.
2008-01-01
Roč. 23, - (2008), s. 1477-1483 ISSN 0213-3911 R&D Projects: GA MZd NR8828; GA ČR GA304/06/1379 Institutional research plan: CEZ:AV0Z50390512 Keywords : Superoxide dismutase * Catalase * Glutathione peroxidase Subject RIV: FF - HEENT, Dentistry Impact factor: 2.194, year: 2008
Fast profiling of anthocyanins in wine by desorption nano-electrospray ionization mass spectrometry
Czech Academy of Sciences Publication Activity Database
Hartmanová, L.; Ranc, V.; Papoušková, B.; Bednář, P.; Havlíček, Vladimír; Lemr, Karel
2010-01-01
Roč. 1217, č. 25 (2010), s. 4223-4228 ISSN 0021-9673 R&D Projects: GA ČR GA203/07/0765 Institutional research plan: CEZ:AV0Z50200510 Keywords : Mass spectrometry * Desorption nano-electrospray * Liquid chromatography Subject RIV: CE - Biochemistry Impact factor: 4.194, year: 2010
Influence of Self-Esteem, Parenting Style and Parental Monitoring ...
African Journals Online (AJOL)
Based on this, this study was set out to investigate the influence of self esteem, parental monitoring and parenting styles on adolescents' risky sexual behavior in Ibadan. Cross-sectional research design was used. A total number of 194 adolescents selected from three secondary schools participated in the study.
Study of the Junior Reserve Officers Training Corps: Should the Services’ Four Curricula Be Merged?
2003-03-01
one song, one book , and their authors that became popular during the 1850s and 1860s that symbolized slavery Review the personal achievements of...on the human body Identify risks associated with secondhand smoke 194 Table E8. Marine Corps First Aid The Four Life-Saving Steps Lesson
Seiffge-Krenke, I.; Burk, W.J.
2016-01-01
Aggressive behavior in adult couples is a problem which must be taken seriously and is a frequent reason for psychotherapy and counseling. Less is known about an early start of aggression, e.g. in adolescent romantic relationships. In a sample of 194 romantic partner dyads (age 16-18 years)
Black Self-Esteem and Desegregated Schools.
Drury, Darrel W.
1980-01-01
Discusses a study to determine attitudes among Black and White students in 194 southern high schools regarding desegregation. Data are presented on differences between schools; test-score achievement; and variations in self-esteem among students in predominantly White, Black, and racially mixed schools. Findings are interpreted in light of…
Lee, Dong-min
2018-01-01
This study attempts to illuminate the recognition, reflection, development, and effects of geography teachers' attitudes toward regions around the world (ATRAWs) using Straussian grounded theory. A total of 194 concepts were categorized into 18 categories, and three types were identified. The findings of this study show that geography teachers…
Directory of Open Access Journals (Sweden)
Ángela Anyur García Bernal
2013-07-01
Plano (PP increase of 114,3°a 115,4° and the occlusal plane inclination increased from 17,8°a 24,7°. The average treatment time was 19,4 months. Conclusions: MEAW philosophy is a therapeutic alternative camouflage in the treatment of skeletal Class III malocclusions.
Thin metal films in resistivity-based chemical sensing
Czech Academy of Sciences Publication Activity Database
Podešva, Pavel; Foret, František
2013-01-01
Roč. 9, č. 4 (2013), s. 642-652 ISSN 1573-4110 R&D Projects: GA ČR(CZ) GAP301/11/2055 Institutional support: RVO:68081715 Keywords : voltohmmetric sensing * chemiresistor * thin metal film * gas sensing Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013
Koovit, Kaja, 1968-
2011-01-01
Austrias asuva Linzi ülikooli uuringu kohaselt moodustab varimajandus Eesti majandusest kolmandiku. SSE Riga ehk Stockholmi majanduskooli Riias Balti varimajanduse uuringu põhjal võib varimajanduse osakaal Eestis olla 19,4 protsenti. Varimajanduse alal maailma juhtivaks eksperdiks peetava Friedrich Schneideri uuringust. Marje Josingu ja Juhan Partsi hinnanguid. Tabel: Varimajandus
Androgyny, Masculinity, and Self-Esteem.
Lundy, Allan; Rosenberg, Judy A.
1987-01-01
Administered Coopersmith Self-Esteem Inventory and Bem Sex Role Inventory to 194 adults. Found androgyny scale emphasizing masculinity was most predictive of self-esteem, due to strong correlation found between masculinity and self-esteem. Found no effects due to femininity, interaction of femininity and masculinity, or sex. (Author/NB)
Potensi Tanaman Di Indonesia Sebagai Larvasida Alami Untuk Aedes aegypti
Directory of Open Access Journals (Sweden)
Yoke Astriani
2017-02-01
Full Text Available AbstractDengue Hemorrhagic Fever (DHF still become one of the health problems in Indonesia. This disease has emerged since 1968 and has become one of the deadliest disease in various regions in Indonesia. Indonesia has not implemented an effective dengue vaccine program to provide protection against all four serotypes of the dengue virus. Vector control using chemical insecticides has made the vectors resistant to the insectisides. One option to avoid those bad effect is natural larvicide. The lack of literature that can be used as a foundation for further studies on the natural larvicidal is the reason why a review of several articles and research results is needed. We use the method of literature review. Our literature reveals that 68% of the 25 plants species are categorized as highly effective with LC50 <750 ppm. Jasmine, Zodia and Tobacco have the highest effectivity compared to the other plants use in this literature review. The LC50 of these plants are 0.999 ppm, 1.94 ppm, and 1.94 ppmrespectively. All twenty five plants that we present suitable to be cultivated in the region of Indonesia with tropical climate so that people can easily cultivate and use it as a natural larvicides.Keyword: Natural larvicides, Aedes aegypti, LC50, and essential oilAbstrakPenyakit Demam Berdarah Dengue (DBD sampai saat ini masih menjadi salah satu permasalahan dunia kesehatan di Indonesia. Penyakit yang muncul sejak tahun 1968 ini telah banyak menelan korban di berbagai daerah dan hingga saat ini, Indonesia belum menerapkan program vaksin yang efektif untuk memberikan perlindungan terhadap empat serotipe dari virus dengue. Pengendalian vektor menggunakan bahan insektisida kimiawi banyak memberikan efek resisten terhadap insektisida tersebut. Salah satu pilihan untuk menghindari hal tersebut dibutuhkan adanya larvasida alami. Oleh karena masih tersebarnya informasi yang dapat dijadikan dasar untuk studi lanjut mengenai larvasida alami, maka tulisan ini
Gil, Horacio; Cano, Lourdes; de Lucio, Aida; Bailo, Begoña; de Mingo, Marta Hernández; Cardona, Guillermo A; Fernández-Basterra, José A; Aramburu-Aguirre, Juan; López-Molina, Nuria; Carmena, David
2017-06-01
Domestic dogs and cats may act as natural reservoirs of a large number of zoonotic pathogens, including the enteric parasites Giardia duodenalis and Cryptosporidium spp., the most relevant protozoan species causing gastrointestinal disease worldwide. A cross-sectional epidemiological study aiming to assess the prevalence and molecular diversity of G. duodenalis and Cryptosporidium spp. was conducted in an animal rescue centre in the province of Álava (Northern Spain). A total of 194 and 65 faecal dropping samples from individual dogs and cats, respectively, were collected between November 2013 and June 2016. G. duodenalis cysts and Cryptosporidium spp. oocysts were detected by direct fluorescence microscopy and PCR-based methods targeting the small subunit ribosomal RNA gene of these parasites. Overall, G. duodenalis and Cryptosporidium spp. were detected in 33% (63/194) and 4.1% (8/194) of dogs, and 9.2% (6/65) and 4.6% (3/65) of cats, respectively. G. duodenalis and Cryptosporidium co-infections were observed in 1.5% (3/194) of dogs, but not in cats. No significant differences in infection rates could be demonstrated among dogs or cats according to their sex, age group, status, or geographical origin. Multi-locus sequence-based genotyping of the glutamate dehydrogenase and β-giardin genes of G. duodenalis allowed the characterization of 19 canine isolates that were unambiguously assigned to sub-assemblages AII (n=7), BIII (n=1), and BIV (n=7), and assemblages C (n=3) and D (n=1). Two feline isolates were genotyped as assemblages A and F, respectively. No mixed assemblage or sub-assemblage infections were identified. C. canis (n=5) and C. hominis (n=1) were the Cryptosporidium species found in dogs, whereas C. felis (n=1) was identified in cats. The finding of G. duodenalis sub-assemblages AII, BIII, and BIV circulating in dogs (but not cats) may have zoonotic potential, although most of the AII and BIV isolates sub-genotyped corresponded to genetic variants not
South African Medical Journal - Vol 104, No 3 (2014)
African Journals Online (AJOL)
... pseudomonal infection on pulmonary function testing in individuals with cystic fibrosis in Pretoria, South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Pentz, P Becker, R Masekela, O Coetzee, RJ Green, 191-194. http://dx.doi.org/10.7196/SAMJ.7222 ...
The genome of the pear (Pyrus bretschneideri Rehd.)
DEFF Research Database (Denmark)
Wu, Jun; Wang, Zhiwen; Shi, Zebin
2013-01-01
The draft genome of the pear (Pyrus bretschneideri) using a combination of BAC-by-BAC and next-generation sequencing is reported. A 512.0-Mb sequence corresponding to 97.1% of the estimated genome size of this highly heterozygous species is assembled with 194× coverage. High-density genetic maps ...
Czech Academy of Sciences Publication Activity Database
Flores, M.; Olivares, A.; Dryahina, Kseniya; Španěl, Patrik
2013-01-01
Roč. 9, č. 4 (2013), s. 622-630 ISSN 1573-4110 R&D Projects: GA ČR GP203/09/P172; GA ČR GA203/09/0256 Institutional support: RVO:61388955 Keywords : volatile compounds * flovar * meat Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013
Bowker, Julie C.; Markovic, Andrea; Cogswell, Alex; Raja, Radhi
2012-01-01
Recent research has revealed significant heterogeneity in the peer difficulties associated with social withdrawal subtypes during early adolescence, but little is known about possible sources of that heterogeneity. This study of 194 Indian young adolescents (48% female; 90% Hindu; M age = 13.35 years) evaluated whether the peer adversity related…
How Reading Strategy Use and Personality Types Are Related?
Safdarian, Zahra; Ghyasi, Majid; Farsani, Mohammad Amini
2014-01-01
This study sought to uncover the reading strategies utilized by Iranian undergraduate English Foreign Language (EFL) learners and their relationship with personality types. To this end, 194 university EFL learners were asked to fill out the Myers-Briggs Type Indicator (MBTI) to identify their personality types and answer a reading strategy…
Czech Academy of Sciences Publication Activity Database
Lorencová, E.; Frélichová, J.; Nelson, E.; Vačkář, David
2013-01-01
Roč. 33, JUL (2013), s. 183-194 ISSN 0264-8377 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : climate change * scenarios * land use change * ecosystem services * agriculture * assessment Subject RIV: EH - Ecology, Behaviour Impact factor: 3.134, year: 2013
Wilkinson, Carol; Prusak, Keven
2013-01-01
The purpose of this study was to assess differences in self-regulation of attitudes towards engaging in exercise and eating a healthy diet between physical education teacher education (PETE) students and general education (GE) students, and between male students and female students. Participants were university students (n = 194) at a university…
2017-2018 Travel Expense Reports for Jean Lebel, President
International Development Research Centre (IDRC) Digital Library (Canada)
Chantal Taylor
Purpose: Meet with development research stakeholders. Date(s):. 2017-11-27 to 2017-12-08. Destination(s):. Cairo, Amman, Paris. Airfare: $11,203.94. Other. Transportation: $148.45. Accommodation: $3,354.72. Meals and. Incidentals: $1,194.75. Other: $132.97. Total: $16,034.83. Comments: 2017-2018 Travel Expense ...
A market-clearing classroom experiment
Czech Academy of Sciences Publication Activity Database
Boháček, Radim
2002-01-01
Roč. 69, č. 1 (2002), s. 189-194 ISSN 0038-4038 Institutional research plan: CEZ:AV0Z7085904 Keywords : market theory * experiments * prices Subject RIV: AH - Economics Impact factor: 0.391, year: 2002 http://search. ebscohost .com/login.aspx?direct=true&db=bth&AN=7344330&site=ehost-live
Temperature dependence of the absorption coefficient of water for midinfrared laser radiation
Jansen, E. D.; van Leeuwen, T. G.; Motamedi, M.; Borst, C.; Welch, A. J.
1994-01-01
The dynamics of the water absorption peak around 1.94 microns was examined. This peak is important for the absorption of holmium and thulium laser radiation. To examine the effect of temperature on the absorption coefficient, the transmission of pulsed Ho:YAG, Ho:YAG, Ho:YSGG, and Tm:YAG laser
Czech Academy of Sciences Publication Activity Database
Vrkoslav, Vladimír; Urbanová, Klára; Cvačka, Josef
2010-01-01
Roč. 1217, č. 25 (2010), s. 4184-4194 ISSN 0021-9673 R&D Projects: GA ČR GA203/09/0139 Institutional research plan: CEZ:AV0Z40550506 Keywords : Beeswax * Branched esters * Human hair * Jojoba * Mass spectrometry Subject RIV: CC - Organic Chemistry Impact factor: 4.194, year: 2010
2016-2017 Travel Expense Reports for Barbara Lucille Trenholm ...
International Development Research Centre (IDRC) Digital Library (Canada)
Beata Bialic
2016-11-28 to 2016-11-30. Destination(s):. Ottawa. Airfare: $1,078.05. Other. Transportation: $135.00. Accommodation: $194.37. Meals and. Incidentals: $216.80. Other: $0.00. Total: $1,624.22. Comments: 2016-2017 Travel Expense Reports for Barbara. Lucille Trenholm, Governor, Chairperson of the. Finance and Audit ...
Corporal Punishment in Tanzania's Schools
Feinstein, Sheryl; Mwahombela, Lucas
2010-01-01
The purpose of this survey was to acquire descriptive information regarding corporal punishment in Tanzania's O-level secondary schools. 448 individuals participated in the study: 254 teachers and 194 students, all from government or private secondary schools in the Iringa Region of Tanzania. In addition, 14 students and 14 teachers were…
Diversity and ecology of lichens on churches in The Netherlands
Sparrius, L.B.; Aptroot, A.; van Herk, C.M.
2007-01-01
This study presents the results of an inventory of lichen species on the walls of 344 medieval and renaissance churches in the Netherlands. In total, 194 species were recorded, of which several are more or less confined to this habitat in the country. We found several regional differences in species
Frye, Alice A.; Garber, Judy
2005-01-01
This study examined the relations between maternal criticism and externalizing and internalizing symptoms in adolescents who varied in their risk for psychopathology. Both maternal-effects and child-effects models were examined. The sample consisted of 194 adolescents (mean age = 11.8 years) and their mothers: 146 mothers had a history of…