International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
49 CFR 193.2189-193.2233 - [Reserved
2010-10-01
... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Design Lng Storage Tanks §§ 193.2189-193.2233 [Reserved] ...
49 CFR 193.2183-193.2185 - [Reserved
2010-10-01
... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Design Impoundment Design and Capacity §§ 193.2183-193.2185 [Reserved] LNG Storage Tanks ...
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Security. 193.2709 Section 193.2709 Transportation...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2709 Security. Personnel having security duties must be qualified to perform their assigned duties by successful completion of the training...
46 CFR 193.50-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 193.50-1 Section 193.50-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION... Details § 193.50-1 Application. (a) The provisions of this subpart, with the exception of § 193.50-90...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Location. 193.50-10 Section 193.50-10 Shipping COAST... Details § 193.50-10 Location. (a) Approved hand portable fire extinguishers and semiportable fire extinguishing systems shall be installed in accordance with Table 193.50-10(a). The location of the equipment...
49 CFR 193.2711 - Personnel health.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Personnel health. 193.2711 Section 193.2711 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2711 Personnel health. Each operator...
49 CFR 193.2611 - Fire protection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Fire protection. 193.2611 Section 193.2611 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Maintenance § 193.2611 Fire protection. (a) Maintenance activities on fire...
49 CFR 193.2625 - Corrosion protection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Corrosion protection. 193.2625 Section 193.2625 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Maintenance § 193.2625 Corrosion protection. (a) Each operator shall determine...
49 CFR 193.2609 - Support systems.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Support systems. 193.2609 Section 193.2609 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Maintenance § 193.2609 Support systems. Each support system or foundation of each...
46 CFR 193.15-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 193.15-1 Section 193.15-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Carbon Dioxide Extinguishing Systems, Details § 193.15-1 Application. (a) The provisions of this...
46 CFR 193.30-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 193.30-1 Section 193.30-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Automatic Sprinkler Systems § 193.30-1 Application. Automatic sprinkling systems shall comply with...
49 CFR 193.2519 - Communication systems.
2010-10-01
...: FEDERAL SAFETY STANDARDS Operations § 193.2519 Communication systems. (a) Each LNG plant must have a primary communication system that provides for verbal communications between all operating personnel at... 49 Transportation 3 2010-10-01 2010-10-01 false Communication systems. 193.2519 Section 193.2519...
49 CFR 193.2173 - Water removal.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Water removal. 193.2173 Section 193.2173...: FEDERAL SAFETY STANDARDS Design Impoundment Design and Capacity § 193.2173 Water removal. (a) Impoundment areas must be constructed such that all areas drain completely to prevent water collection. Drainage...
49 CFR 193.2715 - Training: security.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Training: security. 193.2715 Section 193.2715...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2715 Training: security. (a) Personnel responsible for security at an LNG plant must be trained in accordance with a written plan of...
49 CFR 193.2913 - Security monitoring.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Security monitoring. 193.2913 Section 193.2913...: FEDERAL SAFETY STANDARDS Security § 193.2913 Security monitoring. Each protective enclosure and the area.... Monitoring must be by visual observation in accordance with the schedule in the security procedures under...
46 CFR 193.10-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 193.10-1 Section 193.10-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Main System, Details § 193.10-1 Application. (a) The provisions of this subpart, with the...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Location. 193.60-10 Section 193.60-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Axes § 193.60-10 Location. (a) Fire axes shall be distributed throughout the spaces available...
46 CFR 193.60-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 193.60-1 Section 193.60-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Axes § 193.60-1 Application. (a) The provisions of this subpart shall apply to all vessels...
46 CFR 193.50-5 - Classification.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Classification. 193.50-5 Section 193.50-5 Shipping COAST... Details § 193.50-5 Classification. (a) Hand portable fire extinguishers and semiportable fire...) Classification Type Size Soda-acid and water, gals. Foam, gals. Carbon dioxide, lbs. Dry chemical, lbs. A II 21/2...
49 CFR 193.2801 - Fire protection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Fire protection. 193.2801 Section 193.2801...: FEDERAL SAFETY STANDARDS Fire Protection § 193.2801 Fire protection. Each operator must provide and maintain fire protection at LNG plants according to sections 9.1 through 9.7 and section 9.9 of NFPA 59A...
49 CFR 193.2631 - Internal corrosion control.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Internal corrosion control. 193.2631 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2631 Internal corrosion control. Each component that is subject to internal corrosive attack must be protected from internal corrosion by— (a...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
49 CFR 193.2607 - Foreign material.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Foreign material. 193.2607 Section 193.2607 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES...
49 CFR 193.2623 - Inspecting LNG storage tanks.
2010-10-01
... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2623 Inspecting LNG storage tanks. Each LNG... 49 Transportation 3 2010-10-01 2010-10-01 false Inspecting LNG storage tanks. 193.2623 Section 193...
Towards complete spectroscopy of 193Os
International Nuclear Information System (INIS)
Eisermann, Y.; Graw, G.; Metz, A.; Hertenberger, R.; Wirth, H.-F.
2002-01-01
Strong evidence for the existence of supersymmetry in atomic nuclei has been found in the quartet of nuclei 194,195 Pt, 195,196 Au. Our attention is now focused a second quartet of nuclei, that is 193,194 Ir, 192,193 Os where the model is applicable. We investigate the heaviest osmium isotope which is accessible in a single neutron transfer reaction: 193 Os. Excitation energies are known from (d,p) and (n,γ) measurements, but there is limited information about quantum numbers, To measure absolute cross-sections and asymmetries of the 192 Os(d(tilde),p) 193 Os reaction we used our facilities at the Munich tandem accelerator. The 22 MeV beam of vector-polarised deuterons was produced by our new Stern-Gerlach-Source. Outgoing protons were analysed by the Q3D magnetic spectrograph and detected with a strip-detector. The target consisted of a metallic foil of 146 μg/cm 2 highly enriched 192 Os (99%). (author)
19 CFR 10.193 - Imported directly.
2010-04-01
... control of the customs authority of the intermediate country; (2) Did not enter into the commerce of the... 19 Customs Duties 1 2010-04-01 2010-04-01 false Imported directly. 10.193 Section 10.193 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY...
miR-193b Regulates Mcl-1 in Melanoma.
Chen, Jiamin; Zhang, Xiao; Lentz, Cindy; Abi-Daoud, Marie; Paré, Geneviève C; Yang, Xiaolong; Feilotter, Harriet E; Tron, Victor A
2011-11-01
MicroRNAs play important roles in gene regulation, and their expression is frequently dysregulated in cancer cells. In a previous study, we reported that miR-193b represses cell proliferation and regulates cyclin D1 in melanoma cells, suggesting that miR-193b could act as a tumor suppressor. Herein, we demonstrate that miR-193b also down-regulates myeloid cell leukemia sequence 1 (Mcl-1) in melanoma cells. MicroRNA microarray profiling revealed that miR-193b is expressed at a significantly lower level in malignant melanoma than in benign nevi. Consistent with this, Mcl-1 is detected at a higher level in malignant melanoma than in benign nevi. In a survey of melanoma samples, the level of Mcl-1 is inversely correlated with the level of miR-193b. Overexpression of miR-193b in melanoma cells represses Mcl-1 expression. Previous studies showed that Mcl-1 knockdown cells are hypersensitive to ABT-737, a small-molecule inhibitor of Bcl-2, Bcl-X(L), and Bcl-w. Similarly, overexpression of miR-193b restores ABT-737 sensitivity to ABT-737-resistant cells. Furthermore, the effect of miR-193b on the expression of Mcl-1 seems to be mediated by direct interaction between miR-193b and seed and seedless pairing sequences in the 3' untranslated region of Mcl-1 mRNA. Thus, this study provides evidence that miR-193b directly regulates Mcl-1 and that down-regulation of miR-193b in vivo could be an early event in melanoma progression. Copyright © 2011 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.193... Drawback Filing of Notice and Removal § 28.193 Export marks. In addition to the marks and brands required... chapter, the exporter shall mark the word “Export” on the Government side of each case or Government head...
Organic antireflective coatings for 193-nm lithography
Trefonas, Peter, III; Blacksmith, Robert F.; Szmanda, Charles R.; Kavanagh, Robert J.; Adams, Timothy G.; Taylor, Gary N.; Coley, Suzanne; Pohlers, Gerd
1999-06-01
Organic anti-reflective coatings (ARCs) continue to play an important role in semiconductor manufacturing. These materials provide a convenient means of greatly reducing the resist photospeed swing and reflective notching. In this paper, we describe a novel class of ARC materials optimized for lithographic applications using 193 nm exposure tools. These ARCs are based upon polymers containing hydroxyl-alkyl methacrylate monomers for crosslinkable sites, styrene for a chromophore at 193 nm, and additional alkyl-methacrylate monomers as property modifiers. A glycouril crosslinker and a thermally-activated acidic catalyst provide a route to forming an impervious crosslinked film activate data high bake temperatures. ARC compositions can be adjusted to optimize the film's real and imaginary refractive indices. Selection of optimal target indices for 193 nm lithographic processing through simulations is described. Potential chromophores for 193 nm were explored using ZNDO modeling. We show how these theoretical studies were combined with material selection criteria to yield a versatile organic anti-reflectant film, Shipley 193 G0 ARC. Lithographic process data indicates the materials is capable of supporting high resolution patterning, with the line features displaying a sharp resist/ARC interface with low line edge roughness. The resist Eo swing is successfully reduced from 43 percent to 6 percent.
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
49 CFR 193.2713 - Training: operations and maintenance.
2010-10-01
... first-aid; and (3) All operating and appropriate supervisory personnel— (i) To understand detailed... 49 Transportation 3 2010-10-01 2010-10-01 false Training: operations and maintenance. 193.2713... LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2713...
Lifescience Database Archive (English)
Full Text Available Japanese Bush Warbler Cettia diphone Cettia_diphone_L.png 193.png Takeru Nakazato (...: Takeru Nakazato (Database Center for Life Science) ウグイス Cettia diphone cantans nakazato 2008/12/22 10:09:51 2010/01/14 20:05:22 ...
49 CFR 193.2181 - Impoundment capacity: LNG storage tanks.
2010-10-01
... LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Design Impoundment Design and Capacity § 193.2181 Impoundment capacity: LNG storage tanks. Each impounding system serving an LNG storage tank must have a... 49 Transportation 3 2010-10-01 2010-10-01 false Impoundment capacity: LNG storage tanks. 193.2181...
49 CFR 192.193 - Valve installation in plastic pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Valve installation in plastic pipe. 192.193... Components § 192.193 Valve installation in plastic pipe. Each valve installed in plastic pipe must be designed so as to protect the plastic material against excessive torsional or shearing loads when the valve...
Epigenetically altered miR-193b targets cyclin D1 in prostate cancer
International Nuclear Information System (INIS)
Kaukoniemi, Kirsi M; Rauhala, Hanna E; Scaravilli, Mauro; Latonen, Leena; Annala, Matti; Vessella, Robert L; Nykter, Matti; Tammela, Teuvo L J; Visakorpi, Tapio
2015-01-01
Micro-RNAs (miRNA) are important regulators of gene expression and often differentially expressed in cancer and other diseases. We have previously shown that miR-193b is hypermethylated in prostate cancer (PC) and suppresses cell growth. It has been suggested that miR-193b targets cyclin D1 in several malignancies. Here, our aim was to determine if miR-193b targets cyclin D1 in prostate cancer. Our data show that miR-193b is commonly methylated in PC samples compared to benign prostate hyperplasia. We found reduced miR-193b expression (P < 0.05) in stage pT3 tumors compared to pT2 tumors in a cohort of prostatectomy specimens. In 22Rv1 PC cells with low endogenous miR-193b expression, the overexpression of miR-193b reduced CCND1mRNA levels and cyclin D1 protein levels. In addition, the exogenous expression of miR-193b decreased the phosphorylation level of RB, a target of the cyclin D1-CDK4/6 pathway. Moreover, according to a reporter assay, miR-193b targeted the 3’UTR of CCND1 in PC cells and the CCND1 activity was rescued by expressing CCND1 lacking its 3’UTR. Immunohistochemical analysis of cyclin D1 showed that castration-resistant prostate cancers have significantly (P = 0.0237) higher expression of cyclin D1 compared to hormone-naïve cases. Furthermore, the PC cell lines 22Rv1 and VCaP, which express low levels of miR-193b and high levels of CCND1, showed significant growth retardation when treated with a CDK4/6 inhibitor. In contrast, the inhibitor had no effect on the growth of PC-3 and DU145 cells with high miR-193b and low CCND1 expression. Taken together, our data demonstrate that miR-193b targets cyclin D1 in prostate cancer
International Nuclear Information System (INIS)
Buettgenbach, S.; Dicke, R.; Gebauer, H.; Kuhnen, R.; Traeber, F.
1978-01-01
The hyperfine interaction constants A and B of six low-lying metastable fine structure states of the two iridium isotopes 191 Ir and 193 Ir and the electronic g-factors of these levels have been measured using the atomic-beam magnetic-resonance method. From the values of the magnetic-dipole interaction constants A, corrected for off-diagonal perturbations, we extracted the hyperfine anomaly of a pure 6s-electron state: 191 Δs 193 = 0.64(7)%. Using nonrelativistic approximations for the effective radial parameters the nuclear electric-quadrupole moments were obtained: Q( 191 Ir) = 0.81(21)b, Q( 193 Ir) = 0.73(19)b (corrected for Sternheimer shielding effects). (orig.) [de
10 CFR 431.193 - Test procedures for measuring energy consumption of distribution transformers.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Test procedures for measuring energy consumption of distribution transformers. 431.193 Section 431.193 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY... § 431.193 Test procedures for measuring energy consumption of distribution transformers. The test...
MicroRNA-193b represses cell proliferation and regulates cyclin D1 in melanoma.
Chen, Jiamin; Feilotter, Harriet E; Paré, Geneviève C; Zhang, Xiao; Pemberton, Joshua G W; Garady, Cherif; Lai, Dulcie; Yang, Xiaolong; Tron, Victor A
2010-05-01
Cutaneous melanoma is an aggressive form of human skin cancer characterized by high metastatic potential and poor prognosis. To better understand the role of microRNAs (miRNAs) in melanoma, the expression of 470 miRNAs was profiled in tissue samples from benign nevi and metastatic melanomas. We identified 31 miRNAs that were differentially expressed (13 up-regulated and 18 down-regulated) in metastatic melanomas relative to benign nevi. Notably, miR-193b was significantly down-regulated in the melanoma tissues examined. To understand the role of miR-193b in melanoma, functional studies were undertaken. Overexpression of miR-193b in melanoma cell lines repressed cell proliferation. Gene expression profiling identified 314 genes down-regulated by overexpression of miR-193b in Malme-3M cells. Eighteen of these down-regulated genes, including cyclin D1 (CCND1), were also identified as putative miR-193b targets by TargetScan. Overexpression of miR-193b in Malme-3M cells down-regulated CCND1 mRNA and protein by > or = 50%. A luciferase reporter assay confirmed that miR-193b directly regulates CCND1 by binding to the 3'untranslated region of CCND1 mRNA. These studies indicate that miR-193b represses cell proliferation and regulates CCND1 expression and suggest that dysregulation of miR-193b may play an important role in melanoma development.
Burns, Patricia; Vinderola, Gabriel; Reinheimer, Jorge; Cuesta, Isabel; de Los Reyes-Gavilán, Clara G; Ruas-Madiedo, Patricia
2011-08-01
The capacity of lactic acid bacteria to produce exopolysaccharides (EPS) conferring microorganisms a ropy phenotype could be an interesting feature from a technological point of view. Progressive adaptation to bile salts might render some lactobacilli able to overcome physiological gut barriers but could also modify functional properties of the strain, including the production of EPS. In this work some technological properties and the survival ability in simulated gastrointestinal conditions of Lactobacillus delbrueckii subsp. lactis 193, and Lb. delbrueckii subsp. lactis 193+, a strain with stable bile-resistant phenotype derived thereof, were characterized in milk in order to know whether the acquisition of resistance to bile could modify some characteristics of the microorganism. Both strains were able to grow and acidify milk similarly; however the production of ethanol increased at the expense of the aroma compound acetaldehyde in milk fermented by the strain 193+, with respect to milk fermented by the strain 193. Both microorganisms produced a heteropolysaccharide composed of glucose and galactose, and were able to increase the viscosity of fermented milks. In spite of the higher production yield of EPS by the bile-resistant strain 193+, it displayed a lower ability to increase viscosity than Lb. delbrueckii subsp. lactis 193. Milk increased survival in simulated gastric juice; the presence of bile improved adhesion to the intestinal cell line HT29-MTX in both strains. However, the acquisition of a stable resistance phenotype did not improve survival in simulated gastric and intestinal conditions or the adhesion to the intestinal cell line HT29-MTX. Thus, Lb. delbrueckii subsp. lactis 193 presents suitable technological properties for the manufacture of fermented dairy products; the acquisition of a stable bile-resistant phenotype modified some properties of the microorganism. This suggests that the possible use of bile-resistant derivative strains should be
49 CFR 193.2321 - Nondestructive tests.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... of storage tanks with internal design pressure above 15 psig must be nondestructively examined in... Vessel Code (Section VIII Division 1) (incorporated by reference, see § 193.2013). (b) For storage tanks...
14 CFR 61.193 - Flight instructor privileges.
2010-01-01
... than Flight Instructors With a Sport Pilot Rating § 61.193 Flight instructor privileges. A person who...; (e) An aircraft rating; (f) An instrument rating; (g) A flight review, operating privilege, or...
Kietzmann, Leonie; Guhr, Sebastian S O; Meyer, Tobias N; Ni, Lan; Sachs, Marlies; Panzer, Ulf; Stahl, Rolf A K; Saleem, Moin A; Kerjaschki, Dontscho; Gebeshuber, Christoph A; Meyer-Schwesinger, Catherine
2015-06-01
Parietal epithelial cells have been identified as potential progenitor cells in glomerular regeneration, but the molecular mechanisms underlying this process are not fully defined. Here, we established an immortalized polyclonal human parietal epithelial cell (hPEC) line from naive human Bowman's capsule cells isolated by mechanical microdissection. These hPECs expressed high levels of PEC-specific proteins and microRNA-193a (miR-193a), a suppressor of podocyte differentiation through downregulation of Wilms' tumor 1 in mice. We then investigated the function of miR-193a in the establishment of podocyte and PEC identity and determined whether inhibition of miR-193a influences the behavior of PECs in glomerular disease. After stable knockdown of miR-193a, hPECs adopted a podocyte-like morphology and marker expression, with decreased expression levels of PEC markers. In mice, inhibition of miR-193a by complementary locked nucleic acids resulted in an upregulation of the podocyte proteins synaptopodin and Wilms' tumor 1. Conversely, overexpression of miR-193a in vivo resulted in the upregulation of PEC markers and the loss of podocyte markers in isolated glomeruli. Inhibition of miR-193a in a mouse model of nephrotoxic nephritis resulted in reduced crescent formation and decreased proteinuria. Together, these results show the establishment of a human PEC line and suggest that miR-193a functions as a master switch, such that glomerular epithelial cells with high levels of miR-193a adopt a PEC phenotype and cells with low levels of miR-193a adopt a podocyte phenotype. miR-193a-mediated maintenance of PECs in an undifferentiated reactive state might be a prerequisite for PEC proliferation and migration in crescent formation. Copyright © 2015 by the American Society of Nephrology.
Photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm
Tang, Yongxin; Zhu, Lei
2005-06-01
We have studied the photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm by using laser photolysis combined with cavity ring-down spectroscopy. The HCO radical is a photodissociation product at 193 and 248 nm. The corresponding HCO quantum yields are 0.55 ± 0.07 and 0.12 ± 0.01, independent of butenedial pressure and nitrogen buffer gas pressure. Absorption cross-sections of butenedial are (6.88 ± 0.39) × 10 -18 and (3.62 ± 0.69) × 10 -19 cm 2 at 193 and 248 nm. The end-products from the photolysis of butenedial at 193, 248, 308, and 351 nm were measured by FTIR. Acrolein and 3H-furan-2-one were observed and their yields have been estimated.
49 CFR 193.2187 - Nonmetallic membrane liner.
2010-10-01
... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Design Lng Storage Tanks § 193.2187 Nonmetallic membrane liner. A flammable nonmetallic membrane liner may not be used as an inner container in a storage tank...
27 CFR 479.193 - Arms Export Control Act.
2010-04-01
..., AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND CERTAIN OTHER FIREARMS Other Laws Applicable § 479.193 Arms Export Control Act. For provisions relating to...
MiR-193b regulates early chondrogenesis by inhibiting the TGF-beta2 signaling pathway.
Hou, Changhe; Yang, Zibo; Kang, Yan; Zhang, Ziji; Fu, Ming; He, Aishan; Zhang, Zhiqi; Liao, Weiming
2015-04-13
Cartilage generation and degradation are regulated by miRNAs. Our previous study has shown altered expression of miR-193b in chondrogenic human adipose-derived mesenchymal stem cells (hADSCs). In the current study, we investigated the role of miR-193b in chondrogenesis and cartilage degradation. Luciferase reporter assays showed that miR-193b targeted seed sequences of the TGFB2 and TGFBR3 3'-UTRs. MiR-193b suppressed the expression of early chondrogenic markers in chondrogenic ATDC5 cells, and TNF-alpha expression in IL-1b-induced PMCs. In conclusion, MiR-193b may inhibit early chondrogenesis by targeting TGFB2 and TGFBR3, and may regulate inflammation by repressing TNF-alpha expression in inflamed chondrocytes. Copyright © 2015. Published by Elsevier B.V.
Reference: 193 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 193 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15772667i Peiter Edgar et al. 2005 Mar. Natur...ation and stomatal movement. 7031 404-8 15772667 2005 Mar Nature Hetherington Alistair M|Knight Heather|Maathuis Frans J M|Mills Lewis N|Peiter Edgar|Pelloux J辿r担me|Sanders Dale
International Nuclear Information System (INIS)
Zahn, Guilherme Soares
2006-01-01
In this work, the excited levels of 193 Ir populated by the beta - decay of 193 Os (T 1/2 ∼ 30h) were investigated. For that purpose, ∼ 5 mg samples of 99%-enriched 192 Os were irradiated under a thermal neutron flux of ∼ 10 12 s -1 and then analysed both using single gamma spectroscopy and a 4-detector multi parametric acquisition facility, which provided data for both a gamma gamma coincidence analysis and a directional angular correlation gamma gamma (θ ) study. From these data, 28 transitions were added to this decay scheme, 11 of which were previously known from nuclear reactions and 17 observed for the first time. Eight excited levels were also added to the decay scheme, 3 of which were known from nuclear reaction studies - the remaining 5 are suggested for the first time. Moreover, it was possible to confirm suspicions found in reference that the levels at 848.93 keV and 849.093 keV are indeed the same; it was also possible to confirm the existence of an excited level at 806.9 keV, which had been inferred, but not experimentally confirmed in beta decay studies to date. The angular correlation analysis allowed for the definition of the spin of the excited level at 874 keV as 5/2 +; moreover, the results showed a 79% probability that the spin of the 1078 keV level is 5/2/'-, and also restricted the spin possibilities for the new excited level at 960 keV to two values (1/2 or 3/2). It was also possible to measure the multipolarity mixing ratio (δ Ln+1 /L n ) for 43 transitions - 19 of them for the first time and most of the others with a better precision than previously known. Finally, an attempt was made to understand the low-lying levels structure for this nucleus using a theoretical model, which reproduced the ground state and the two lowest-lying excited levels in 193 Ir. (author)
14 CFR 193.15 - What FAA officials exercise the authority of the Administrator under this part?
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false What FAA officials exercise the authority of the Administrator under this part? 193.15 Section 193.15 Aeronautics and Space FEDERAL AVIATION... SUBMITTED INFORMATION § 193.15 What FAA officials exercise the authority of the Administrator under this...
193Hg collective oblate band with Ex>5.7 MeV
International Nuclear Information System (INIS)
Roy, N.; Henry, E.A.; Becker, J.A.
1993-01-01
Rotational bands in the neutron-deficient Pb nuclei 192,194,196-201 Pb have been reported recently. Band members are connected by L = 1 transitions, with crossover L = 2 transitions observed at the higher γ-ray energies. Regular and irregular patterns of γ-ray energies are observed. Conversion coefficients determined from intensity balance suggest the L = 1 transitions are M1. The bands have generally been interpreted as collective oblate, involving deformation aligned high-j proton configurations such as π(s 1/2 -2 h 9/2 i 13/2 ), and rotation aligned i 13/2 -n neutrons. Evidence for a similar band in 193 Hg has been obtained. 193 Hg was populated in the reaction 176 Yb( 22 Ne,5n) at E i ( 22 Ne) = 110 MeV. Reaction γ rays were detected with the Ge detector array HERA. A new 'collective' structure was observed with E x >5.7 MeV. States of the structure extend from I≥47/2 to I +10, and they decay with competing dipole and quadrupole transitions. The ratio B(M1)/B(E2), ∼ 2μ 2 /(e b) 2 , is approximately 10x lower in 193 Hg than in the Pb bands. The lowest member is produced with ∼20% of the 193 Hg cross section. Evidence for a similar band in 196 Hg will be presented at this meeting
41 CFR 102-193.20 - What are the specific agency responsibilities for records management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the specific agency responsibilities for records management? 102-193.20 Section 102-193.20 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
MVP-mediated exosomal sorting of miR-193a promotes colon cancer progression.
Teng, Yun; Ren, Yi; Hu, Xin; Mu, Jingyao; Samykutty, Abhilash; Zhuang, Xiaoying; Deng, Zhongbin; Kumar, Anil; Zhang, Lifeng; Merchant, Michael L; Yan, Jun; Miller, Donald M; Zhang, Huang-Ge
2017-02-17
Exosomes are emerging mediators of intercellular communication; whether the release of exosomes has an effect on the exosome donor cells in addition to the recipient cells has not been investigated to any extent. Here, we examine different exosomal miRNA expression profiles in primary mouse colon tumour, liver metastasis of colon cancer and naive colon tissues. In more advanced disease, higher levels of tumour suppressor miRNAs are encapsulated in the exosomes. miR-193a interacts with major vault protein (MVP). Knockout of MVP leads to miR-193a accumulation in the exosomal donor cells instead of exosomes, inhibiting tumour progression. Furthermore, miR-193a causes cell cycle G1 arrest and cell proliferation repression through targeting of Caprin1, which upregulates Ccnd2 and c-Myc. Human colon cancer patients with more advanced disease show higher levels of circulating exosomal miR-193a. In summary, our data demonstrate that MVP-mediated selective sorting of tumour suppressor miRNA into exosomes promotes tumour progression.
Results from a new 193nm die-to-database reticle inspection platform
Broadbent, William H.; Alles, David S.; Giusti, Michael T.; Kvamme, Damon F.; Shi, Rui-fang; Sousa, Weston L.; Walsh, Robert; Xiong, Yalin
2010-05-01
A new 193nm wavelength high resolution reticle defect inspection platform has been developed for both die-to-database and die-to-die inspection modes. In its initial configuration, this innovative platform has been designed to meet the reticle qualification requirements of the IC industry for the 22nm logic and 3xhp memory generations (and shrinks) with planned extensions to the next generation. The 22nm/3xhp IC generation includes advanced 193nm optical lithography using conventional RET, advanced computational lithography, and double patterning. Further, EUV pilot line lithography is beginning. This advanced 193nm inspection platform has world-class performance and the capability to meet these diverse needs in optical and EUV lithography. The architecture of the new 193nm inspection platform is described. Die-to-database inspection results are shown on a variety of reticles from industry sources; these reticles include standard programmed defect test reticles, as well as advanced optical and EUV product and product-like reticles. Results show high sensitivity and low false and nuisance detections on complex optical reticle designs and small feature size EUV reticles. A direct comparison with the existing industry standard 257nm wavelength inspection system shows measurable sensitivity improvement for small feature sizes
Study of {sup 193}Os beta{sup -} decay; Estudo do decaimento beta{sup -} do {sup 193}Os
Energy Technology Data Exchange (ETDEWEB)
Zahn, Guilherme Soares
2006-07-01
In this work, the excited levels of {sup 193}Ir populated by the beta{sup -} decay of {sup 193}Os (T{sub 1/2} {approx} 30h) were investigated. For that purpose, {approx} 5 mg samples of 99%-enriched {sup 192}Os were irradiated under a thermal neutron flux of {approx} 10{sup 12} s{sup -1} and then analysed both using single gamma spectroscopy and a 4-detector multi parametric acquisition facility, which provided data for both a gamma gamma coincidence analysis and a directional angular correlation gamma gamma ({theta} ) study. From these data, 28 transitions were added to this decay scheme, 11 of which were previously known from nuclear reactions and 17 observed for the first time. Eight excited levels were also added to the decay scheme, 3 of which were known from nuclear reaction studies - the remaining 5 are suggested for the first time. Moreover, it was possible to confirm suspicions found in reference that the levels at 848.93 keV and 849.093 keV are indeed the same; it was also possible to confirm the existence of an excited level at 806.9 keV, which had been inferred, but not experimentally confirmed in beta decay studies to date. The angular correlation analysis allowed for the definition of the spin of the excited level at 874 keV as 5/2{sup +;} moreover, the results showed a 79% probability that the spin of the 1078 keV level is 5/2/'-, and also restricted the spin possibilities for the new excited level at 960 keV to two values (1/2 or 3/2). It was also possible to measure the multipolarity mixing ratio ({delta}{sub Ln+1}/L{sub n}) for 43 transitions - 19 of them for the first time and most of the others with a better precision than previously known. Finally, an attempt was made to understand the low-lying levels structure for this nucleus using a theoretical model, which reproduced the ground state and the two lowest-lying excited levels in {sup 193}Ir. (author)
Measurement of the ground state spectroscopic quadrupole moments of 191Os and 193Os
International Nuclear Information System (INIS)
Ernst, H.; Hagn, E.; Zech, E.
1979-01-01
Radioactive 191 Os and 193 Os nuclei have been aligned in an Os single crystal at temperatures down to 4 mK. From the temperature dependence of the γ-anisotropy the quadrupole frequencies vsub(Q) = e 2 qQ/h have been determined as vsub(Q)( 191 OsOs) = -278+-9 MHz and vsub(Q)( 193 OsOs) = -96+-15 MHz. With the known electric field gradient for OsOs of eq = (-4.54+-0.24) x 10 17 V/cm 2 the ground state spectroscopic quadrupole moments are deduced to be Q( 191 Os) = +2.53+-0.16 b and Q( 193 Os) = +0.87+-0.15 b. (orig.)
All-dry resist processes for 193-nm lithography
Horn, Mark W.; Maxwell, Brian E.; Kunz, Roderick R.; Hibbs, Michael S.; Eriksen, Lynn M.; Palmateer, Susan C.; Forte, Anthony R.
1995-06-01
We report on two different all-dry resist schemes for 193-nm lithography, one negative tone and one positive tone. Our negative tone resist is an extension of our initial work on all-dry photoresists. This scheme employs a bilayer in which the imaging layer is formed by plasma enhanced chemical vapor deposition (PECVD) from tetramethylsilane (TMS) and deposited onto PECVD carbon-based planarizing layers. Figure 1 shows SEMs of dark field and light field octagons patterned in projection on Lincoln Laboratory's 0.5-NA 193-nm Micrascan system. These 0.225-micrometers and 0.200-micrometers line and space features were obtained at a dose of approximately 58 mJ/cm2. Dry development of the exposed resist was accomplished using Cl2 chemistry in a helicon high-ion-density etching tool. Pattern transfer was performed in the helicon tool with oxygen-based chemistries. Recently, we have also developed an all-dry positive-tone silylation photoresist. This photoresist is a PECVD carbon-based polymer which is crosslinked by 193-nm exposure, enabling selective silylation similar to that initially reported by Hartney et al., with spin-applied polymers. In those polymers, for example polyvinylphenol, the silylation site concentration is fixed by the hydroxyl groups on the polymer precursors, thus limiting the silicon uptake per unit volume. With PECVD polymers, the total concentration of silylation sites and their depth can be tailored by varying plasma species as a function of time during the deposition. This affords the possibility of greater silicon uptake per unit volume and better depth control of the silylation profile. Figure 2 shows a SEM of 0.5-micrometers features patterned in plasma deposited silylation resist.
2010-10-01
... Pitot tube pressure of not less than 50 p.s.i. Where 11/2-inch hose is permitted in lieu of 21/2-inch... 21/2-inch hose had been permitted. Where 3/4-inch hose is permitted by Table 193.10-5(a), the Pitot... fire pumps; or (B) Another suitable pump capable of supplying one hose stream at a Pitot tube pressure...
Advances in 193 nm excimer lasers for mass spectrometry applications
Delmdahl, Ralph; Esser, Hans-Gerd; Bonati, Guido
2016-03-01
Ongoing progress in mass analysis applications such as laser ablation inductively coupled mass spectrometry of solid samples and ultraviolet photoionization mediated sequencing of peptides and proteins is to a large extent driven by ultrashort wavelength excimer lasers at 193 nm. This paper will introduce the latest improvements achieved in the development of compact high repetition rate excimer lasers and elaborate on the impact on mass spectrometry instrumentation. Various performance and lifetime measurements obtained in a long-term endurance test over the course of 18 months will be shown and discussed in view of the laser source requirements of different mass spectrometry tasks. These sampling type applications are served by excimer lasers delivering pulsed 193 nm output of several mJ as well as fast repetition rates which are already approaching one Kilohertz. In order to open up the pathway from the laboratory to broader market industrial use, sufficient component lifetimes and long-term stable performance behavior have to be ensured. The obtained long-term results which will be presented are based on diverse 193 nm excimer laser tube improvements aiming at e.g. optimizing the gas flow dynamics and have extended the operational life the laser tube for the first time over several billion pulses even under high duty-cycle conditions.
27 CFR 24.193 - Conversion into still wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion into still wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Effervescent Wine § 24.193 Conversion into still wine. Sparkling wine or artificially carbonated wine may be dumped for use as still wine. The dumping process will...
41 CFR 102-193.10 - What are the goals of the Federal Records Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the goals of the Federal Records Management Program? 102-193.10 Section 102-193.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION...
2010-01-01
... SUBMITTED INFORMATION § 193.5 How may I submit safety or security information and have it protected from... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false How may I submit safety or security information and have it protected from disclosure? 193.5 Section 193.5 Aeronautics and Space FEDERAL AVIATION...
miR-193b Modulates Resistance to Doxorubicin in Human Breast Cancer Cells by Downregulating MCL-1
Directory of Open Access Journals (Sweden)
Jingpei Long
2015-01-01
Full Text Available MicroRNAs (miRNAs family, which is involved in cancer development, proliferation, apoptosis, and drug resistance, is a group of noncoding RNAs that modulate the expression of oncogenes and antioncogenes. Doxorubicin is an active cytotoxic agent for breast cancer treatment, but the acquisition of doxorubicin resistance is a common and critical limitation to cancer therapy. The aim of this study was to investigate whether miR-193b mediated the resistance of breast cancer cells to doxorubicin by targeting myeloid cell leukemia-1 (MCL-1. In this study, we found that miR-193b levels were significantly lower in doxorubicin-resistant MCF-7 (MCF-7/DOXR cells than in the parental MCF-7 cells. We observed that exogenous miR-193b significantly suppressed the ability of MCF-7/DOXR cells to resist doxorubicin. It demonstrated that miR-193b directly targeted MCL-1 3′-UTR (3′-Untranslated Regions. Further studies indicated that miR-193b sensitized MCF-7/DOXR cells to doxorubicin through a mechanism involving the downregulation of MCL-1. Together, our findings provide evidence that the modulation of miR-193b may represent a novel therapeutic target for the treatment of breast cancer.
2010-07-01
... management business process improvements should my agency strive to achieve? 102-193.25 Section 102-193.25...-193.25 What type of records management business process improvements should my agency strive to... correspondence; (b) Design forms that are easy to fill-in, read, transmit, process, and retrieve, and reduce...
X-ray yields of superdeformed states in 193Hg
International Nuclear Information System (INIS)
Cullen, D.M.; Lee, I.Y.; Baktash, C.
1993-01-01
The K α =x-ray yields associated with the superdeformed and normal-deformed bands in 193 Hg have been measured. The results indicate an excess yield of K α -x rays in coincidence with the superdeformed cascade relative to that in coincidence with the normal-deformed cascade. The internal conversion of known transitions along the superdeformed cascade cannot account for the observed K α -x ray yield. It is likely that this excess x-ray yield is associated with low energy M1 transitions competing with the low-spin superdeformed E2 transitions. These M1 γ rays are expected to connect the two superdeformed bands which are observed in coincidence with each other. Calculations based on the measured γ-ray intensities indicate that within the experimental uncertainties the excess K α yield can be entirely accounted for by interband-M1 transitions. X-ray yields from the recent 193 Hg EUROGAM experiment will also be discussed
Low-energy levels calculation for 193Ir
International Nuclear Information System (INIS)
Zahn, Guilherme Soares; Zamboni, Cibele Bugno; Genezini, Frederico Antonio; Mesa-Hormaza, Joel; Cruz, Manoel Tiago Freitas da
2006-01-01
In this work, a model based on single particle plus pairing residual interaction was used to study the low-lying excited states of the 193 Ir nucleus. In this model, the deformation parameters in equilibrium were obtained by minimizing the total energy calculated by the Strutinsky prescription; the macroscopic contribution to the potential was taken from the Liquid Droplet Model, with the shell and paring corrections used as as microscopic contributions. The nuclear shape was described using the Cassinian ovoids as base figures; the single particle energy spectra and wave functions for protons and neutrons were calculated in a deformed Woods-Saxon potential, where the parameters for neutrons were obtained from the literature and the parameters for protons were adjusted in order to describe the main sequence of angular momentum and parity of the band heads, as well as the proton binding energy of 193 Ir. The residual pairing interaction was calculated using the BCS prescription with Lipkin-Nogami approximation. The results obtained for the first three band heads (the 3/2 + ground state, the 1/2 + excited state at E ∼ 73 keV and the the 11/2 - isomeric state at E ∼ 80 keV) showed a very good agreement, but the model so far greatly overestimated the energy of the next band head, a 7/2 - at E ∼ 299 keV. (author)
Aging effect of AlF3 coatings for 193 nm lithography
Zhao, Jia; Wang, Lin; Zhang, Weili; Yi, Kui; Shao, Jianda
2018-02-01
As important part of components for 193 nm lithography, AlF3 coatings deposited by resistive heating method acquire advantages like lower optical loss and higher laser damage threshold, but they also possess some disadvantages like worse stability, which is what aging effect focuses on. AlF3 single-layer coatings were deposited; optical property, surface morphology and roughness, and composition were characterized in different periods. Owing to aging effect, refractive index and extinction coefficient increased; larger and larger roughness caused more and more scattering loss, which was in the same order with absorption at 193.4 nm and part of optical loss; from composition analysis, proportional substitution of AlF3 by alumina may account for changes in refractive index as well as absorption.
Design, synthesis, and characterization of fluorine-free PAGs for 193-nm lithography
Liu, Sen; Glodde, Martin; Varanasi, Pushkara R.
2010-04-01
Photoacid generators (PAGs) are a key component in chemically amplified resists used in photolithography. Perfluorooctanesulfonates (PFOS) and other perfluoroalkylsulfonates (PFAS) have been well adopted as PAGs in 193 nm photoresist. Recently, concerns have been raised about their environmental impact due to their chemical persistency, bioaccumulation and toxicity. It is a general interest to find environmentally benign PAGs that are free of fluorine atoms. Here we describe the design, synthesis and characterization of a series of novel fluorine-free onium salts as PAGs for 193 nm photoresists. These PAGs demonstrated desirable physical and lithography properties when compared with PFAS-based PAGs for both dry and immersion exposures.
Directory of Open Access Journals (Sweden)
Junjie Chen
2016-11-01
Full Text Available Abstract Background The metastatic cascade is a complex and multistep process with many potential barriers. Recently, miR-193a has been reported to be a suppressive miRNA in multiple types of cancers, but its underlying anti-oncogenic activity in non-small cell lung cancers (NSCLC is not fully elucidated. Methods The expressions of miR-193a (miR-193a-5p in human lung cancer tissues and cell lines were detected by real-time PCR. Dual-luciferase reporter assay was used to identify the direct target of miR-193a. Cell proliferation, apoptosis, and metastasis were assessed by CCK-8, flow cytometry, and Transwell assay, respectively. Results The expression of miR-193a in lung cancer tissues was decreased comparing to adjacent non-tumor tissues due to DNA hypermethylation in lung cancer tissues. Ectopic expression of miR-193a inhibited cell proliferation, colony formation, migration, and invasion in A549 and H1299 cells. Moreover, overexpression of miR-193a partially reversed tumor growth factor-β1 (TGF-β1-induced epithelial-to-mesenchymal transition (EMT in NSCLC cells. Mechanistically, miR-193a reduced the expression of WT1, which negatively regulated the protein level of E-cadherin, suggesting that miR-193a might prevent EMT via modulating WT1-E-cadherin axis. Importantly, knockdown of WT1 resembled the anti-cancer activity by miR-193a and overexpression of WT1 partially reversed miR-193a-induced anti-cancer activity, indicating that WT1 plays an important role in miR-193a-induced anti-cancer activity. Finally, overexpression of miR-193a decreased the growth of tumor xenografts in mice. Conclusion Collectively, our results have revealed an important role of miR-193a-WT1-E-cadherin axis in metastasis, demonstrated an important molecular cue for EMT, and suggested a therapeutic strategy of restoring miR-193a expression in NSCLC.
26 CFR 1.193-1 - Deduction for tertiary injectant expenses.
2010-04-01
... in which the expenses are paid or incurred. (b) Definitions—(1) Qualified tertiary injectant expenses... Chief Counsel (Technical) for purposes of section 193. (c) Special rules for hydrocarbons—(1) In general. If an injectant contains more than an insignificant amount of recoverable hydrocarbons, the amount...
High-spin states in the 192Pb and 193Pb isotopes
International Nuclear Information System (INIS)
Lagrange, J.M.; Pautrat, M.
1991-01-01
The 193 Pb and 192 Pb isotopes are produced through the 182 W( 16 O, 5n, 6n) reactions. The de-excitation γ-ray and conversion electron spectra lead to the conversion coefficients for most transitions. With the results of the γ-γ and e - -γ coincidences, the half-lives measured for several states, the angular distribution coefficients for the odd isotope and the transition multipolarities, the data on the 192 Pb level scheme has been much enhanced and the 193 Pb one studied for the first time. The experimental schemes are compared to those given by microscopic calculations, in a two or three quasi-particle approximation using a surface delta interaction with a reduced pairing component. The discrepancies between theory and experiment are attributed to the increasing influence of proton configurations
Absorption coefficients for water vapor at 193 nm from 300 to 1073 K
Kessler, W. J.; Carleton, K. L.; Marinelli, W. J.
1993-01-01
Measurements of the water absorption coefficient at 193 nm from 300 to 1073 K are reported. The measurements were made using broadband VUV radiation and a monochromator-based detection system. The water vapor was generated by a saturator and metered into a flowing, 99 cm absorption cell via a water vapor mass flow meter. The 193 nm absorption coefficient measurements are compared to room temperature and high temperature shock tube measurements with good agreement. The absorption can be parameterized by a nu3 vibrational mode reaction coordinate and the thermal population of the nu3 mode.
Evidence for octupole softness of the superdeformed shape from band interactions in sup 193,4 Hg
Energy Technology Data Exchange (ETDEWEB)
Cullen, D.M.; Riley, M.A.; Alderson, A.; Ali, I.; Fallon, P.; Forsyth, P.D.; Hanna, F.; Mullins, S.M.; Roberts, J.W.; Sharpey-Schafer, J.F.; Twin, P.J. (Liverpool Univ. (UK). Oliver Lodge Lab.); Bengtsson, T. (Lund Inst. of Tech. (Sweden). Dept. of Mathematical Physics); Bentley, M.A.; Bruce, A.M.; Simpson, J. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Nazarewicz, W. (Liverpool Univ. (UK). Oliver Lodge Lab. Politechnika Warszawska (Poland). Inst. Fizyki); Poynter, R.; Regan, P.; Wadsworth, R. (York Univ. (UK). Dept. of Physics); Satula, W. (Warsaw Univ. (Poland). Inst. Fizyki Teoretycznej); Sletten, G. (Niels Bohr Inst., Roskilde (Denmark). Tandem Accelerator Lab.); Wyss, R. (Manne Siegbahn Inst. of Physics, Stockholm (Sweden))
1990-12-24
Three superdeformed (SD) bands have been observed in {sup 194}Hg and four (or five ) SD bands in {sup 193}Hg using the {sup 150}Nd+{sup 48}Ca reaction. All bands except for two in {sup 193}Hg show a steady increase in dynamical moment of inertia J{sup (2)} with rotational frequency. The two exceptional bands form a classical pair of strongly interacting bands. It is suggested that the strong interaction between the bands is caused by a softness to octupole deformation. Evidence is found for the existence of dipole transitions connecting bands of opposite signature in {sup 193}Hg. The strengths of these transitions suggest that they are probably E1 supporting the importance of the role of octupole vibrations. These data suggest the wider importance of octupole softness in enhancing E1 transitions in the SD feeding and decay mechanisms. The spectroscopy of the observed SD bands in {sup 193,4}Hg are discussed in detail and attention is drawn to the 'identical' energies of {gamma}-rays in these isotopes with those in lighter isotopes. The similarities in bands relate to the neutron sub-shell closure for SD nuclei at N=112. (orig.).
49 CFR 193.2629 - External corrosion control: buried or submerged components.
2010-10-01
...) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2629 External... external corrosive attack must be protected from external corrosion by— (1) Material that has been designed...
Miyakura, Yasuyuki; Tahara, Makiko; Lefor, Alan T; Yasuda, Yoshikazu; Sugano, Kokichi
2014-11-24
Methylation of the MLH1 promoter region has been suggested to be a major mechanism of gene inactivation in sporadic microsatellite instability-positive (MSI-H) colorectal cancers (CRCs). Recently, single-nucleotide polymorphism (SNP) in the MLH1 promoter region (MLH1-93G/A; rs1800734) has been proposed to be associated with MLH1 promoter methylation, loss of MLH1 protein expression and MSI-H tumors. We examined the association of MLH1-93G/A and six other SNPs surrounding MLH1-93G/A with the methylation status in 210 consecutive sporadic CRCs in Japanese patients. Methylation of the MLH1 promoter region was evaluated by Na-bisulfite polymerase chain reaction (PCR)/single-strand conformation polymorphism (SSCP) analysis. The genotype frequencies of SNPs located in the 54-kb region surrounding the MLH1-93G/A SNP were examined by SSCP analysis. Methylation of the MLH1 promoter region was observed in 28.6% (60/210) of sporadic CRCs. The proportions of MLH1-93G/A genotypes A/A, A/G and G/G were 26% (n=54), 51% (n=108) and 23% (n=48), respectively, and they were significantly associated with the methylation status (p=0.01). There were no significant associations between genotype frequency of the six other SNPs and methylation status. The A-allele of MLH1-93G/A was more common in cases with methylation than the G-allele (p=0.0094), especially in females (p=0.0067). In logistic regression, the A/A genotype of the MLH1-93G/A SNP was shown to be the most significant risk factor for methylation of the MLH1 promoter region (odds ratio 2.82, p=0.003). Furthermore, a haplotype of the A-allele of rs2276807 located -47 kb upstream from the MLH1-93G/A SNP and the A-allele of MLH1-93G/A SNP was significantly associated with MLH1 promoter methylation. These results indicate that individuals, and particularly females, carrying the A-allele at the MLH1-93G/A SNP, especially in association with the A-allele of rs2276807, may harbor an increased risk of methylation of the MLH1 promoter
International Nuclear Information System (INIS)
Herbertson, R. A.; Lee, F. T.; Hopkins, W.; Smyth, F. E.; Murone, C.; Tebbutt, N. C.; Micallef, N.; MacFarlane, D. J.; Bellen, J.; Sonnichsen, D. S.; Brechbiel, M. W.; Scott, A. M.; Lee, T. L.
2009-01-01
Full text:Background: The Lewis Y (Ley) antigen is a blood-group related antigen expressed in >70% of solid tumours. This study explored the biodistribution and pharmacokinetics of the immunoconjugate CMD-193 (humanized anti-Ley antibody conjugated with calichaemicin) in patients with advanced Ley expressing epithelial cancers. Methods: There were 2 dose cohorts, (1.0mg/m2 and 2.6mg/m2). Primary objectives were to determine biodistribution and pharmacokinetics of CMD-193. The first cycle was labelled with 111In for biodistribution assessment, and subsequent cycles were administered 3 weekly to a maximum of 6 cycles. Tumour targeting was assessed using SPECT imaging, and pharmacokinetic analysis was based on gamma counting (111In-CMD-193) and ELISA (CMD-193 protein). Results: Nine patients were enrolled, and received 1-6 treatment cycles. Biodistribution imaging demonstrated initial blood pooling, followed by markedly increased hepatic uptake by day 2 (which persisted to day 8), and fast blood clearance. This pattern was seen for all patients, with no significant tumour uptake visualised in any patient. The overall T 1 /2 of 111In-CMD-193 complex formation in blood. One patient had partial metabolic response on 18F-FDG-PET. No radiologic responses were observed. Conclusions: CMD-193 demonstrates rapid blood clearance and increased hepatic uptake compared to prior studies of the original non-conjugated antibody. This trial highlights the importance of biodistribution and pharmacodynamic assessment in early phase studies of new biologics in clinical development.
Detection of OH on photolysis of styrene oxide at 193 nm in gas phase
Kumar, Awadhesh; SenGupta, Sumana; Pushpa, K. K.; Naik, P. D.; Bajaj, P. N.
2006-10-01
Photodissociation of styrene oxide at 193 nm in gas phase generates OH, as detected by laser-induced fluorescence technique. Under similar conditions, OH was not observed from ethylene and propylene oxides, primarily because of their low absorption cross-sections at 193 nm. Mechanism of OH formation involves first opening of the three-membered ring from the ground electronic state via cleavage of either of two C sbnd O bonds, followed by isomerization to enolic forms of phenylacetaldehyde and acetophenone, and finally scission of the C sbnd OH bond of enols. Ab initio molecular orbital calculations support the proposed mechanism.
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false How must design and production approval... REGULATIONS PROTECTION OF VOLUNTARILY SUBMITTED INFORMATION § 193.17 How must design and production approval... under § 193.9(a)(2) to the holders of design approvals of production approvals issued by the FAA, the...
Wu, Hongyu; Zhou, Caicun
2018-02-05
Lung cancer is a leading cause of death worldwide. Long non-coding RNAs have been documented aberrantly expressed and exerted crucial role in variety of cancers. Urothelial carcinoma associated 1 (UCA1) is a potential new type of biomarkers for tumor diagnosis and exerts oncogenic effect on various human cancers. However, the mechanism of oncogenic role of UCA1 in lung cancer remains unclear. In this study, we firstly confirmed the role of UCA1 in lung cancer and found that UCA1 down-regulation inhibited cell proliferation and migration in both SKMES-1 and H520 lung cancer cells. Then we demonstrated that repressed UCA1 promoted the miR-193a expression and miR-193a could bind to the predicted binding site of UCA1. We then dissected the role of miR-193a in lung cancer and proved the anti-tumor role of miR-193a. Furthermore, we found that miR-193a displayed its role in lung cancer via modulating the HMGB1 expression. In addition, we found that over-expression of HMGB1 could restore the UCA1 knockdown induced repression of cell proliferation and migration. In summary, our study demonstrated that UCA1 exerts oncogenes activity in lung cancer, acting mechanistically by upregulating HMGB1 expression through 'sponging' miR-193a. Copyright © 2018 Elsevier Inc. All rights reserved.
Identification of low-lying proton-based intruder states in 189-193Pb
International Nuclear Information System (INIS)
Vel, K. van de; Andreyev, A.N.; Huyse, M.; Duppen, P. van; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Helariutta, K.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Kuusiniemi, P.; Leino, M.; Muikku, M.; Nieminen, P.; Eskola, K.; Wyss, R.
2002-01-01
Low-lying proton-based intruder states have been observed in the odd-mass isotopes 189,191,193 Pb in experiments at the RITU gas-filled recoil separator. The identification has been performed by observing the fine structure in the α decay of the parent 193,195,197 Po nuclei in prompt coincidence with conversion electrons and γ rays in the daughter lead isotopes. Along with the literature data these results establish a systematics of intruder states in the odd-mass lead isotopes from 197 Pb down to 185 Pb. Interpretation of these states involves the coupling of the 1i 13/2 or 3p 3/2 odd neutron to the 0 + state in the oblate minimum in the even-mass lead core. Conversion coefficients have been determined for some of the transitions, revealing mixing between the coexisting states. The experimental results are compared to potential energy surface calculations
Evidence for stepwise dissociation dynamics in acetone at 248 and 193 nm
North, Simon W.; Blank, David A.; Gezelter, J. Daniel; Longfellow, Cheryl A.; Lee, Yuan T.
1995-03-01
The technique of molecular beam photofragment translational spectroscopy has been used to study the dissociation of acetone following S1←S0 (248 nm) and S2←S0 (193 nm) excitation. Excitation at 248 nm resulted in the production of CH3 and CH3CO with 14.2±1.0 kcal/mole on average of the available energy appearing as translation of the photofragments. Comparison of the measured with values reported at 266 nm suggest that the energy partitioning is dominated by the exit barrier caused by an avoided crossing on the potential energy surface. A substantial fraction (30±4%) of the nascent acetyl radicals from the primary dissociation contain sufficient energy to undergo spontaneous secondary decomposition. From the onset of the truncation of the CH3CO P(ET) a threshold of 17.8±3.0 kcal/mole for the dissociation of the acetyl radical has been determined in agreement with recent results on the photodissociation of acetyl chloride. The translational energy release in the dissociation of CH3CO closely matches the experimentally determined exit barrier. At 193 nm the only observed dissociation pathway was the formation of two methyl radicals and carbon monoxide. On average ˜38% of the available energy is found in product translation suggesting that significant internal energy resides in the nascent CH3 fragments consistent with the results of Hall et al. [J. Chem. Phys. 94, 4182 (1991)]. We conclude that the dynamics and energy partitioning for dissociation at 193 nm is similar to that at 248 nm.
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
34 CFR 403.193 - What are the information requirements regarding special populations?
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false What are the information requirements regarding special... TECHNOLOGY EDUCATION PROGRAM What Conditions Must be Met by Local Recipients? § 403.193 What are the... their parents information concerning— (i) The opportunities available in vocational education; (ii) The...
2011-05-27
... Point Hope et al., v. Salazar, No. 1:08-cv-00004-RRB (D. Alaska)]. The sale was conducted in February... Continental Shelf, Alaska OCS Region, Chukchi Sea Planning Area, Oil and Gas Lease Sale 193 AGENCY: Bureau of...: BOEMRE announces the availability of a Revised Draft SEIS, OCS Oil and Gas Lease Sale 193, Chukchi Sea...
Directory of Open Access Journals (Sweden)
Maria Perez Carrion
2018-02-01
Full Text Available Mutations in leucine-rich repeat kinase 2 gene (LRRK2 are associated with familial and sporadic Parkinson’s disease (PD. LRRK2 is a complex protein that consists of multiple domains, including 13 putative armadillo-type repeats at the N-terminus. In this study, we analyzed the functional and molecular consequences of a novel variant, E193K, identified in an Italian family. E193K substitution does not influence LRRK2 kinase activity. Instead it affects LRRK2 biochemical properties, such as phosphorylation at Ser935 and affinity for 14-3-3ε. Primary fibroblasts obtained from an E193K carrier demonstrated increased cellular toxicity and abnormal mitochondrial fission upon 1-methyl-4-phenylpyridinium treatment. We found that E193K alters LRRK2 binding to DRP1, a crucial mediator of mitochondrial fission. Our data support a role for LRRK2 as a scaffolding protein influencing mitochondrial fission.
Comparison of 193 nm and 308 nm laser liquid printing by shadowgraphy imaging
Energy Technology Data Exchange (ETDEWEB)
Palla-Papavlu, A., E-mail: apalla@nipne.ro [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania); Shaw-Stewart, J. [EMPA, Swiss Federal Laboratories for Materials Testing and Research, Laboratory for Functional Polymers, Überlandstrasse 129, 8600 Dübendorf (Switzerland); Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Mattle, T. [Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Dinca, V. [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania); Lippert, T.; Wokaun, A. [Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Dinescu, M. [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania)
2013-08-01
Over the last years laser-induced forward transfer has emerged as a versatile and powerful tool for engineering surfaces with active compounds. Soft, easily damageable materials can be transferred using a triazene polymer as a sacrificial layer which acts as a pressure generator and at the same time protects the material from direct laser irradiation. To understand and optimize the transfer process of biomolecules in liquid solution by using an intermediate triazene polymer photosensitive layer, shadowgraphy imaging is carried out. Two laser systems i.e. an ArF laser operating at 193 nm and a XeCl laser operating at 308 nm are applied for the transfer. Solutions with 50% v/v glycerol concentration are prepared and the influence of the triazene polymer sacrificial layer thickness (60 nm) on the deposits is studied. The shadowgraphy images reveal a pronounced difference between laser-induced forward transfer using 193 nm or 308 nm, i.e. very different shapes of the ejected liquid.
46 CFR 193.10-90 - Installations contracted for prior to March 1, 1968.
2010-10-01
... service so long as they are maintained in good condition to the satisfaction of the Officer in Charge, Marine Inspection. Minor repairs, alterations, and replacements may be permitted to the same standards as...) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Main System, Details § 193.10-90 Installations...
The drift velocity of electrons in carbon dioxide at temperatures between 193 and 573 K
International Nuclear Information System (INIS)
Elford, M.T.; Haddad, G.N.
1980-01-01
The drift velocity of electrons in carbon dioxide has been measured at gas temperatures ranging from 193 to 573 K and at E/N values up to 20 Td at 193 K, 50 Td at 293 K and 40 Td at 573 K. The measured drift velocities were found to decrease linearly with increasing gas number density at a given value of E/N for gas temperatures less than 293 K. This dependence has been attributed to multiple scattering and the data have been extrapolated to zero number density to correct for this effect. Comparisons are made with previous measurements where available. The present data for the variation of μN(thermal) with temperature agree to within the experimental error with the data of Pact et al. (1962)
Was the Narrow Line Seyfert 1 RGB J0044+193 ever radio loud?
Maccarone, T.J.; Miller-Jones, J.C.A.; Fender, R.P.; Pooley, G.G.
2005-01-01
We show new radio data and a re-analysis of old data for the Narrow Line Seyfert 1 (NLSy1) galaxy RGB J0044+193. This galaxy has previously been suggested to be both radio loud, and highly variable in the radio. As most NLSy 1 galaxies are radio quiet, this was interpreted as possible evidence that
15 CFR 19.3 - Do these regulations adopt the Federal Claims Collection Standards (FCCS)?
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Do these regulations adopt the Federal... of Commerce COMMERCE DEBT COLLECTION General Provisions § 19.3 Do these regulations adopt the Federal Claims Collection Standards (FCCS)? This Part adopts and incorporates all provisions of the FCCS. This...
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
A laser photofragmentation time-of-flight mass spectrometric study of acetophenone at 193 and 248 nm
Zhao, H.-Q.; Cheung, Y.-S.; Liao, C.-L.; Liao, C.-X.; Ng, C. Y.; Li, Wai-Kee
1997-11-01
The photodissociation of acetophenone (C6H5COCH3) at 193 and 248 nm has been studied using the time-of-flight mass spectrometric technique. For hν=193 nm, two major primary channels, C6H5COCH3+hν→C6H5CO+CH3 [channel (1)] and C6H5+CH3CO [channel (2)], are observed with comparable cross sections. Data analysis shows that ≈30%-50% of primary C6H5CO and CH3CO radicals further decomposes, yielding secondary products C6H5+CO and CH3+CO, respectively. The translational energy release measurements indicate that for both channels (1) and (2) at 193 nm, ≈25%-30% of the available energy is channeled into kinetic energies of the primary photofragments. Measurements at hν=248 nm reveal that the branching ratio of channel (2) to channel (1) is ≈0.01. For channel (1) at hν=248 nm, ≈42% of the available energy is directed as the kinetic energy of the photofragments. The observed maximum kinetic energy release for channel (1) at 248 nm yields a value of 85.0±2.2 kcal/mol for the C6H5CO-CH3 bond dissociation energy at 0 K (D0). The photofragment angular distributions are found to be isotropic for both channels (1) and (2) at hν=193 nm and for channel (1) at hν=248 nm. A minor photodissociation channel C6H5COCH3+hν→C6H5CH3+CO is identified at both hν=193 and 248 nm. The energetics for the dissociation reactions of acetophenone have also been investigated using ab initio Gaussian-2-type procedures. The heats of formation at 0 K (ΔfH°0) for C6H5CO and C6H5 calculated using the isodesmic reaction scheme are 33.9±1.3 and 87.6±1.0 kcal/mol, respectively. These results suggest that the literature ΔfH°0 values for C6H5CO and C6H5 are likely to be low by 3-4 kcal/mol. These theoretical ΔfH° values for C6H5CO and C6H5 yield a theoretical D0(C6H5CO-CH3) value of 85.1±1.4 kcal/mol, which is in excellent accord with the experimental results obtained in the present study.
Test of supersymmetry in the 193Ir→194Pt proton stripping reactions
International Nuclear Information System (INIS)
Vergnes, M.; Rotbard, G.; Kalifa, J.; Berrier-Ronsin, G.; Vernotte, J.; Seltz, R.; Burke, D.G.
1980-01-01
A breakdown of the selection rules of the supersymmetry model is observed for the population of the 0 2 + and 2 2 + levels of 194 Pt in the 193 Ir → 194 Pt proton stripping reactions performed using the Orsay and Mc Master University tandem accelerators. The existence of other violations in the neighbouring nuclei leads to believe that we are seeing the limitations of the supersymmetry scheme itself, at least for particle transfer reactions
Enhanced Human-Type Receptor Binding by Ferret-Transmissible H5N1 with a K193T Mutation.
Peng, Wenjie; Bouwman, Kim M; McBride, Ryan; Grant, Oliver C; Woods, Robert J; Verheije, Monique H; Paulson, James C; de Vries, Robert P
2018-05-15
All human influenza pandemics have originated from avian influenza viruses. Although multiple changes are needed for an avian virus to be able to transmit between humans, binding to human-type receptors is essential. Several research groups have reported mutations in H5N1 viruses that exhibit specificity for human-type receptors and promote respiratory droplet transmission between ferrets. Upon detailed analysis, we have found that these mutants exhibit significant differences in fine receptor specificity compared to human H1N1 and H3N2 and retain avian-type receptor binding. We have recently shown that human influenza viruses preferentially bind to α2-6-sialylated branched N-linked glycans, where the sialic acids on each branch can bind to receptor sites on two protomers of the same hemagglutinin (HA) trimer. In this binding mode, the glycan projects over the 190 helix at the top of the receptor-binding pocket, which in H5N1 would create a stearic clash with lysine at position 193. Thus, we hypothesized that a K193T mutation would improve binding to branched N-linked receptors. Indeed, the addition of the K193T mutation to the H5 HA of a respiratory-droplet-transmissible virus dramatically improves both binding to human trachea epithelial cells and specificity for extended α2-6-sialylated N-linked glycans recognized by human influenza viruses. IMPORTANCE Infections by avian H5N1 viruses are associated with a high mortality rate in several species, including humans. Fortunately, H5N1 viruses do not transmit between humans because they do not bind to human-type receptors. In 2012, three seminal papers have shown how these viruses can be engineered to transmit between ferrets, the human model for influenza virus infection. Receptor binding, among others, was changed, and the viruses now bind to human-type receptors. Receptor specificity was still markedly different compared to that of human influenza viruses. Here we report an additional mutation in ferret
International Nuclear Information System (INIS)
Gurzadyan, G.G.; Goerner, H.
1994-01-01
Photoreactions, such as base release and decomposition of the base moeity, induced by either 20 ns laser pulses at 193 nm or continuous 254 nm irradiation, were studied for a series of uracil and adenine derivatives in neutral aqueous solution. The quantum yield of chromophore loss (Φ cl ) depends significantly on the nature of the nucleic acid constituent and the saturating gas (Ar, N 2 O or O 2 ). In the case of polynucleotides the destruction of nucleotides was measured by high-performance liquid chromatography after hydrolysis; the quantum yields (Φ dn ) are comparable to those of chromophore loss or larger. The Φ cl and Φ dn of 0.04-0.1 for poly(U) and poly(dU), obtained for both wavelengths of irradiation, are due to processes originating from the lowest excited singlet state, i.e. formation of photohydrates and photodimers, and a second part from photoionization using λ irr = 193 nm. Irradiation at 193 nm effectively splits pyrimidine dimers and thus reverts them into monomers. (author)
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
Three-body dissociations: The photodissociation of dimethyl sulfoxide at 193 nm
International Nuclear Information System (INIS)
Blank, D.A.; North, S.W.; Stranges, D.
1997-01-01
When a molecule with two equivalent chemical bonds is excited above the threshold for dissociation of both bonds, how the rupture of the two bonds is temporally coupled becomes a salient question. Following absorption at 193 nm dimethyl sulfoxide (CH 3 SOCH 3 ) contains enough energy to rupture both C-S bonds. This can happen in a stepwise (reaction 1) or concerted (reaction 2) fashion where the authors use rotation of the SOCH 3 intermediate prior to dissociation to define a stepwise dissociation: (1) CH 3 SOCH 3 → 2CH 3 + SO; (2a) CH 3 SOCH 3 → CH 3 + SOCH 3 ; and (2b) SOCH 3 → SO + CH 3 . Recently, the dissociation of dimethyl sulfoxide following absorption at 193 nm was suggested to involve simultaneous cleavage of both C-S bonds on an excited electronic surface. This conclusion was inferred from laser induced fluorescence (LIF) and resonant multiphoton ionization (2+1 REMPI) measurements of the internal energy content in the CH 3 and SO photoproducts and a near unity quantum yield measured for SO. Since this type of concerted three body dissociation is very interesting and a rather rare event in photodissociation dynamics, the authors chose to investigate this system using the technique of photofragment translational spectroscopy at beamline 9.0.2.1. The soft photoionization provided by the VUV undulator radiation allowed the authors to probe the SOCH 3 intermediate which had not been previously observed and provided good evidence that the dissociation of dimethyl sulfoxide primarily proceeds via a two step dissociation, reaction 2
Kerkar, Nanda; Choudhuri, Kaushik; Ma, Yun; Mahmoud, Ayman; Bogdanos, Dimitrios P; Muratori, Luigi; Bianchi, Francesco; Williams, Roger; Mieli-Vergani, Giorgina; Vergani, Diego
2003-02-01
Cytochrome P4502D6 (CYP2D6), target of liver kidney microsomal autoantibody type 1 (LKM1), characterizes autoimmune hepatitis type 2 (AIH2) but is also found in patients with chronic hepatitis C virus (HCV) infection. To provide a complete linear epitope B cell map of CYP2D6, we tested peptides spanning the entire sequence of CYP2D6. In addition to confirming previously described antigenic sites, we identified four new epitopes (193-212, 238-257, 268-287, and 478-497). CYP2D6(193-212) is immunodominant and was the target of 12 of 13 (93%) patients with AIH2 and 5 of 10 (50%) HCV/LKM1-positive patients. Because LKM1 is present in both AIH2 and a viral infection, we tested whether Abs to CYP2D6(193-212) arise through cross-reactive immunity between virus and self. We identified a hexameric sequence "RLLDLA" sharing 5 of 6 aa with "RLLDLS" of HCV(2985-2990) and all 6 aa with CMV(130-135). Of 17 CYP2D6(193-212)-reactive sera, 11 (7 AIH and 4 HCV) reacted by ELISA with the HCV homologue, 8 (5 AIH and 3 HCV) with the CMV homologue, and 8 (5 AIH and 3 HCV) showed double reactivity. Autoantibody binding to CYP2D6(193-212) was inhibited by preincubation with HCV(2977-2996) or CMV(121-140). Recombinant HCV-nonstructural protein 5 and CMV-UL98 proteins also inhibited Ab binding to CYP2D6(193-212). Affinity-purified CYP2D6(193-212)-specific Ab inhibited the metabolic activity of CYP2D6. The demonstrated similarity and cross-reactivity between CYP2D6(193-212) and two unrelated viruses suggests that multiple exposure to viruses mimicking self may represent an important pathway to the development of autoimmunity.
Mennen, I.A.M.
2010-01-01
This study defines changing power and status relations between the highest ranking representatives of Roman imperial power at the central level, particularly in a period when the central level came under tremendous pressure, AD 193-284. Prosopography has been used as the principal method for
International Nuclear Information System (INIS)
Titus, M J; Graves, D B; Yamaguchi, Y; Hudson, E A
2011-01-01
We present a comparison of patterned 193 nm photoresist (PR) line width roughness (LWR) of samples processed in a well characterized argon (Ar) inductively coupled plasma (ICP) system to RMS surface roughness and bulk chemical modification of blanket 193 nm PR samples used as control samples. In the ICP system, patterned and blanket PR samples are irradiated with Ar vacuum ultraviolet photons (VUV) and Ar ions while sample temperature, photon flux, ion flux and ion energy are controlled and measured. The resulting chemical modifications to bulk 193 nm PR (blanket) and surface roughness are analysed with Fourier transform infrared spectroscopy and atomic force microscopy (AFM). LWR of patterned samples are measured with scanning electron microscopy and blanket portions of the patterned PRs are measured with AFM. We demonstrate that with no RF-bias applied to the substrate the LWR of 193 nm PR tends to smooth and correlates with the smoothing of the RMS surface roughness. However, both LWR and RMS surface roughness increases with simultaneous high-energy (≥70 eV) ion bombardment and VUV-irradiation and is a function of exposure time. Both high- and low-frequency LWR correlate well with the RMS surface roughness of the patterned and blanket 193 nm PR samples. LWR, however, does not increase with temperatures ranging from 20 to 80 deg. C, in contrast to the RMS surface roughness which increases monotonically with temperature. It is unclear why LWR remains independent of temperature over this range. However, the fact that blanket roughness and LWR on patterned samples, both scale similarly with VUV fluence and ion energy suggests a similar mechanism is responsible for both types of surface morphology modifications.
Energy Technology Data Exchange (ETDEWEB)
Titus, M J; Graves, D B [Department of Chemical Engineering, University of California, Berkeley, CA 94720 (United States); Yamaguchi, Y; Hudson, E A, E-mail: graves@berkeley.edu [Lam Research Corporation, 4400 Cushing Parkway, Freemont, CA 94538 (United States)
2011-03-02
We present a comparison of patterned 193 nm photoresist (PR) line width roughness (LWR) of samples processed in a well characterized argon (Ar) inductively coupled plasma (ICP) system to RMS surface roughness and bulk chemical modification of blanket 193 nm PR samples used as control samples. In the ICP system, patterned and blanket PR samples are irradiated with Ar vacuum ultraviolet photons (VUV) and Ar ions while sample temperature, photon flux, ion flux and ion energy are controlled and measured. The resulting chemical modifications to bulk 193 nm PR (blanket) and surface roughness are analysed with Fourier transform infrared spectroscopy and atomic force microscopy (AFM). LWR of patterned samples are measured with scanning electron microscopy and blanket portions of the patterned PRs are measured with AFM. We demonstrate that with no RF-bias applied to the substrate the LWR of 193 nm PR tends to smooth and correlates with the smoothing of the RMS surface roughness. However, both LWR and RMS surface roughness increases with simultaneous high-energy ({>=}70 eV) ion bombardment and VUV-irradiation and is a function of exposure time. Both high- and low-frequency LWR correlate well with the RMS surface roughness of the patterned and blanket 193 nm PR samples. LWR, however, does not increase with temperatures ranging from 20 to 80 deg. C, in contrast to the RMS surface roughness which increases monotonically with temperature. It is unclear why LWR remains independent of temperature over this range. However, the fact that blanket roughness and LWR on patterned samples, both scale similarly with VUV fluence and ion energy suggests a similar mechanism is responsible for both types of surface morphology modifications.
Three-body dissociations: The photodissociation of dimethyl sulfoxide at 193 nm
Energy Technology Data Exchange (ETDEWEB)
Blank, D.A.; North, S.W.; Stranges, D. [Lawrence Berkeley National Lab., CA (United States)] [and others
1997-04-01
When a molecule with two equivalent chemical bonds is excited above the threshold for dissociation of both bonds, how the rupture of the two bonds is temporally coupled becomes a salient question. Following absorption at 193 nm dimethyl sulfoxide (CH{sub 3}SOCH{sub 3}) contains enough energy to rupture both C-S bonds. This can happen in a stepwise (reaction 1) or concerted (reaction 2) fashion where the authors use rotation of the SOCH{sub 3} intermediate prior to dissociation to define a stepwise dissociation: (1) CH{sub 3}SOCH{sub 3} {r_arrow} 2CH{sub 3} + SO; (2a) CH{sub 3}SOCH{sub 3} {r_arrow} CH{sub 3} + SOCH{sub 3}; and (2b) SOCH{sub 3} {r_arrow} SO + CH{sub 3}. Recently, the dissociation of dimethyl sulfoxide following absorption at 193 nm was suggested to involve simultaneous cleavage of both C-S bonds on an excited electronic surface. This conclusion was inferred from laser induced fluorescence (LIF) and resonant multiphoton ionization (2+1 REMPI) measurements of the internal energy content in the CH{sub 3} and SO photoproducts and a near unity quantum yield measured for SO. Since this type of concerted three body dissociation is very interesting and a rather rare event in photodissociation dynamics, the authors chose to investigate this system using the technique of photofragment translational spectroscopy at beamline 9.0.2.1. The soft photoionization provided by the VUV undulator radiation allowed the authors to probe the SOCH{sub 3} intermediate which had not been previously observed and provided good evidence that the dissociation of dimethyl sulfoxide primarily proceeds via a two step dissociation, reaction 2.
14 CFR 193.7 - What does it mean for the FAA to designate information as protected?
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false What does it mean for the FAA to designate... INFORMATION § 193.7 What does it mean for the FAA to designate information as protected? (a) General. When the FAA issues an order designating information as protected under this part, the FAA does not disclose...
Laser ablation of nanoscale particles with 193 nm light
International Nuclear Information System (INIS)
Choi, J H; Lucas, D; Koshland, C P
2007-01-01
Laser interaction with nanoscale particles is distinct and different from laser-bulk material interaction, where a hot plasma is normally created. Here, we review our studies on 193 nm laser ablation of various nanoscale particles including NaCl, soot, polystyrene, and gold. The 20 ns laser beam with fluences up to 0.3 J/cm 2 irradiates nanoparticles in a gas stream at laser repetition rates from 10 to 100 Hz. The particle size distributions before and after irradiation are measured with a scanning mobility particle sizer (SMPS), and particle morphology is examined with electron microscopy. All the nanomaterials studied exhibit a similar disintegration pattern and similar particle formation characteristics. No broadband emission associated with particle heating or optical breakdown is observed. The nanoparticles formed after irradiation have a smaller mean diameter and an order of magnitude higher number concentration with a more spherical shape compared to the original particles. We use the photon-atom ratio (PAR) to interpret the laser-particle interaction energetics
[Cleavage of DNA fragments induced by UV nanosecond laser excitation at 193 nm].
Vtiurina, N N; Grokhovskiĭ, S L; Filimonov, I V; Medvedkov, O I; Nechipurenko, D Iu; Vasil'ev, S A; Nechipurenko, Iu D
2011-01-01
The cleavage of dsDNA fragments in aqueous solution after irradiation with UV laser pulses at 193 nm has been studied. Samples were investigated using polyacrylamide gel electrophoresis. The intensity of damage of particular phosphodiester bond after hot alkali treatment was shown to depend on the base pair sequence. It was established that the probability of cleavage is twice higher for sites of DNA containing two or more successively running guanine residues. A possible mechanism of damage to the DNA molecule connected with the migration of holes along the helix is discussed.
Research development of thermal aberration in 193nm lithography exposure system
Wang, Yueqiang; Liu, Yong
2014-08-01
Lithographic exposure is the key process in the manufacture of the integrated circuit, and the performance of exposure system decides the level of microelectronic manufacture technology. Nowadays, the 193nm ArF immersion exposure tool is widely used by the IC manufacturer. With the uniformity of critical dimension (CDU) and overlay become tighter and the requirement for throughput become higher, the thermal aberration caused by lens material and structure absorbing the laser energy cannot be neglected. In this paper, we introduce the efforts and methods that researcher on thermal aberration and its control. Further, these methods were compared to show their own pros and cons. Finally we investigated the challenges of thermal aberration control for state of the art technologies.
Technology of focus detection for 193nm projection lithographic tool
Di, Chengliang; Yan, Wei; Hu, Song; Xu, Feng; Li, Jinglong
2012-10-01
With the shortening printing wavelength and increasing numerical aperture of lithographic tool, the depth of focus(DOF) sees a rapidly drop down trend, reach a scale of several hundred nanometers while the repeatable accuracy of focusing and leveling must be one-tenth of DOF, approximately several dozen nanometers. For this feature, this article first introduces several focusing technology, Obtained the advantages and disadvantages of various methods by comparing. Then get the accuracy of dual-grating focusing method through theoretical calculation. And the dual-grating focusing method based on photoelastic modulation is divided into coarse focusing and precise focusing method to analyze, establishing image processing model of coarse focusing and photoelastic modulation model of accurate focusing. Finally, focusing algorithm is simulated with MATLAB. In conclusion dual-grating focusing method shows high precision, high efficiency and non-contact measurement of the focal plane, meeting the demands of focusing in 193nm projection lithography.
Photodissociation dynamics of 1-propanol and 2-propanol at 193.3 nm
International Nuclear Information System (INIS)
Zhou Weidong; Yuan Yan; Zhang Jingsong
2003-01-01
193.3-nm photodissociation dynamics of jet-cooled 1-propanol and 2-propanol and their partially deuterated variants are examined by using the high-n Rydberg-atom time-of-flight technique. Isotope labeling studies show that O-H bond fission is the primary H-atom production channel in the ultraviolet photodissociation of both 1-propanol and 2-propanol. Center-of-mass (c.m.) product translational energy release of the RO-H dissociation channel is large, with T >=0.78 for H+1-propoxy (n-propoxy) and 0.79 for H+2-propoxy (isoproxy). Maximum c.m. translational energy release yields an upper limit of the O-H bond dissociation energy: 433±2 kJ/mol in 1-propanol and 435±2 kJ/mol in 2-propanol. H-atom product angular distribution is anisotropic (with β≅-0.79 for 1-propanol and -0.77 for 2-propanol), suggesting an electronic transition moment perpendicular to the H-O-C plane and a short excited-state dissociation lifetime (less than a rotational period). Information about photodissociation dynamics and bond energies of the partially deuterated propanols are also obtained. The 193.3-nm photodissociation dynamics of 1-propanol and 2-propanol are nearly identical to each other and are similar to those of methanol and ethanol. This indicates a common RO-H dissociation mechanism: after the n O →σ * (O-H)/3s excitation localized on the H-O-C moiety, the H atom is ejected promptly in the H-O-C plane in a time scale shorter than a rotational period of the parent molecule, and it dissociates along the O-H coordinate on the repulsive excited-state potential-energy surface with a large translational energy release
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Will the FAA ever disclose information that... VOLUNTARILY SUBMITTED INFORMATION § 193.9 Will the FAA ever disclose information that is designated as protected under this part? The FAA discloses information that is designated as protected under this part...
Directory of Open Access Journals (Sweden)
Gökçe Güllü
2015-03-01
Full Text Available The functional role of IGFBP5 in breast cancer is complicated. Experimental and bioinformatics studies have shown that IGFBP5 is targeted by miR-140-5p and miR-193b, although this has not yet been proven in clinical samples. The aim of this study was to evaluate the expression of miR-140-5p and miR-193b in breast cancer and adjacent normal tissue and assess its correlation with IGFBP5 and the clinicopathological characteristics of the tumors. IGFBP5 protein expression was analyzed immunohistochemically and IGFBP5, miR-140 and miR-193b mRNA expression levels were analyzed with real-time RT-PCR. Tumor tissue had higher miR-140-5p expression than adjacent normal tissue (p = 0.015. Samples with no immunohistochemical staining for IGFBP5 showed increased miR-140-5p expression (p = 0.009. miR-140-5p expression was elevated in invasive ductal carcinomas (p = 0.002, whereas basal-like tumors had decreased expression of miR-140-5p compared to other tumors (p = 0.008. Lymph node-positive samples showed an approximately 13-fold increase in miR-140-5p expression compared to lymph node-negative tissue (p = 0.049. These findings suggest that miR-140-5p, but not miR-193b, could be an important determinant of IGFBP5 expression and clinical phenotype in breast cancer patients. Further studies are needed to clarify the expressional regulation of IGFBP5 by miR-140-5p.
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
Hassink, R. J.; Nakajima, H.; Nakajima, H. O.; Doevendans, P. A.; Field, L. J.
2009-01-01
Background: Transgenic mice expressing the dominant interfering p193 protein in cardiomyocytes (MHC-1152stop mice) exhibit an induction of cell cycle activity and altered remodelling after experimental myocardial infarction (MI). Objective: To determine whether the altered remodelling results in
Lin, Cheng-ming; Chang, Keh-wen; Lee, Ming-der; Loong, Wen-An
1999-07-01
Abstract-Five materials which are PdSixOy, CrAlxOy, SiNx, TiSixNy, and TiSixOyNz as absorptive shifters for attenuated phase-shifting mask in 193 nm wavelength lithography are presented. PdSixOy films were deposited by dual e-gun evaporation. CrAlxOy, TiSixNy and TiSixOyNz films were formed by plasma sputtering and SiNx films were formed with LPCVD. All of these materials are shown to be capable of achieving 4 percent - 15 percent transmittance in 193 nm with thickness that produce a 180 degrees phase shift. Under BCl3:Cl2 equals 14:70 sccm; chamber pressure 5 mtorr and RF power 1900W, the dry etching selectivity of TiSixNy over DQN positive resist and fused silica, were found to be 2:1 and 4,8:1 respectively. An embedded layer TiSixNy with 0.5 micrometers line/space was successfully patterned.
Energy Technology Data Exchange (ETDEWEB)
Harrison, Aaron W.; Ryazanov, Mikhail; Sullivan, Erin N.; Neumark, Daniel M., E-mail: dneumark@berkeley.edu [Department of Chemistry, University of California, Berkeley, California 94720, USA and Chemical Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)
2016-07-14
The photodissociation dynamics of the methyl perthiyl radical (CH{sub 3}SS) have been investigated using fast-beam coincidence translational spectroscopy. Methyl perthiyl radicals were produced by photodetachment of the CH{sub 3}SS{sup −} anion followed by photodissociation at 248 nm (5.0 eV) and 193 nm (6.4 eV). Photofragment mass distributions and translational energy distributions were measured at each dissociation wavelength. Experimental results show S atom loss as the dominant (96%) dissociation channel at 248 nm with a near parallel, anisotropic angular distribution and translational energy peaking near the maximal energy available to ground state CH{sub 3}S and S fragments, indicating that the dissociation occurs along a repulsive excited state. At 193 nm, S atom loss remains the major fragmentation channel, although S{sub 2} loss becomes more competitive and constitutes 32% of the fragmentation. The translational energy distributions for both channels are very broad at this wavelength, suggesting the formation of the S{sub 2} and S atom products in several excited electronic states.
International Nuclear Information System (INIS)
Mahmoud, S.S.; Mahmoud, A.A.
2004-01-01
Ultraviolet light (193 nm) produced by an excimer laser has been used to produce precise tissue ablation with minimal thermal damage to adjacent tissue. The present study was designed to investigate the effect of excimer laser during photo refractive keratectomy (PRK) on aqueous humor constituents and also the effect of antioxidant enzyme superoxide dismutase (SOD)- applied topically- on these changes if exist. Five groups of schenchilla rabbits were involved in this study, where four groups underwent corneal stromal ablation using argon fluoride excimer laser (Ar F, 193 nm). Two of these four groups were treated with superoxide dismutase intra operatively. The fifth group was used as control one. The obtained results revealed depletion of aqueous humor ascorbate and glutathione contents. Aqueous humor refractive index, cholesterol, phospholipids, malondialdehyde (MDA) and total protein were measured. In conclusion, the excimer laser can induce changes in aqueous humor constituents during PRK. These changes lasted at least for 24 hours and as the time increased to 4 weeks, these changes became limited. The use of exogenous SOD seems to exert beneficial effect on aqueous humor refractive index and total protein
International Nuclear Information System (INIS)
Gochelashvili, K S; Zemskov, M E; Evdokimova, O N; Mikhkel'soo, V T; Prokhorov, A M
1999-01-01
An excimer laser spectrometer was designed and constructed. It consists of a high-vacuum interaction chamber, a short-wavelength (λ = 193 nm) excimer ArF laser used for evaporation, a probe dye laser pumped by an XeCl excimer laser, and a system for recording a laser-induced fluorescence signal. This spectrometer was used to investigate nonthermal mechanisms of photoevaporation of a number of wide-gap dielectrics. (laser applications and other topics in quantum electronics)
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Taylor Creek, navigation lock (S-193) across the entrance to Taylor Creek at Lake Okeechobee, Okeechobee, Fla.; use, administration..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.170d Taylor Creek, navigation lock...
Directory of Open Access Journals (Sweden)
A. Essadik
2015-01-01
Full Text Available Polymorphisms in tumor necrosis factor alpha (TNF-α gene are emerging as key determinants of gastric diseases. The TNF-α−308 (G/A and TNF-α−238 (G/A single-nucleotide polymorphisms SNPs are the most extensively studied. However, all these studies are conducted in Caucasian and Asian populations. Thus, for the first time in Africa, we sought to investigate whether polymorphisms in TNF-α gene were associated with the development of gastric pathology in Morocco. Two SNPs located in the promoter region (positions −308 and −238 in TNF-α gene were genotyped in 244 individuals (170 patients and 74 healthy controls. Odds ratios (ORs and 95% confidence intervals (CI were estimated using logistic regression analysis. The TNF-α−238 (G/A genotype was significantly associated with a high risk of gastritis and gastric cancer (GC (P=0.001 and P=0.002, resp.. Furthermore, a new polymorphism located in the promoter region at position −193 in TNF-α gene was identified. The distribution of this SNP was markedly different in patients suffering from ulcers. The association between TNF-α−193 (G/A genotype and high risk of ulcer was significant (P=0.03. These results suggest that the TNF-α−193 (G/A allele has a protective function against gastric cancer by developing ulcer.
Peláez, R. J.; Afonso, C. N.; Bator, M.; Lippert, T.
2013-06-01
The aim of this work is to demonstrate that single-photon photoionization processes make a significant difference in the expansion and temperature of the plasma produced by laser ablation of ceramic Al2O3 in vacuum as well as to show their consequences in the kinetic energy distribution of the species that eventually will impact on the film properties produced by pulsed laser deposition. This work compares results obtained by mass spectrometry and optical spectroscopy on the composition and features of the plasma produced by laser ablation at 193 nm and 248 nm, i.e., photon energies that are, respectively, above and below the ionization potential of Al, and for fluences between threshold for visible plasma and up to ≈2 times higher. The results show that the ionic composition and excitation of the plasma as well as the ion kinetic energies are much higher at 193 nm than at 248 nm and, in the latter case, the population of excited ions is even negligible. The comparison of Maxwell-Boltzmann temperature, electron temperatures, and densities of the plasmas produced with the two laser wavelengths suggests that the expansion of the plasma produced at 248 nm is dominated by a single population. Instead, the one produced at 193 nm is consistent with the existence of two populations of cold and hot species, the latter associated to Al+ ions that travel at the forefront and produced by single photon ionization as well as Al neutrals and double ionized ions produced by electron-ion impact. The results also show that the most energetic Al neutrals in the plasma produced at the two studied wavelengths are in the ground state.
DEFF Research Database (Denmark)
Barco, Lisa; Ramon, Elena; Cortini, Enzo
2014-01-01
Abstract Salmonella enterica subsp. enterica serovar 4,[5],12:i:- DT193 is recognized as an emerging monophasic variant of Salmonella Typhimurium in many European countries. Resistance to ampicillin, streptomycin, sulphonamides, and tetracycline (R-type ASSuT) is described as one of the most comm...
International Nuclear Information System (INIS)
Blank, D.A.; Suits, A.G.; Lee, Y.T.
1997-01-01
Ethylene and its substituted analogues (H 2 CCHX) are important molecules in hydrogen combustion. As the simplest π-bonded hydrocarbons these molecules serve as prototypical systems for understanding the decomposition of this important class of compounds. The authors have used the technique of photofragment translational spectroscopy at beamline 9.0.2.1 to investigate the dissociation of vinyl chloride (X=Cl) and acrylonitrile (X=CN) following absorption at 193 nm. The technique uses a molecular beam of the reactant seeded in helium which is crossed at 90 degrees with the output of an excimer laser operating on the ArF transition, 193.3 nm. The neutral photoproducts which recoil out of the molecular beam travel 15.1 cm where they are photoionized by the VUV undulator radiation, mass selected, and counted as a function of time. The molecular beam source is rotatable about the axis of the dissociation laser. The authors have directly observed all four of the following dissociation channels for both systems: (1) H 2 CCHX → H + C 2 H 2 X; (2) H 2 CCHX → X + C 2 H 3 ; (3) H 2 CCHX → H 2 + C 2 HX; and (4) H 2 CCHX → HX + C 2 H 2 . They measured translational energy distributions for all of the observed channels and measured the photoionization onset for many of the photoproducts which provided information about their chemical identity and internal energy content. In the case of acrylonitrile, selective product photoionization provided the ability to discriminate between channels 2 and 4 which result in the same product mass combination
Understanding dissolution behavior of 193nm photoresists in organic solvent developers
Lee, Seung-Hyun; Park, Jong Keun; Cardolaccia, Thomas; Sun, Jibin; Andes, Cecily; O'Connell, Kathleen; Barclay, George G.
2012-03-01
Herein, we investigate the dissolution behavior of 193-nm chemically amplified resist in different organic solvents at a mechanistic level. We previously reported the effect of solvent developers on the negative tone development (NTD) process in both dry and immersion lithography, and demonstrated various resist performance parameters such as photospeed, critical dimension uniformity, and dissolution rate contrast are strongly affected by chemical nature of the organic developer. We further pursued the investigation by examining the dependence of resist dissolution behavior on their solubility properties using Hansen Solubility Parameter (HSP). The effects of monomer structure, and resist composition, and the effects of different developer chemistry on dissolution behaviors were evaluated by using laser interferometry and quartz crystal microbalance. We have found that dissolution behaviors of methacrylate based resists are significantly different in different organic solvent developers such as OSDTM-1000 Developer* and n-butyl acetate (nBA), affecting their resist performance. This study reveals that understanding the resist dissolution behavior helps to design robust NTD materials for higher resolution imaging.
Semiconductor-based narrow-line and high-brilliance 193-nm laser system for industrial applications
Opalevs, D.; Scholz, M.; Stuhler, J.; Gilfert, C.; Liu, L. J.; Wang, X. Y.; Vetter, A.; Kirner, R.; Scharf, T.; Noell, W.; Rockstuhl, C.; Li, R. K.; Chen, C. T.; Voelkel, R.; Leisching, P.
2018-02-01
We present a novel industrial-grade prototype version of a continuous-wave 193 nm laser system entirely based on solid state pump laser technology. Deep-ultraviolet emission is realized by frequency-quadrupling an amplified diode laser and up to 20 mW of optical power were generated using the nonlinear crystal KBBF. We demonstrate the lifetime of the laser system for different output power levels and environmental conditions. The high stability of our setup was proven in > 500 h measurements on a single spot, a crystal shifter multiplies the lifetime to match industrial requirements. This laser improves the relative intensity noise, brilliance, wall-plug efficiency and maintenance cost significantly. We discuss first lithographic experiments making use of this improvement in photon efficiency.
International Nuclear Information System (INIS)
Quaia, Emilio; Krug, Lee M.; Pandit-Taskar, Neeta; Nagel, Andrew; Reuter, Victor E.; Humm, John; Divgi, Chaitanya
2008-01-01
Aim: To assess the value of data set coregistration of gamma camera and computed tomography (CT) in the assessment of targeting of humanized monoclonal antibody 3S193 labeled with indium-111 ( 111 In-hu3S193) to small cell lung cancer (SCLC). Methods and materials: Ten patients (6 male and 4 female; mean age ± S.D., 60 ± 4 years), from an overall population of 20 patients with SCLCs expressing Lewis Y antigen at immunohistochemical analysis, completed a four weekly injections of 111 In-hu3S193 and underwent gamma camera imaging. All had had, as part of their baseline evaluation, Fluorine18 fluoro-2-deoxyglucose (FDG) positron emission tomography/computed tomography (PET/CT). Two readers in consensus retrospectively coregistered the gamma camera images with the CT component of the FDG PET/CT by automatic or manual alignment. The resulting image sets were visually examined and SCLC lesions targeting at coregistered gamma camera and CT was correlated side-by-side with the 18 F-FDG uptake. Results: A total number of 31 lesions from SCLC with a thoracic (n = 13) or extrathoracic location (n = 18) were all positive on FDG PET/CT. Coregistration of the gamma camera to the CT demonstrated targeting of antibody to all lesions >2 cm (n = 20) and in a few lesions ≤2 cm (n = 2), with no visualization of most lesions ≤2 cm (n = 9). No 111 In-hu3S193 uptake in normal tissues was observed. Conclusion: Coregistration of antibody gamma camera imaging to FDG PET/CT is feasible and allows valuable assessment of 111 In-hu3S193 antibody targeting to SCLC lesions >2 cm, while lesions ≤2 cm reveal a limited targeting
Energy Technology Data Exchange (ETDEWEB)
Blank, D.A.; Suits, A.G.; Lee, Y.T. [Lawrence Berkeley National Lab., CA (United States)] [and others
1997-04-01
Ethylene and its substituted analogues (H{sub 2}CCHX) are important molecules in hydrogen combustion. As the simplest {pi}-bonded hydrocarbons these molecules serve as prototypical systems for understanding the decomposition of this important class of compounds. The authors have used the technique of photofragment translational spectroscopy at beamline 9.0.2.1 to investigate the dissociation of vinyl chloride (X=Cl) and acrylonitrile (X=CN) following absorption at 193 nm. The technique uses a molecular beam of the reactant seeded in helium which is crossed at 90 degrees with the output of an excimer laser operating on the ArF transition, 193.3 nm. The neutral photoproducts which recoil out of the molecular beam travel 15.1 cm where they are photoionized by the VUV undulator radiation, mass selected, and counted as a function of time. The molecular beam source is rotatable about the axis of the dissociation laser. The authors have directly observed all four of the following dissociation channels for both systems: (1) H{sub 2}CCHX {r_arrow} H + C{sub 2}H{sub 2}X; (2) H{sub 2}CCHX {r_arrow} X + C{sub 2}H{sub 3}; (3) H{sub 2}CCHX {r_arrow} H{sub 2} + C{sub 2}HX; and (4) H{sub 2}CCHX {r_arrow} HX + C{sub 2}H{sub 2}. They measured translational energy distributions for all of the observed channels and measured the photoionization onset for many of the photoproducts which provided information about their chemical identity and internal energy content. In the case of acrylonitrile, selective product photoionization provided the ability to discriminate between channels 2 and 4 which result in the same product mass combination.
Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV
Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.
2017-09-01
Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.
Energy Technology Data Exchange (ETDEWEB)
Hilgers, K.
2005-12-15
New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
Fabrication of biosynthetic vascular prostheses by 193-nm excimer laser radiation
Husinsky, Wolfgang; Csek, Ch.; Bartel, A.; Grabenwoeger, M.; Fitzal, F.; Wolner, Ernst
1998-05-01
This study was undertaken to investigate the feasibility of transmural capillary ingrowth into the inner surface of biosynthetic vascular prostheses (OmniflowTM) through perforations created by an excimer-laser, thus inducing an endothelial cell coverage. The biosynthetic vascular prostheses (10 cm length, 6 mm (phi) ) were perforated with an excimer laser ((phi) of the holes 50 - 100 micrometer, distance 4 mm) and implanted into the carotid arteries of 8 sheep. The laser tissue interaction process of 193 nm radiation ensures minimal thermal damage to the prostheses. They were compared to untreated OmniflowTM prostheses implanted at the contralateral side. Three months after implantation the prostheses were explanted and evaluated by gross morphology, histological examination and scanning electron microscopy. Scanning electron microscopy showed endothelial cells in the midgraft portion of all perforated prostheses, whereas collagen fibers, fibrin meshwork and activated platelets formed the inner layer in 6 out of 8 untreated OmniflowTM prostheses. It can be concluded, that spontaneous endothelialization of biosynthetic vascular prostheses can be achieved by transmural capillary ingrowth through perforations in the wall of the prostheses in an experimental sheep model.
Product channels in the 193-nm photodissociation of HCNO (fulminic acid)
Energy Technology Data Exchange (ETDEWEB)
Feng, Wenhui; Hershberger, John F., E-mail: john.hershberger@ndsu.edu
2016-06-15
IR diode laser spectroscopy was used to detect the products of HCNO (fulminic acid) photolysis at 193 nm. Six product channels are energetically possible at this photolysis wavelength: O + HCN, H + NCO/CNO, CN + OH, CO + NH, NO + CH and HNCO. In some experiments, isotopically labeled {sup 15}N{sup 18}O, C{sub 2}D{sub 6} or C{sub 6}H{sub 12} reagents were included into the photolysis mixture in order to suppress and/or redirect possible secondary reactions. HCN, OC{sup 18}O, {sup 15}N{sup 15}NO, CO, DCN and HNCO molecules were detected upon laser photolysis of HCNO/reagents/buffer gas mixtures. Analysis of the yields of product molecules leads to the following photolysis quantum yields: ϕ{sub 1a} (O + HCN) = 0.38 ± 0.04, ϕ{sub 1b} (H + (NCO)) = 0.07 ± 0.02, ϕ{sub 1c} (CN + OH) = 0.24 ± 0.03, ϕ{sub 1d} (CO + NH(a{sup 1}Δ)) < 0.22 ± 0.1, ϕ{sub 1e} (HNCO) = 0.02 ± 0.01 and ϕ{sub 1f} (CH + NO) = 0.21 ± 0.1, respectively.
International Nuclear Information System (INIS)
Ducroux, L.
1997-01-01
This work is devoted to the search and analysis of superdeformed and oblate states in 193 Pb nucleus. High spin states of this isotope, populated via fusion-evaporation reaction 168 Er ( 30 Si, 5n) 193 Pb, have been studied with the EUROGAM II γ multidetector array located near the VIVITRON accelerator in Strasbourg. New sorting and analysis programs have been developed in particular related to the background treatment. Angular distribution and linear polarisation analysis allowed us to assign the γ transition multipolarities. Five dipole bands, corresponding to a weakly oblate-deformed shape of the nucleus, have been observed and connected to the low-lying states. The level scheme has been considerably extended up to a spin of 61/2 ℎ and an excitation energy of about 8 MeV. These structures have been interpreted as based on a high-K two-quasi-proton excitation coupled to rotation aligned quasi-neutrons. Six superdeformed bands, corresponding to a high prolate-deformed shape of the nucleus, have been observed. These six bands have been interpreted as three pairs of signature partners based on quasineutron excitations. The extraction of the g-factor of a K=9/2 neutron superdeformed orbital has been done for the first time in lead isotopes, giving access to the magnetic properties of the extreme nuclear matter. All these results have been discussed in terms of microscopic mean field self-consistent Hartree-Fock calculations using the microscopic 'rotor + particle(s)' model. (author)
Oblate L = 1 bands in 194,196-201Pb, and 193Hg
International Nuclear Information System (INIS)
Becker, J.A.; Kuhnert, A.; Stoyer, M.A.; Brinkman, M.J.; Wang, T.F.; Roy, N.; Cizewski, J.A.; Stephens, F.S.; Deleplanque, M.A.; Diamond, R.M.; Azaiez, F.; Macchiavelli, A.O.; Korten, W.; Draper, J.E.; California Univ., Berkeley, CA
1992-11-01
Reports of recent experiments have included observations of regular and irregular bands in neutron deficient Pb isotopes with A=194, 196--201. The bands are populated strongly in HI,xn reactions. The shared characteristics of the bands include: (1) Bandhead energies of few MeV; (2) High bandhead spin; (3) Large alignments; (4) Small dynamic moments of inertia, and (5) Strong L = 1 transitions and weaker L = 2 crossover transitions, with B(Ml/B(E2)) ∼ 20 μ 2 /e 2 b 2 . Lifetimes of band members in the 198 Pb regular band are B(Ml) ∼ 1 W.u., and B(E2) ∼ 10 W.u. (with large errors). These observations are consistent with an interpretation of the regular structures as collective oblate bands with both proton and neutron excitations involved; the closed proton shell at Z = 82 is broken, and coupled to v(i l3/2 ) -n excitations. The irregular structures may correspond to triaxial shapes, with similar orbits involved. A similar structure has been also found in 193 Hg
Top-coatless 193nm positive-tone development immersion resist for logic application
Liu, Lian Cong; Yeh, Tsung Ju; Lin, Yeh-Sheng; Huang, Yu Chin; Kuo, Chien Wen; Huang, Wen Liang; Lin, Chia Hung; Yu, Chun Chi; Hsu, Ray; Wan, I.-Yuan; Lin, Jeff; Im, Kwang-Hwyi; Lim, Hae Jin; Jeon, Hyun K.; Suzuki, Yasuhiro; Xu, Cheng Bai
2015-03-01
In this paper, we summarize our development efforts for a top-coatless 193nm immersion positive tone development (PTD) contact hole (C/H) resist with improved litho and defect performances for logic application specifically with an advance node. The ultimate performance goal was to improve the depth of focus (DoF) margin, mask error enhancement factor (MEEF), critical dimension uniformity (CDU), contact edge roughness (CER), and defect performance. Also, the through pitch CD difference was supposed to be comparable to the previous control resist. Effects of polymer and PAG properties have been evaluated for this purpose. The material properties focused in the evaluation study were polymer activation energy (Ea), polymer solubility differentiated by polymerization process types, and diffusion length (DL) and acidity (pKa) of photoacid generator (PAG). Additionally, the impact of post exposure bake (PEB) temperature was investigated for process condition optimization. As a result of this study, a new resist formulation to satisfy all litho and defect performance was developed and production yield was further improved.
LNG containment release: Comparison of NFPA-59A and 49-CFR-193
International Nuclear Information System (INIS)
West, H.H.; Pfenning, D.B.
1994-01-01
Due to the potential wide area impact of an unplanned LNG (Liquefied Natural Gas) release, the National Fire Protection Association (NFPA) and later the US Department of Transportation issued standards and regulations which included specific methodologies for analyzing the consequence of an accidental LNG release. The concept of a ''design spill'' was defined in order to evaluate the consequences of an accidental LNG release, with particular attention to the influence of safety protective measures. In addition to specifying the magnitude of the unplanned release, the design spill also specified some of the parameters for estimation of the downwind LNG vapor dispersion and the extent of the radiant heat from an LNG pool fire. Since the NFPA-59A and 49-CFR-193 standards were the first in-depth regulation to address consequence analysis estimation for petroleum components, it is particularly important to consider their details in light of the recently proposed EPA 40-CFR-68 regulations [Risk Management for Chemical Accidental Release Prevention] which specifically address consequence analysis as a part of process safety management
Iron-57 and iridium-193 Moessbauer spectroscopic studies of supported iron-iridium catalysts
International Nuclear Information System (INIS)
Berry, F.J.; Jobson, S.
1988-01-01
57 Fe and 193 Ir Moessbauer spectroscopy shows that silica- and alumina-supported iron-iridium catalysts formed by calcination in air contain mixtures of small particle iron(III) oxide and iridium(IV) oxide. The iridium dioxide in both supported catalysts is reduced in hydrogen to metallic iridium. The α-Fe 2 O 3 in the silica supported materials is predominantly reduced in hydrogen to an iron-iridium alloy whilst in the alumina-supported catalyst the iron is stabilised by treatment in hydrogen as iron(II). Treatment of a hydrogen-reduced silica-supported iron catalyst in hydrogen and carbon monoxide is accompanied by the formation of iron carbides. Carbide formation is not observed when the iron-iridium catalysts are treated in similar atmospheres. The results from the bimetallic catalysts are discussed in terms of the hydrogenation of associatively adsorbed carbon monoxide and the selectivity of supported iron-iridium catalysts to methanol formation. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Pelaez, R. J.; Afonso, C. N. [Laser Processing Group, Instituto de Optica, CSIC, Serrano 121, Madrid 28006 (Spain); Bator, M.; Lippert, T. [General Energy Research Department, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland)
2013-06-14
The aim of this work is to demonstrate that single-photon photoionization processes make a significant difference in the expansion and temperature of the plasma produced by laser ablation of ceramic Al{sub 2}O{sub 3} in vacuum as well as to show their consequences in the kinetic energy distribution of the species that eventually will impact on the film properties produced by pulsed laser deposition. This work compares results obtained by mass spectrometry and optical spectroscopy on the composition and features of the plasma produced by laser ablation at 193 nm and 248 nm, i.e., photon energies that are, respectively, above and below the ionization potential of Al, and for fluences between threshold for visible plasma and up to Almost-Equal-To 2 times higher. The results show that the ionic composition and excitation of the plasma as well as the ion kinetic energies are much higher at 193 nm than at 248 nm and, in the latter case, the population of excited ions is even negligible. The comparison of Maxwell-Boltzmann temperature, electron temperatures, and densities of the plasmas produced with the two laser wavelengths suggests that the expansion of the plasma produced at 248 nm is dominated by a single population. Instead, the one produced at 193 nm is consistent with the existence of two populations of cold and hot species, the latter associated to Al{sup +} ions that travel at the forefront and produced by single photon ionization as well as Al neutrals and double ionized ions produced by electron-ion impact. The results also show that the most energetic Al neutrals in the plasma produced at the two studied wavelengths are in the ground state.
Energy Technology Data Exchange (ETDEWEB)
Ducroux, L. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire]|[Universite Claude Bernard, 69 - Lyon (France)
1997-01-09
This work is devoted to the search and analysis of superdeformed and oblate states in {sup 193}Pb nucleus. High spin states of this isotope, populated via fusion-evaporation reaction {sup 168}Er ({sup 30}Si, 5n) {sup 193}Pb, have been studied with the EUROGAM II {gamma} multidetector array located near the VIVITRON accelerator in Strasbourg. New sorting and analysis programs have been developed in particular related to the background treatment. Angular distribution and linear polarisation analysis allowed us to assign the {gamma} transition multipolarities. Five dipole bands, corresponding to a weakly oblate-deformed shape of the nucleus, have been observed and connected to the low-lying states. The level scheme has been considerably extended up to a spin of 61/2 {Dirac_h} and an excitation energy of about 8 MeV. These structures have been interpreted as based on a high-K two-quasi-proton excitation coupled to rotation aligned quasi-neutrons. Six superdeformed bands, corresponding to a high prolate-deformed shape of the nucleus, have been observed. These six bands have been interpreted as three pairs of signature partners based on quasineutron excitations. The extraction of the g-factor of a K=9/2 neutron superdeformed orbital has been done for the first time in lead isotopes, giving access to the magnetic properties of the extreme nuclear matter. All these results have been discussed in terms of microscopic mean field self-consistent Hartree-Fock calculations using the microscopic 'rotor + particle(s)' model. (author)
Energy Technology Data Exchange (ETDEWEB)
Ducroux, L [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; [Universite Claude Bernard, 69 - Lyon (France)
1997-01-09
This work is devoted to the search and analysis of superdeformed and oblate states in {sup 193}Pb nucleus. High spin states of this isotope, populated via fusion-evaporation reaction {sup 168}Er ({sup 30}Si, 5n) {sup 193}Pb, have been studied with the EUROGAM II {gamma} multidetector array located near the VIVITRON accelerator in Strasbourg. New sorting and analysis programs have been developed in particular related to the background treatment. Angular distribution and linear polarisation analysis allowed us to assign the {gamma} transition multipolarities. Five dipole bands, corresponding to a weakly oblate-deformed shape of the nucleus, have been observed and connected to the low-lying states. The level scheme has been considerably extended up to a spin of 61/2 {Dirac_h} and an excitation energy of about 8 MeV. These structures have been interpreted as based on a high-K two-quasi-proton excitation coupled to rotation aligned quasi-neutrons. Six superdeformed bands, corresponding to a high prolate-deformed shape of the nucleus, have been observed. These six bands have been interpreted as three pairs of signature partners based on quasineutron excitations. The extraction of the g-factor of a K=9/2 neutron superdeformed orbital has been done for the first time in lead isotopes, giving access to the magnetic properties of the extreme nuclear matter. All these results have been discussed in terms of microscopic mean field self-consistent Hartree-Fock calculations using the microscopic 'rotor + particle(s)' model. (author)
Cotham, Victoria C; Shaw, Jared B; Brodbelt, Jennifer S
2015-09-15
Fast online chemical derivatization of peptides with an aromatic label for enhanced 193 nm ultraviolet photodissociation (UVPD) is demonstrated using a dual electrospray reactor implemented on the front-end of a linear ion trap (LIT) mass spectrometer. The reactor facilitates the intersection of protonated peptides with a second population of chromogenic 4-formyl-1,3-benzenedisulfonic acid (FBDSA) anions to promote real-time formation of ion/ion complexes at atmospheric pressure. Subsequent collisional activation of the ion/ion intermediate results in Schiff base formation generated via reaction between a primary amine in the peptide cation and the aldehyde moiety of the FBDSA anion. Utilizing 193 nm UVPD as the subsequent activation step in the MS(3) workflow results in acquisition of greater primary sequence information relative to conventional collision induced dissociation (CID). Furthermore, Schiff-base-modified peptides exhibit on average a 20% increase in UVPD efficiency compared to their unmodified counterparts. Due to the efficiency of covalent labeling achieved with the dual spray reactor, we demonstrate that this strategy can be integrated into a high-throughput LC-MS(n) workflow for rapid derivatization of peptide mixtures.
Spin, quadrupole moment, and deformation of the magnetic-rotational band head in Pb193
Balabanski, D. L.; Ionescu-Bujor, M.; Iordachescu, A.; Bazzacco, D.; Brandolini, F.; Bucurescu, D.; Chmel, S.; Danchev, M.; de Poli, M.; Georgiev, G.; Haas, H.; Hübel, H.; Marginean, N.; Menegazzo, R.; Neyens, G.; Pavan, P.; Rossi Alvarez, C.; Ur, C. A.; Vyvey, K.; Frauendorf, S.
2011-01-01
The spectroscopic quadrupole moment of the T1/2=9.4(5) ns isomer in Pb193 at an excitation energy Eex=(2585+x) keV is measured by the time-differential perturbed angular distribution method as |Qs|=2.6(3) e b. Spin and parity Iπ=27/2- are assigned to it based on angular distribution measurements. This state is the band head of a magnetic-rotational band, described by the 1i13/2 subshell with the (3s1/2-21h9/21i13/2)11- proton excitation. The pairing-plus-quadrupole tilted-axis cranking calculations reproduce the measured quadrupole moment with a moderate oblate deformation ɛ2=-0.11, similar to that of the 11-proton intruder states, which nuclei in the region. This is the first direct measurement of a quadrupole moment and thus of the deformation of a magnetic-rotational band head.
Tritium recovery from co-deposited layers using 193-nm laser
Shu, W. M.; Kawakubo, Y.; Nishi, M. F.
Recovery of tritium from co-deposited layers formed in deuterium-tritium plasma operations of the TFTR (Tokamak Fusion Test Reactor) was investigated by the use of an ArF excimer laser operating at the wavelength of 193 nm. At the laser energy density of 0.1 J/cm2, a transient spike of the tritium-release rate was observed at initial irradiation. Hydrogen isotopes were released in the form of hydrogen-isotope molecules during the laser irradiation in vacuum, suggesting that tritium can be recovered readily from the released gases. In a second experiment, hydrogen (tritium) recovery from the co-deposited layers on JT-60 tiles that had experienced hydrogen-plasma operations was investigated by laser ablation with a focused beam of the excimer laser. The removal rate of the co-deposited layers was quite low when the laser energy density was smaller than the ablation threshold (1.0 J/cm2), but reached 1.1 μm/pulse at the laser energy density of 7.6 J/cm2. The effective absorption coefficient in the co-deposited layers at the laser wavelength was determined to be 1.9 μm-1. The temperature of the surface during the irradiation at the laser energy density of 0.5 J/cm2 was measured on the basis of Planck's law of radiation, and the maximum temperature during the irradiation decreased from 3570 K at the initial irradiation to 2550 K at the 1000th pulse of the irradiation.
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
International Nuclear Information System (INIS)
Czas, J.; Jochum, K.P.; Stoll, B.; Weis, U.; Yang, Q.-C.; Jacob, D.E.; Andreae, M.O.
2012-01-01
The degree of transparency of glasses, which depends on the Fe content, may influence the ablation behavior during laser ablation-inductively coupled plasma-mass spectrometry (LA-ICP-MS) analysis. To test possible matrix effects when using a 193 nm Nd:YAG laser, we have analyzed transparent and opaque NIST, BAM and USGS reference glasses. These reference materials are ideal for such investigations, because they are well characterized, most elements are homogeneously distributed at the micrometer scale, and their Fe content varies over a very large range, from 16 to 130,000 μg g −1 . Our measurements show that the fractionation factors of refractory and volatile lithophile elements, such as Sr, Ba, and Rb, are 1.00 ± 0.03 and independent of the degree of transparency. However, for volatile chalcophile/siderophile elements (e.g., Zn and Pb) the fractionation factors vary significantly between 0.7 and 1, depending on the spot sizes and the transparency of the material. Mass-load-induced matrix effects may also influence the accuracy of LA-ICP-MS analysis. They are less than 2% for the lithophile and up to 10% for volatile chalcophile/siderophile elements when the mass load varies by a factor 2.4. Relative sensitivity factors used for calibration of lithophile elements agree within uncertainty limits for transparent and opaque glasses when using a 193 nm laser. Even for volatile/chalcophile elements they differ only by 5–10%. The reliability of the LA-ICP-MS analyses is demonstrated by presenting concentration data of 27 trace elements in the NIST, BAM and USGS reference glasses using NIST SRM 612 for calibration, where highly accurate reference values are available. For trace element concentrations in the range between 1 and 500 μg g −1 , the reproducibility and the uncertainties at the 95% confidence level of the measurements vary between 1–4%, and 7–10%, respectively. - Highlights: ► Matrix effects are low for lithophile elements using a 193 nm laser
Breaks in plasmid DNA strand induced by laser radiation at a wavelength of 193 nm
International Nuclear Information System (INIS)
Gurzadyan, G.G.; Shul'te Frolinde, D.
1996-01-01
DNA of plasmid pB322 irradiated with laser at a wavelength of 193 nm was treated with an extract containing proteins from E.coli K12 AB1157 (wild-type). The enzymes were found to produce single- and double-strand DNA breaks, which was interpreted as a transformation of a portion of cyclobutane pyrimidine dimers and (6-4) photoproducts into nonrepairable single-strand DNA breaks. The products resulted from ionization of DNA, in particular, single-strand breaks, transform to double-strand breaks. A comparison of these data with the data on survival of plasmid upon transformation of E.coli K12 AB1157 enables one to assess the biological significance of single- and double-strand breaks. The inactivation of the plasmid is mainly determined by the number of directly formed laser-induced single-strand breaks. 26 refs.; 2 figs
International Nuclear Information System (INIS)
Lindner, M.; Gunnink, R.; Nagle, R.J.
1987-01-01
We produced carrier-free, nearly isotopically pure /sup 193/Ir/sup m/ from thermal-neutron irradiation of /sup 192/Os. From studies of the conversion-electron spectrum, the photon spectrum, and the absolute counting rates, we determined the absolute K, L1, L2, L3, M1, M3, M5, N, and O+P conversion coefficients for the first time. With possibly one exception, these values agree closely with theoretical calculations. The value for the energy of the unconverted gamma ray was found to be 80.22 +- 0.02 keV. The half-life for /sup 193/Ir/sup m/ determined by absolute electron counting in a proportional counter of 100% counting efficiency (4πβ) was found to be 10.53 +- 0.04 d. We have determined the L 1 subshell fluorescence yield, ω 1 , to be 0.120 +- 0.003 for iridium. Based upon our measurements of initial and final L subshell vacancies together with a best-fit literature value for ω 2 , we have found a plausible value for the Coster-Kronig coefficient f/sub 12/ to be 0.091 +- 0.011
CO product energy distribution in the photodissociation of methylketene and acrolein at 193 nm
Fujimoto, G. T.; Umstead, M. E.; Lin, M. C.
1985-04-01
CO product vibrational energy distributions in the photodissociation of the two C3H4O isomers, methylketene (CH3CHCO) and acrolein (CH2CHCHO), at 193 nm have been measured by CO laser resonance absorption. The CO from methylketene was found to be vibrationally excited up to v=7, and from acrolein v=6, with average vibrational energies of 3.4±0.3 and 2.7±0.7 kcal/mol, respectively. The similarities observed in the appearance times and in the vibrational energy content of the CO formed in the two systems support our previous conclusion that in the case of acrolein isomerization to methylketene takes place prior to the dissociation process: CH2CHCHO+hν→CH3CHCO*†→CH3CH+CO†. The CO vibrational energy distributions observed in both systems agree closely with the statistical distribution predicted assuming that ethylidene rather than ethylene is formed in the photodissociation reaction.
Fennell, Lochlan J; Jamieson, Saara; McKeone, Diane; Corish, Tracie; Rohdmann, Megan; Furner, Tori; Bettington, Mark; Liu, Cheng; Kawamata, Futoshi; Bond, Catherine; Van De Pols, Jolieke; Leggett, Barbara; Whitehall, Vicki
2018-01-05
Sessile serrated adenomas with BRAF mutation progress rapidly to cancer following the development of dysplasia (SSAD). Approximately 75% of SSADs methylate the mismatch repair gene MLH1, develop mismatch repair deficiency and the resultant cancers have a good prognosis. The remaining SSADs and BRAF mutant traditional serrated adenomas (TSA) develop into microsatellite stable cancers with a poor prognosis. The reason for this dichotomy is unknown. In this study, we assessed the genotypic frequency of the MLH1-93 polymorphism rs1800734 in SSADs and TSAs to determine if the uncommon variant A allele predisposes to MLH1 promoter hypermethylation. We performed genotyping for the MLH1-93 polymorphism, quantitative methylation specific PCR, and MLH1 immunohistochemistry on 124 SSAD, 128 TSA, 203 BRAF mutant CRCs and 147 control subjects with normal colonoscopy. The minor A allele was significantly associated with a dose dependent increase in methylation at the MLH1 promoter in SSADs (p = 0.022). The AA genotype was only observed in SSADs with MLH1 loss. The A allele was also overrepresented in BRAF mutant cancers with MLH1 loss. Only one of the TSAs showed loss of MLH1 and the overall genotype distribution in TSAs did not differ from controls. The MLH1-93 AA genotype is significantly associated with promoter hypermethylation and MLH1 loss in the context of SSADs. BRAF mutant microsatellite stable colorectal cancers with the AA genotype most likely arise in TSAs since the A allele does not predispose to methylation in this context.
Wang, Dan Min; Lin, Ling; Peng, Jian Hua; Gong, Yao; Hou, Zhi Duo; Chen, Su Biao; Xiao, Zheng Yu
2018-06-08
The pathogenesis of sacroiliitis is unclear; therefore, we aimed to systematically study the immunopathology of sacroiliitis in patients with axial spondyloarthritis (axSpA), and explore the relationship between pannus formation, inflammation, and the structural damage caused by sacroiliitis. Fine needle aspiration biopsy of the sacroiliac joint (SIJ) was performed in 193 patients with axSpA. Clinical, laboratory, and imaging data were collected at baseline and during the follow up. Immunohistochemistry analysis was performed to detect CD34+ microvessels, CD68+ osteoclasts/macrophages, vascular endothelial growth factor (VEGF), metalloproteinase-3 (MMP-3), tumor necrosis factor-α (TNF-α), and caspase-3. Autopsy subjects were used as controls. In early sacroiliitis (grade 0-1) all pathological features could be observed, with the most common being subchondral pannus formation. Among the 193 patients, 98 were followed up for 1-13 years (mean 3.6 years); 63.3% had radiological progression at the endpoint. Multiple regression analysis showed that cartilage pannus invasion (OR 2.99, P = 0.010) and endochondral ossification (OR 3.97, P = 0.049) at baseline were risk factors for radiological structural damage. Compared to SIJ controls, the subchondral microvessel density, number of CD68+ multinuclear osteoclasts, and the levels of VEGF, caspase-3, MMP-3, and TNF-α expressed at the interface of the bone and cartilage were significantly higher in patients with sacroiliitis. Subchondral fibrovascular tissue formation is the most important pathological feature in early sacroiliitis. The existence of cartilage pannus invasion or endochondral ossification at baseline can predict radiological structural damage during the follow up.
Fotodisociación de un haz molecular de cetena a 193 nm. : procesos de uno y dos fotones
Ruiz del Castillo, Javier
1995-01-01
En el presente trabajo se ha estudiado experimentalmente la fotodisociación de un haz molecular de cetena (ch2co) con un laser de arf (longitud de onda de 193 nm). Como fragmentos resultantes producto de la fotodisociación se han observado el metileno ch2 (b1b1) que se manifiesta en su emisión de fluorescencia ch2 (b1b1 - a1a1) en la región espectral 500-760 nm, y el radical metilideno ch, en sus estados electrónicos a2 , b2 , y c2 +, en sus transiciones electrónicas al estado fundamental x2 ...
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
Párrizas, Marcelina; Brugnara, Laura; Esteban, Yaiza; González-Franquesa, Alba; Canivell, Sílvia; Murillo, Serafín; Gordillo-Bastidas, Elizabeth; Cussó, Roser; Cadefau, Joan A; García-Roves, Pablo M; Servitja, Joan-Marc; Novials, Anna
2015-03-01
Diabetes is frequently diagnosed late, when the development of complications is almost inevitable, decreasing the quality of life of patients. However, early detection of affected individuals would allow the implementation of timely and effective therapies. Here we set to describe the profile of circulating microRNAs (miRNAs) in prediabetic patients with the intention of identifying novel diagnostic and therapeutic tools. We used real-time RT-PCR to measure the abundance of 176 miRNAs in serum of a cohort of 92 control and prediabetic individuals with either impaired fasting glucose or impaired glucose tolerance, as well as newly diagnosed diabetic patients. We validated the results in a second cohort of control and prediabetic subjects undergoing a therapeutic exercise intervention, as well as in a mouse model of glucose intolerance. We identified two miRNAs, miR-192 and miR-193b, whose abundance is significantly increased in the prediabetic state but not in diabetic patients. Strikingly, these miRNAs are also increased in plasma of glucose-intolerant mice. Moreover, circulating levels of miR-192 and miR-193b return to baseline in both prediabetic humans and glucose-intolerant mice undergoing a therapeutic intervention consisting in chronic exercise, which succeeded in normalizing metabolic parameters. Our data show that the pattern of circulating miRNAs is modified by defects in glucose metabolism in a similar manner in mice and humans. This circulating miRNA signature for prediabetes could be used as a new diagnostic tool, as well as to monitor response to intervention.
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
Spin, quadrupole moment, and deformation of the magnetic-rotational band head in (193)Pb
Balabanski, D L; Iordachescu, A; Bazzacco, D; Brandolini, F; Bucurescu, D; Chmel, S; Danchev, M; De Poli, M; Georgiev, G; Haas, H; Hubel, H; Marginean, N; Menegazzo, R; Neyens, G; Pavan, P; Rossi Alvarez, C; Ur, C A; Vyvey, K; Frauendorf, S
2011-01-01
The spectroscopic quadrupole moment of the T(1/2) = 9.4(5) ns isomer in (193)Pb at an excitation energy E(ex) = (2585 + x) keV is measured by the time-differential perturbed angular distribution method as vertical bar Q(s)vertical bar = 2.6(3) e b. Spin and parity I(pi) = 27/2(-) are assigned to it based on angular distribution measurements. This state is the band head of a magnetic-rotational band, described by the coupling of a neutron hole in the 1i(13/2) subshell with the (3s(1/2)(-2)1h(9/2)1i(13/2))(11-) proton excitation. The pairing-plus-quadrupole tilted-axis cranking calculations reproduce the measured quadrupole moment with a moderate oblate deformation epsilon(2) = -0.11, similar to that of the 11(-)proton intruder states, which occur in the even-even Pb nuclei in the region. This is the first direct measurement of a quadrupole moment and thus of the deformation of a magnetic-rotational band head.
International Nuclear Information System (INIS)
Blank, D.A.; Suits, A.G.; Lee, Y.T.; North, S.W.; Hall, G.E.
1998-01-01
We have investigated the photodissociation of acrylonitrile (H 2 CCHCN) at 193 nm using the technique of photofragment translational spectroscopy. The experiments were performed at the Chemical Dynamics Beamline at the Advanced Light Source and used tunable vacuum ultraviolet synchrotron radiation for product photoionization. We have identified four primary dissociation channels including atomic and molecular hydrogen elimination, HCN elimination, and CN elimination. There is significant evidence that all of the dissociation channels occur on the ground electronic surface following internal conversion from the initially optically prepared state. The product translational energy distributions reflect near statistical simple bond rupture for the radical dissociation channels, while substantial recombination barriers mediate the translational energy release for the two molecular elimination channels. Photoionization onsets have provided additional insight into the chemical identities of the products and their internal energy content. copyright 1998 American Institute of Physics
Araya, Miguel
2018-05-01
HESS J1809‑193 is an unidentified TeV source discovered by the High Energy Stereoscopic System and originally classified as a pulsar wind nebula (PWN) candidate associated with the pulsar PSR J1809‑1917. However, a recent study of deep radio observations and the interstellar medium near the source has found evidence for a hadronic scenario for the gamma-rays. Here, a detailed study of the GeV emission in the region using data from the Fermi-LAT is presented. The GeV emission has an extended morphology in the region of the TeV emission and the overall spectrum can be accounted for by a cosmic-ray population having a simple power-law spectrum with energies extending up to 1 PeV. However, the spectrum at tens of TeV should be observed more deeply in the future to confirm its hadronic nature, and other scenarios involving combinations of leptonic and hadronic emission from several of the known supernova remnants in the region cannot be ruled out. The nearby TeV source HESS J1813‑178, thought to be a PWN, is also studied in detail at GeV energies and we find a region of significant emission that is much more extended than the TeV emission and whose spectrum is softer than expected from a PWN but similar to those seen in several star-forming regions that are believed to accelerate protons. There is marginal evidence for a GeV point source at the location of the X-ray PWN, beside the extended emission.
Hussain, Azher; Gorovits, Boris; Leal, Mauricio; Fluhler, Eric
2014-01-01
Antibody-drug conjugates (ADCs) are a new generation of anticancer therapeutics. The objective of this manuscript is to propose a methodology that can be used to assess the stability of the ADCs by using the PK data obtained by ligand-binding assays that measure various components of ADCs. The ligand-binding assays format of different components of ADCs provided unique valuable PK information. The mathematical manipulation of the bioanalytical data provided an insight into the in vivo integrity, indicating that the loading of the calicheamicin on the G193 antibody declines in an apparent slow first-order process. This report demonstrates the value of analyzing various components of the ADC and their PK profiles to better understand the disposition and in vivo stability of ADCs.
Energy Technology Data Exchange (ETDEWEB)
Lopez, X
2004-12-15
This work deals with the production of strange particles in Ni + Ni collisions at 1.93 A GeV detected with the Fopi (four pi) detector at the heavy ion synchrotron SIS (GSI - Germany). We have limited our investigation to the study of {lambda} and {xi} hyperons. The first chapter presents the models used to describe ultra-relativistic heavy ions collisions. In the second chapter we present the main experimental results concerning the production and transport of strange particles in an energy domain ranging from SIS to RHIC (relativistic heavy ion collider) energies. The third chapter is dedicated to the specificities of the Fopi detector. The fourth chapter deals with the production of {lambda} particles in Ni + Ni collisions. An analysis method based on neuron network has been used in parallel with a more classical method. The production rate and temperature of {lambda} have been deduced from both methods. The neuron network method gives a statistical gain and allows a better identification of particles with low transverse impulses. The fifth chapter is dedicated to the detection of the doubly strange {xi}{sup -} particle. A detailed study about the stability of the signal is presented. In the last chapter all our experimental results are confronted with theoretical predictions. The UrQMD model that uses a hard equation of state, can simulate satisfactorily the production rates of {lambda} and K{sup +} as well as their dependency on collision centrality despite the fact that this model does not use a potential linked to the medium density. The comparison between experimental results and predictions given by the IQMD model (that is based on a soft equation of state) is better when the version of the model that does not take into account the effects of the media is used. We see that the choices for the nuclear matter compressibility, for the particles involved in Kaon and {lambda} creation process, or for the interaction potential with dense medium, appear to be
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
Energy Technology Data Exchange (ETDEWEB)
Lopez, X
2004-12-15
This work deals with the production of strange particles in Ni + Ni collisions at 1.93 A GeV detected with the Fopi (four pi) detector at the heavy ion synchrotron SIS (GSI - Germany). We have limited our investigation to the study of {lambda} and {xi} hyperons. The first chapter presents the models used to describe ultra-relativistic heavy ions collisions. In the second chapter we present the main experimental results concerning the production and transport of strange particles in an energy domain ranging from SIS to RHIC (relativistic heavy ion collider) energies. The third chapter is dedicated to the specificities of the Fopi detector. The fourth chapter deals with the production of {lambda} particles in Ni + Ni collisions. An analysis method based on neuron network has been used in parallel with a more classical method. The production rate and temperature of {lambda} have been deduced from both methods. The neuron network method gives a statistical gain and allows a better identification of particles with low transverse impulses. The fifth chapter is dedicated to the detection of the doubly strange {xi}{sup -} particle. A detailed study about the stability of the signal is presented. In the last chapter all our experimental results are confronted with theoretical predictions. The UrQMD model that uses a hard equation of state, can simulate satisfactorily the production rates of {lambda} and K{sup +} as well as their dependency on collision centrality despite the fact that this model does not use a potential linked to the medium density. The comparison between experimental results and predictions given by the IQMD model (that is based on a soft equation of state) is better when the version of the model that does not take into account the effects of the media is used. We see that the choices for the nuclear matter compressibility, for the particles involved in Kaon and {lambda} creation process, or for the interaction potential with dense medium, appear to be
Energy Technology Data Exchange (ETDEWEB)
Naudy-Vives, C.; Courant, D.; Perot, J.C.; Garcia, J.; Fretier, P.; Court, L.; Dormont, D.
1995-12-31
The effects on TNF-alpha and gelatinase B activity in mammalian cells induced by 193 nm argon fluoride excimer laser have been investigated. The data show that a secretion of 92 kDa type IV collagenase and TNF-alpha were increased in cell culture supernatants. Moreover, the 193 nm laser radiation produces a decrease of cell proliferation and an increase of cell activation 8 hours after irradiation. The total protein amount increases with the delivered dose. Same, but less effects were obtained after exposure to a conventional UV lamp at 254 nm. (author). 8 refs.
Adamczyk, L.
2016-12-15
We present a measurement of the inclusive production of Upsilon mesons in U+U collisions at 193 GeV at mid-rapidity (|y| < 1). Previous studies in central Au+Au collisions at 200 GeV show a suppression of Upsilon(1S+2S+3S) production relative to expectations from the Upsilon yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Upsilon(1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Upsilon(1S+2S+3S) and Upsilon(1S) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.
Energy Technology Data Exchange (ETDEWEB)
Burakov, B.E., E-mail: burakov@peterlink.ru [V.G. Khlopin Radium Institute, 28, 2-nd Murinskiy Ave., St. Petersburg, 194021 (Russian Federation); Yagovkina, M.A. [A.F. Ioffe Physical-Technical Institute, 26, Politekhnicheskaya, St. Petersburg, 194021 (Russian Federation)
2015-12-15
Polycrystalline samples of cubic zirconia, Zr{sub 0.79}Gd{sub 0.14}Pu{sub 0.07}O{sub 1.93}, doped with approximately 9.9 wt.% {sup 238}Pu, and PuO{sub 2} containing 11.0 wt. % {sup 238}Pu (and main isotope is {sup 239}Pu) have been repeatedly studied during many years by X-ray diffraction analysis. At a temperature of 25 °C the unit-cell parameter of PuO{sub 2} increases depending on accumulated dose, and is accompanied by decrease of coherent scattering region (CSR). Self-irradiation of Zr{sub 0.79}Gd{sub 0.14}Pu{sub 0.07}O{sub 1.93} is accompanied with repeated change of unit-cell parameter and CSR.
Directory of Open Access Journals (Sweden)
Garraffo H Martin
2007-09-01
Full Text Available Abstract Background The 5,8-disubstituted indolizidines constitute the largest class of poison-frog alkaloids. Some alkaloids have been shown to act as noncompetitive blockers at nicotinic acetylcholine receptors but the proposed structures and the biological activities of most of the 5,8-disubstituted indolizidines have not been determined because of limited supplies of the natural products. We have therefore conducted experiments to confirm proposed structures and determine biological activities using synthetic compounds. Recently, we reported that one of this class of alkaloids, (--235B', acts as a noncompetitive antagonist for α4β2 nicotinic receptors, and its sensitivity is comparable to that of the classical competitive antagonist for this receptor, dihydro-β-erythroidine. Results The enantioselective syntheses of (--209B, (--231C, (--233D, (--235B", (--221I, and what proved to be an epimer of natural 193E, starting from common chiral lactams have been achieved. When we performed electrophysiological recordings to examine the effects of the synthetic alkaloids on two major subtypes of nicotinic receptors (α4β2 and α7 expressed in Xenopus laevis oocytes, (--231C effectively blocked α4β2 receptor responses (IC50 value, 1.5 μM with a 7.0-fold higher potency than for blockade of α7 receptor responses. In contrast, synthetic (--221I and (--epi-193E were more potent in blocking α7 receptor responses (IC50 value, 4.4 μM and 9.1 μM, respectively than α4β2 receptor responses (5.3-fold and 2.0-fold, respectively. Conclusion We achieved the total synthesis of (--209B, (--231C, (--233D, (--235B", (--221I, and an epimer of 193E starting from common chiral lactams, and the absolute stereochemistry of natural (--233D was determined. Furthermore, the relative stereochemistry of (--231C and (--221I was also determined. The present asymmetric synthesis of the proposed structure for 193E revealed that the C-8 configuration of natural 193E
El Tantawi, Maha; Folayan, Morenike O; Mehaina, Mohamed; Vukovic, Ana; Castillo, Jorge L; Gaffar, Balgis O; Arheiam, Arheiam; Al-Batayneh, Ola B; Kemoli, Arthur M; Schroth, Robert J; Lee, Gillian H M
2018-06-21
To assess the relationship between health care system and economic factors and early childhood caries (ECC) data availability and prevalence. We estimated ECC data for 193 United Nations countries from studies published between 2007 and 2017. We obtained other variables from the World Health Organization and the World Bank databases. We assessed association with ECC data availability by using logistic regression and with ECC prevalence by using linear regression. We included 190 publications from 88 (45.6%) countries. The mean ECC prevalence was 23.8% and 57.3% in children younger than 36 months and children aged 36 to 71 months, respectively. The odds of ECC data availability were significantly higher for countries with more physicians and more dentists. In children younger than 36 months, ECC prevalence was associated with universal health coverage (B = -6.56). In children aged 36 to 71 months, it was associated with growth of gross national income (B = 0.27). Countries with more physicians and more dentists were more likely to have ECC data. Among those with data, countries with higher economic growth had higher ECC prevalence. (Am J Public Health. Published online ahead of print June 21, 2018: e1-e7. doi:10.2105/AJPH.2018.304466).
Zheng, Erhu; Huang, Yi; Zhang, Haiyang
2017-03-01
As CMOS technology reaches 14nm node and beyond, one of the key challenges of the extension of 193nm immersion lithography is how to control the line edge and width roughness (LER/LWR). For Self-aligned Multiple Patterning (SaMP), LER becomes larger while LWR becomes smaller as the process proceeds[1]. It means plasma etch process becomes more and more dominant for LER reduction. In this work, we mainly focus on the core etch solution including an extra plasma coating process introduced before the bottom anti reflective coating (BARC) open step, and an extra plasma cure process applied right after BARC-open step. Firstly, we leveraged the optimal design experiment (ODE) to investigate the impact of plasma coating step on LER and identified the optimal condition. ODE is an appropriate method for the screening experiments of non-linear parameters in dynamic process models, especially for high-cost-intensive industry [2]. Finally, we obtained the proper plasma coating treatment condition that has been proven to achieve 32% LER improvement compared with standard process. Furthermore, the plasma cure scheme has been also optimized with ODE method to cover the LWR degradation induced by plasma coating treatment.
International Nuclear Information System (INIS)
Lee, H.; Wu, C.-Y.; Yang, S.K.; Lee, Y.-P.
2005-01-01
Following photodissociation of formyl fluoride (HFCO) at 193 nm, we detected products with fragmentation translational spectroscopy utilizing a tunable vacuum ultraviolet beam from a synchrotron for ionization. Among three primary dissociation channels observed in this work, the F-elimination channel HFCO→HCO+F dominates, with a branching ratio ∼0.66 and an average release of kinetic energy ∼55 kJ mol -1 ; about 17% of HCO further decomposes to H+CO. The H-elimination channel HFCO→FCO+H has a branching ratio ∼0.28 and an average release of kinetic energy ∼99 kJ mol -1 ; about 21% of FCO further decomposes to F+CO. The F-elimination channel likely proceeds via the S 1 surface whereas the H-elimination channel proceeds via the T 1 surface; both channels exhibit moderate barriers for dissociation. The molecular HF-elimination channel HFCO→HF+CO, correlating with the ground electronic surface, has a branching ratio of only ∼0.06; the average translational release of 93 kJ mol -1 , ∼15% of available energy, implies that the fragments are highly internally excited. Detailed mechanisms of photodissociation are discussed
Mask compensation for process flare in 193nm very low k1 lithography
Lee, Jeonkyu; Lee, Taehyeong; Oh, Sangjin; Kang, Chunsoo; Kim, Jungchan; Choi, Jaeseung; Park, Chanha; Yang, Hyunjo; Yim, Donggyu; Do, Munhoe; Su, Irene; Song, Hua; Choi, Jung-Hoe; Fan, Yongfa; Wang, Anthony C.; Lee, Sung-Woo; Boone, Robert; Lucas, Kevin
2013-04-01
Traditional rule-based and model-based OPC methods only simulate in a very local area (generally less than 1um) to identify and correct for systematic optical or process problems. Despite this limitation, however, these methods have been very successful for many technology generations and have been a major reason for the industry being able to tremendously push down lithographic K1. This is also enabled by overall good across-exposure field lithographic process control which has been able to minimize longer range effects across the field. Now, however, the situation has now become more complex. The lithographic single exposure resolution limit with 1.35NA tools remains about 80nm pitch but the final wafer dimensions and final wafer pitches required in advanced technologies continue to scale down. This is putting severe strain on lithographic process and OPC CD control. Therefore, formerly less important 2nd order effects are now starting to have significant CD control impact if not corrected for. In this paper, we provide examples and discussion of how optical and chemical flare related effects are becoming more problematic, especially at the boundaries of large, dense memory arrays. We then introduce a practical correction method for these systematic effects which reuses some of the recent long range effect correcting OPC techniques developed for EUV pattern correction (such as EUV flare). We next provide analysis of the benefits of these OPC methods for chemical flare issues in 193nm lithography very low K1 lithography. Finally, we summarize our work and briefly mention possible future extensions.
Strangeness production in Ni+Ni collisions at 1.93 AGeV
International Nuclear Information System (INIS)
Lopez, X.
2004-12-01
This work deals with the production of strange particles in Ni + Ni collisions at 1.93 A GeV detected with the Fopi (four pi) detector at the heavy ion synchrotron SIS (GSI - Germany). We have limited our investigation to the study of Λ and Ξ hyperons. The first chapter presents the models used to describe ultra-relativistic heavy ions collisions. In the second chapter we present the main experimental results concerning the production and transport of strange particles in an energy domain ranging from SIS to RHIC (relativistic heavy ion collider) energies. The third chapter is dedicated to the specificities of the Fopi detector. The fourth chapter deals with the production of Λ particles in Ni + Ni collisions. An analysis method based on neuron network has been used in parallel with a more classical method. The production rate and temperature of Λ have been deduced from both methods. The neuron network method gives a statistical gain and allows a better identification of particles with low transverse impulses. The fifth chapter is dedicated to the detection of the doubly strange Ξ - particle. A detailed study about the stability of the signal is presented. In the last chapter all our experimental results are confronted with theoretical predictions. The UrQMD model that uses a hard equation of state, can simulate satisfactorily the production rates of Λ and K + as well as their dependency on collision centrality despite the fact that this model does not use a potential linked to the medium density. The comparison between experimental results and predictions given by the IQMD model (that is based on a soft equation of state) is better when the version of the model that does not take into account the effects of the media is used. We see that the choices for the nuclear matter compressibility, for the particles involved in Kaon and Λ creation process, or for the interaction potential with dense medium, appear to be degrees of freedom that are difficult to adjust
Energy Technology Data Exchange (ETDEWEB)
Shakeri Jooybari, B. [Department of Energy Engineering and Physics, Amirkabir University of Technology, P.O. Box 15875-4413, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Nuclear Science and Technology Research Institute (NSRT), Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Ghergherehchi, M. [College of Information and Technology/ school of Electronic and Electrical Engineering, Sungkyunkwan University, Suwon (Korea, Republic of); Afarideh, H., E-mail: hafarideh@aut.ac.ir [Department of Energy Engineering and Physics, Amirkabir University of Technology, P.O. Box 15875-4413, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Lamehi-Rachti, M. [Nuclear Science and Technology Research Institute (NSRT), Tehran, Islamic Republic of Iran (Iran, Islamic Republic of)
2015-01-01
The effects of ArF laser irradiation (λ=193nm) at various fluences (energy dose or energy density) on the etching properties of pre-exposed (laser + alpha) CR-39 detectors were studied. First, UV–Vis and Fourier transform infrared (FTIR) spectra were acquired for non-laser-irradiated and laser-irradiated samples to detect the influence of the ArF laser on the chemical modification of the CR-39. Changes observed in the spectra indicated that the predominant process that occurred upon ArF laser irradiation was a bond-scission process. Thereafter, the mean track and bulk etching parameters were experimentally measured in ArF-laser-irradiated CR-39 detectors exposed to an alpha source ({sup 241}Am, E = 5.49 MeV). Inhomogeneous regions in the laser-irradiated side of the CR-39 demonstrated a variable etching rate on only the front side of the CR-39 detector. New equations are also presented for the average bulk etching rate for these inhomogeneous regions (front side). The mean bulk and track etching rates and the mean track dimensions increased in a fluence range of 0–37.03 mJ/cm{sup 2} because of photodegradation and the scission of chemical bonds, which are the predominant processes in this range. When the fluence was increased from 37.03 to 123.45 mJ/cm{sup 2}, the bulk and track etching rates and the track dimensions slowly decreased because of the formation of cross-linked structures on the CR-39 surface. The behavior of the bulk and track etching rates and the track dimensions appears to be proportional to the dose absorbed on the detector surface. It was observed that as the etching time was increased, the bulk and track etching rates and the track dimensions of the laser-irradiated samples decreased because of the shallow penetration depth of the 193 nm laser and the reduction in the oxygen penetration depth.
Calvet, Laure; Pereira, Bruno; Sapin, Anne-Françoise; Mareynat, Gabrielle; Lautrette, Alexandre; Souweine, Bertrand
2017-01-01
The purpose of the work was to assess the contribution to diagnosis and/or treatment (CDT) of bone marrow aspiration (BMA) in the critically ill patient. The retrospective study included 193 patients. On the basis of BMA findings, contribution to diagnosis was defined by one of four previously unestablished diagnoses (maturation arrest of granulocyte precursors, hemophagocytic lymphohistiocytosis, hematological malignancy, marrow infiltration with cancer cells) and to treatment as the initiation or withdrawal of a specific treatment including the decision to forgo life-sustaining treatment (DFLST). A CDT of BMA was observed in 40/193 patients (20.7%). BMA contributed to diagnosis in 37 cases (granulocyte precursor maturation arrest, N = 10; hemophagocytic lymphohistiocytosis, N = 12; hematological malignancy, N = 15) and to treatment in 14, including three DFLSTs. In multivariate analysis, the factors associated with a CDT were hematological malignancy, cancer or non-malignant hematological abnormality known on admission, indication for BMA excluding isolated thrombocytopenia, higher pre-BMA HScore (calculated prior to BMA), and higher SOFA score with or without platelet-count SOFA subscore. In the 160 patients without hematological malignancy or cancer known on admission, non-malignant hematological abnormality known on admission, indication for BMA excluding isolated thrombocytopenia, higher pre-BMA HScore, and higher SOFA score calculated with or without platelet-count SOFA subscore were independently associated with a CDT of BMA. BMA can have a significant CDT in ICU patients with or without a known hematological malignancy or cancer on admission. An HScore calculated before BMA can be a valuable tool for predicting a CDT of BMA.
Mechanisms involved in HBr and Ar cure plasma treatments applied to 193 nm photoresists
International Nuclear Information System (INIS)
Pargon, E.; Menguelti, K.; Martin, M.; Bazin, A.; Joubert, O.; Chaix-Pluchery, O.; Sourd, C.; Derrough, S.; Lill, T.
2009-01-01
In this article, we have performed detailed investigations of the 193 nm photoresist transformations after exposure to the so-called HBr and Ar plasma cure treatments using various characterization techniques (x-ray photoelectron spectroscopy, Fourier transformed infrared, Raman analyses, and ellipsometry). By using windows with different cutoff wavelengths patched on the photoresist film, the role of the plasma vacuum ultraviolet (VUV) light on the resist modifications is clearly outlined and distinguished from the role of radicals and ions from the plasma. The analyses reveal that both plasma cure treatments induce severe surface and bulk chemical modifications of the resist films. The synergistic effects of low energetic ion bombardment and VUV plasma light lead to surface graphitization or cross-linking (on the order of 10 nm), while the plasma VUV light (110-210 nm) is clearly identified as being responsible for ester and lactone group removal from the resist bulk. As the resist modification depth depends strongly on the wavelength penetration into the material, it is found that HBr plasma cure that emits near 160-170 nm can chemically modify the photoresist through its entire thickness (240 nm), while the impact of Ar plasmas emitting near 100 nm is more limited. In the case of HBr cure treatment, Raman and ellipsometry analyses reveal the formation of sp 2 carbon atoms in the resist bulk, certainly thanks to hydrogen diffusion through the resist film assisted by the VUV plasma light.
Υ production in U + U collisions at √{sN N}=193 GeV measured with the STAR experiment
Adamczyk, L.; Adkins, J. K.; Agakishiev, G.; Aggarwal, M. M.; Ahammed, Z.; Alekseev, I.; Anderson, D. M.; Aoyama, R.; Aparin, A.; Arkhipkin, D.; Aschenauer, E. C.; Ashraf, M. U.; Attri, A.; Averichev, G. S.; Bai, X.; Bairathi, V.; Bellwied, R.; Bhasin, A.; Bhati, A. K.; Bhattarai, P.; Bielcik, J.; Bielcikova, J.; Bland, L. C.; Bordyuzhin, I. G.; Bouchet, J.; Brandenburg, J. D.; Brandin, A. V.; Bunzarov, I.; Butterworth, J.; Caines, H.; Calderón de la Barca Sánchez, M.; Campbell, J. M.; Cebra, D.; Chakaberia, I.; Chaloupka, P.; Chang, Z.; Chatterjee, A.; Chattopadhyay, S.; Chen, J. H.; Chen, X.; Cheng, J.; Cherney, M.; Christie, W.; Contin, G.; Crawford, H. J.; Das, S.; De Silva, L. C.; Debbe, R. R.; Dedovich, T. G.; Deng, J.; Derevschikov, A. A.; Didenko, L.; Dilks, C.; Dong, X.; Drachenberg, J. L.; Draper, J. E.; Du, C. M.; Dunkelberger, L. E.; Dunlop, J. C.; Efimov, L. G.; Engelage, J.; Eppley, G.; Esha, R.; Esumi, S.; Evdokimov, O.; Eyser, O.; Fatemi, R.; Fazio, S.; Federic, P.; Fedorisin, J.; Feng, Z.; Filip, P.; Finch, E.; Fisyak, Y.; Flores, C. E.; Fulek, L.; Gagliardi, C. A.; Garand, D.; Geurts, F.; Gibson, A.; Girard, M.; Greiner, L.; Grosnick, D.; Gunarathne, D. S.; Guo, Y.; Gupta, A.; Gupta, S.; Guryn, W.; Hamad, A. I.; Hamed, A.; Haque, R.; Harris, J. W.; He, L.; Heppelmann, S.; Heppelmann, S.; Hirsch, A.; Hoffmann, G. W.; Horvat, S.; Huang, H. Z.; Huang, B.; Huang, T.; Huang, X.; Huck, P.; Humanic, T. J.; Igo, G.; Jacobs, W. W.; Jentsch, A.; Jia, J.; Jiang, K.; Jowzaee, S.; Judd, E. G.; Kabana, S.; Kalinkin, D.; Kang, K.; Kauder, K.; Ke, H. W.; Keane, D.; Kechechyan, A.; Khan, Z.; Kikoła, D. P.; Kisel, I.; Kisiel, A.; Kochenda, L.; Koetke, D. D.; Kosarzewski, L. K.; Kraishan, A. F.; Kravtsov, P.; Krueger, K.; Kumar, L.; Lamont, M. A. C.; Landgraf, J. M.; Landry, K. D.; Lauret, J.; Lebedev, A.; Lednicky, R.; Lee, J. H.; Li, Y.; Li, C.; Li, X.; Li, W.; Li, X.; Lin, T.; Lisa, M. A.; Liu, F.; Liu, Y.; Ljubicic, T.; Llope, W. J.; Lomnitz, M.; Longacre, R. S.; Luo, X.; Luo, S.; Ma, G. L.; Ma, R.; Ma, L.; Ma, Y. G.; Magdy, N.; Majka, R.; Manion, A.; Margetis, S.; Markert, C.; Matis, H. S.; McDonald, D.; McKinzie, S.; Meehan, K.; Mei, J. C.; Miller, Z. W.; Minaev, N. G.; Mioduszewski, S.; Mishra, D.; Mohanty, B.; Mondal, M. M.; Morozov, D. A.; Mustafa, M. K.; Nandi, B. K.; Nasim, Md.; Nayak, T. K.; Nigmatkulov, G.; Niida, T.; Nogach, L. V.; Nonaka, T.; Novak, J.; Nurushev, S. B.; Odyniec, G.; Ogawa, A.; Oh, K.; Okorokov, V. A.; Olvitt, D.; Page, B. S.; Pak, R.; Pan, Y. X.; Pandit, Y.; Panebratsev, Y.; Pawlik, B.; Pei, H.; Perkins, C.; Pile, P.; Pluta, J.; Poniatowska, K.; Porter, J.; Posik, M.; Poskanzer, A. M.; Pruthi, N. K.; Przybycien, M.; Putschke, J.; Qiu, H.; Quintero, A.; Ramachandran, S.; Ray, R. L.; Reed, R.; Rehbein, M. J.; Ritter, H. G.; Roberts, J. B.; Rogachevskiy, O. V.; Romero, J. L.; Roth, J. D.; Ruan, L.; Rusnak, J.; Rusnakova, O.; Sahoo, N. R.; Sahu, P. K.; Sakrejda, I.; Salur, S.; Sandweiss, J.; Sarkar, A.; Schambach, J.; Scharenberg, R. P.; Schmah, A. M.; Schmidke, W. B.; Schmitz, N.; Seger, J.; Seyboth, P.; Shah, N.; Shahaliev, E.; Shanmuganathan, P. V.; Shao, M.; Sharma, M. K.; Sharma, A.; Sharma, B.; Shen, W. Q.; Shi, Z.; Shi, S. S.; Shou, Q. Y.; Sichtermann, E. P.; Sikora, R.; Simko, M.; Singha, S.; Skoby, M. J.; Smirnov, D.; Smirnov, N.; Solyst, W.; Song, L.; Sorensen, P.; Spinka, H. M.; Srivastava, B.; Stanislaus, T. D. S.; Stepanov, M.; Stock, R.; Strikhanov, M.; Stringfellow, B.; Sugiura, T.; Sumbera, M.; Summa, B.; Sun, Y.; Sun, Z.; Sun, X. M.; Surrow, B.; Svirida, D. N.; Tang, Z.; Tang, A. H.; Tarnowsky, T.; Tawfik, A.; Thäder, J.; Thomas, J. H.; Timmins, A. R.; Tlusty, D.; Todoroki, T.; Tokarev, M.; Trentalange, S.; Tribble, R. E.; Tribedy, P.; Tripathy, S. K.; Tsai, O. D.; Ullrich, T.; Underwood, D. G.; Upsal, I.; Van Buren, G.; van Nieuwenhuizen, G.; Varma, R.; Vasiliev, A. N.; Vertesi, R.; Videbæk, F.; Vokal, S.; Voloshin, S. A.; Vossen, A.; Wang, G.; Wang, J. S.; Wang, F.; Wang, Y.; Wang, Y.; Webb, J. C.; Webb, G.; Wen, L.; Westfall, G. D.; Wieman, H.; Wissink, S. W.; Witt, R.; Wu, Y.; Xiao, Z. G.; Xie, G.; Xie, W.; Xin, K.; Xu, Z.; Xu, H.; Xu, N.; Xu, J.; Xu, Y. F.; Xu, Q. H.; Yang, Y.; Yang, Y.; Yang, S.; Yang, Q.; Yang, Y.; Yang, C.; Ye, Z.; Ye, Z.; Yi, L.; Yip, K.; Yoo, I.-K.; Yu, N.; Zbroszczyk, H.; Zha, W.; Zhang, J.; Zhang, Z.; Zhang, J.; Zhang, S.; Zhang, X. P.; Zhang, J. B.; Zhang, Y.; Zhang, S.; Zhao, J.; Zhong, C.; Zhou, L.; Zhu, X.; Zoulkarneeva, Y.; Zyzak, M.; STAR Collaboration
2016-12-01
We present a measurement of the inclusive production of Υ mesons in U+U collisions at √{sN N}=193 GeV at midrapidity (|y |<1 ). Previous studies in central Au+Au collisions at √{sN N}=200 GeV show a suppression of Υ (1S+2S+3S) production relative to expectations from the Υ yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Υ (1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Υ (1 S +2 S +3 S ) and Υ (1 S ) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.
Stable high brightness radio frequency driven micro-discharge lamps at 193 (ArF*) and 157 nm ( F2*)
International Nuclear Information System (INIS)
Salvermoser, M; Murnick, D E
2004-01-01
A stable discharge between two pin electrodes separated by several hundred micrometres in a high pressure rare gas (∼900 mbar) halogen (∼1 mbar) mixture is shown to yield continuous wave (CW) ultra violet (UV) and vacuum UV light sources. Lamps operating at 193 (ArF*) and 157 nm F 2 *) have been demonstrated. Total CW output power in the UV was measured to be 30 for ArF* and 20 mW for F 2 *. The brightness of the light sources is estimated to be of the order of several W cm -2 sr -1 . With direct current excitation, electrode lifetimes are limited to a few minutes due to fluorine salt deposits. However, using a radio frequency (RF) field to drive the discharge, the lifetime of the lamps increased to hundreds of hours. A one-dimensional model of the RF micro-discharge explaining the increase in electrode lifetime is presented. The technology described can be adapted to many other wavelengths and promises even higher powers in future
Scintillation properties of Ca co-doped L(Y)SO:Ce between 193 K and 373 K for TOF-PET/MRI
International Nuclear Information System (INIS)
Weele, David N ter; Schaart, Dennis R; Dorenbos, Pieter
2014-01-01
Time-of-flight Positron Emission Tomography (TOF-PET) and TOF-PET/MRI require scintillators with high light yield, short decay time, and short rise time in order to obtain high timing resolution. LSO:Ce and LYSO:Ce are commonly used. Ca co-doped LSO:Ce shows improved scintillation properties. The decay time constant of LSO:Ce,0.2%Ca (~33 ns) is shorter than standard LSO:Ce (~38-40 ns), and it has about 15% higher light yield. We measured scintillation pulse shapes and photoelectron yields of LSO:Ce, LSO:Ce,0.2%Ca, LYSO:Ce, LYSO:Ce,20ppmCa, LYSO:0.11%Ce,0.2%Mg, and LYSO:0.2%Ce,0.2%Ca at temperatures ranging from 193 K to 373 K. To study rise times we built a set-up in which samples are excited by 100 ps (FWHM) x-ray pulses.
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
Energy Technology Data Exchange (ETDEWEB)
Macklin, R.L.; Drake, D.M.; Malanify, J.J.
1977-11-01
Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu, and the /sup 6/Li(n,..cap alpha..)/sup 3/H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV.
Study of (n,2n reaction on 191,193Ir isotopes and isomeric cross section ratios
Directory of Open Access Journals (Sweden)
Vlastou R.
2017-01-01
Full Text Available The cross section of 191Ir(n,2n190Irg+m1 and 191Ir(n,2n190Irm2 reactions has been measured at 17.1 and 20.9 MeV neutron energies at the 5.5 MV tandem T11/25 Accelerator Laboratory of NCSR “Demokritos”, using the activation method. The neutron beams were produced by means of the 3H(d,n4He reaction at a flux of the order of 2 × 105 n/cm2s. The neutron flux has been deduced implementing the 27Al(n,α reaction, while the flux variation of the neutron beam was monitored by using a BF3 detector. The 193Ir(n,2n192Ir reaction cross section has also been determined, taking into account the contribution from the contaminant 191Ir(n,γ192Ir reaction. The correction method is based on the existing data in ENDF for the contaminant reaction, convoluted with the neutron spectra which have been extensively studied by means of simulations using the NeusDesc and MCNP codes. Statistical model calculations using the code EMPIRE 3.2.2 and taking into account pre-equilibrium emission, have been performed on the data measured in this work as well as on data reported in literature.
International Nuclear Information System (INIS)
Schaefer, F.K.W.; Heer, I.; Schaefer, P.J.; Mundhenke, C.; Osterholz, S.; Order, B.M.; Hofheinz, N.; Hedderich, J.; Heller, M.; Jonat, W.; Schreer, I.
2011-01-01
Purpose: To evaluate the diagnostic performance of ultrasound elastography in breast masses. Material and methods: 193 lesions (129 benign, 64 malignant) were analyzed with the EUB 8500 Logos-ultrasonic-unit (Hitachi Medical, Japan) and a linear-array-transducer of 7.5-13-MHz. Standard of reference was cytology (FNAfine needle aspiration) or histology (core biopsy). The elastic-score was classified according to a 6-point colour-scale (Ueno classification; 1-3 = benign, 4-5 = malignant). Conventional B-mode ultrasound (US) findings were classified according to the BI-RADS classification. Statistical analysis included sensitivity, specificity, ROC-analysis and kappa-values for intra-/interobserver reliability. Results: The mean score for elasticity was 4.1 ± 0.9 for malignant lesions, and 2.1 ± 1.0 for benign lesions (p < 0.001). With a best cut-off point between elasticity scores 3 and 4, sensitivity was 96.9%, and specificity 76%. Setting a best cut-off point for conventional US between BI-RADS 4 and 5, sensitivity was 57.8%, and specificity 96.1%. Elastography provided higher sensitivity and lower specificity than conventional US, but two lesions with elasticity score 1 were false negative, whereas no lesion scored BI-RADS 1-3 were false negative. ROC-curve was 0.884 for elastography, and 0.820 for conventional US (p < 0.001). Weighted kappa-values for intra-/interobserver reliability were 0.784/0.634 for BI-RADS classification, and 0.720/0.561 for elasticity scores. Conclusion: In our study setting, elastography does not have the potential to replace conventional B-mode US for the detection of breast cancer, but may complement conventional US to improve the diagnostic performance.
Mets, E; Van der Meulen, J; Van Peer, G; Boice, M; Mestdagh, P; Van de Walle, I; Lammens, T; Goossens, S; De Moerloose, B; Benoit, Y; Van Roy, N; Clappier, E; Poppe, B; Vandesompele, J; Wendel, H-G; Taghon, T; Rondou, P; Soulier, J; Van Vlierberghe, P; Speleman, F
2015-04-01
The MYB oncogene is a leucine zipper transcription factor essential for normal and malignant hematopoiesis. In T-cell acute lymphoblastic leukemia (T-ALL), elevated MYB levels can arise directly through T-cell receptor-mediated MYB translocations, genomic MYB duplications or enhanced TAL1 complex binding at the MYB locus or indirectly through the TAL1/miR-223/FBXW7 regulatory axis. In this study, we used an unbiased MYB 3'untranslated region-microRNA (miRNA) library screen and identified 33 putative MYB-targeting miRNAs. Subsequently, transcriptome data from two independent T-ALL cohorts and different subsets of normal T-cells were used to select miRNAs with relevance in the context of normal and malignant T-cell transformation. Hereby, miR-193b-3p was identified as a novel bona fide tumor-suppressor miRNA that targets MYB during malignant T-cell transformation thereby offering an entry point for efficient MYB targeting-oriented therapies for human T-ALL.
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
Directory of Open Access Journals (Sweden)
Sara Nunes
2018-04-01
Full Text Available Localized cutaneous leishmaniasis (LCL is a chronic disease characterized by ulcerated skin lesion(s and uncontrolled inflammation. The mechanisms underlying the pathogenesis of LCL are not completely understood, and little is known about posttranscriptional regulation during LCL. MicroRNAs (miRNAs are non-coding small RNAs that regulate gene expression and can be implicated in the pathogenesis of LCL. We investigated the involvement of miRNAs and their targets genes in human LCL using publicly available transcriptome data sets followed by ex vivo validation. Initial analysis highlighted that miRNA expression is altered during LCL, as patients clustered separately from controls. Joint analysis identified eight high confidence miRNAs that had altered expression (−1.5 ≤ fold change ≥ 1.5; p < 0.05 between cutaneous ulcers and uninfected skin. We found that the expression of miR-193b and miR-671 are greatly associated with their target genes, CD40 and TNFR, indicating the important role of these miRNAs in the expression of genes related to the inflammatory response observed in LCL. In addition, network analysis revealed that miR-193b, miR-671, and TREM1 correlate only in patients who show faster wound healing (up to 59 days and not in patients who require longer cure times (more than 60 days. Given that these miRNAs are associated with control of inflammation and healing time, our findings reveal that they might influence the pathogenesis and prognosis of LCL.
Forward J /ψ production in U + U collisions at √{sN N}=193 GeV
Adare, A.; Aidala, C.; Ajitanand, N. N.; Akiba, Y.; Akimoto, R.; Alexander, J.; Alfred, M.; Aoki, K.; Apadula, N.; Asano, H.; Atomssa, E. T.; Awes, T. C.; Azmoun, B.; Babintsev, V.; Bai, M.; Bai, X.; Bandara, N. S.; Bannier, B.; Barish, K. N.; Bathe, S.; Baublis, V.; Baumann, C.; Baumgart, S.; Bazilevsky, A.; Beaumier, M.; Beckman, S.; Belmont, R.; Berdnikov, A.; Berdnikov, Y.; Black, D.; Blau, D. S.; Bok, J. S.; Boyle, K.; Brooks, M. L.; Bryslawskyj, J.; Buesching, H.; Bumazhnov, V.; Butsyk, S.; Campbell, S.; Chen, C.-H.; Chi, C. Y.; Chiu, M.; Choi, I. J.; Choi, J. B.; Choi, S.; Christiansen, P.; Chujo, T.; Cianciolo, V.; Citron, Z.; Cole, B. A.; Cronin, N.; Crossette, N.; Csanád, M.; Csörgő, T.; Danley, T. W.; Datta, A.; Daugherity, M. S.; David, G.; Deblasio, K.; Dehmelt, K.; Denisov, A.; Deshpande, A.; Desmond, E. J.; Ding, L.; Dion, A.; Diss, P. B.; Do, J. H.; D'Orazio, L.; Drapier, O.; Drees, A.; Drees, K. A.; Durham, J. M.; Durum, A.; Engelmore, T.; Enokizono, A.; Esumi, S.; Eyser, K. O.; Fadem, B.; Feege, N.; Fields, D. E.; Finger, M.; Finger, M.; Fleuret, F.; Fokin, S. L.; Frantz, J. E.; Franz, A.; Frawley, A. D.; Fukao, Y.; Fusayasu, T.; Gainey, K.; Gal, C.; Gallus, P.; Garg, P.; Garishvili, A.; Garishvili, I.; Ge, H.; Giordano, F.; Glenn, A.; Gong, X.; Gonin, M.; Goto, Y.; Granier de Cassagnac, R.; Grau, N.; Greene, S. V.; Grosse Perdekamp, M.; Gu, Y.; Gunji, T.; Guragain, H.; Hachiya, T.; Haggerty, J. S.; Hahn, K. I.; Hamagaki, H.; Hamilton, H. F.; Han, S. Y.; Hanks, J.; Hasegawa, S.; Haseler, T. O. S.; Hashimoto, K.; Hayano, R.; He, X.; Hemmick, T. K.; Hester, T.; Hill, J. C.; Hollis, R. S.; Homma, K.; Hong, B.; Hoshino, T.; Hotvedt, N.; Huang, J.; Huang, S.; Ichihara, T.; Ikeda, Y.; Imai, K.; Imazu, Y.; Inaba, M.; Iordanova, A.; Isenhower, D.; Isinhue, A.; Ivanishchev, D.; Jacak, B. V.; Jeon, S. J.; Jezghani, M.; Jia, J.; Jiang, X.; Johnson, B. M.; Joo, K. S.; Jouan, D.; Jumper, D. S.; Kamin, J.; Kanda, S.; Kang, B. H.; Kang, J. H.; Kang, J. S.; Kapustinsky, J.; Kawall, D.; Kazantsev, A. V.; Key, J. A.; Khachatryan, V.; Khandai, P. K.; Khanzadeev, A.; Kijima, K. M.; Kim, C.; Kim, D. J.; Kim, E.-J.; Kim, G. W.; Kim, M.; Kim, Y.-J.; Kim, Y. K.; Kimelman, B.; Kistenev, E.; Kitamura, R.; Klatsky, J.; Kleinjan, D.; Kline, P.; Koblesky, T.; Kofarago, M.; Komkov, B.; Koster, J.; Kotchetkov, D.; Kotov, D.; Krizek, F.; Kurita, K.; Kurosawa, M.; Kwon, Y.; Lacey, R.; Lai, Y. S.; Lajoie, J. G.; Lebedev, A.; Lee, D. M.; Lee, G. H.; Lee, J.; Lee, K. B.; Lee, K. S.; Lee, S.; Lee, S. H.; Leitch, M. J.; Leitgab, M.; Lewis, B.; Li, X.; Lim, S. H.; Liu, M. X.; Lynch, D.; Maguire, C. F.; Makdisi, Y. I.; Makek, M.; Manion, A.; Manko, V. I.; Mannel, E.; Maruyama, T.; McCumber, M.; McGaughey, P. L.; McGlinchey, D.; McKinney, C.; Meles, A.; Mendoza, M.; Meredith, B.; Miake, Y.; Mibe, T.; Mignerey, A. C.; Milov, A.; Mishra, D. K.; Mitchell, J. T.; Miyasaka, S.; Mizuno, S.; Mohanty, A. K.; Mohapatra, S.; Montuenga, P.; Moon, T.; Morrison, D. P.; Moskowitz, M.; Moukhanova, T. V.; Murakami, T.; Murata, J.; Mwai, A.; Nagae, T.; Nagamiya, S.; Nagashima, K.; Nagle, J. L.; Nagy, M. I.; Nakagawa, I.; Nakagomi, H.; Nakamiya, Y.; Nakamura, K. R.; Nakamura, T.; Nakano, K.; Nattrass, C.; Netrakanti, P. K.; Nihashi, M.; Niida, T.; Nishimura, S.; Nouicer, R.; Novák, T.; Novitzky, N.; Nyanin, A. S.; O'Brien, E.; Ogilvie, C. A.; Oide, H.; Okada, K.; Orjuela Koop, J. D.; Osborn, J. D.; Oskarsson, A.; Ozawa, K.; Pak, R.; Pantuev, V.; Papavassiliou, V.; Park, I. H.; Park, J. S.; Park, S.; Park, S. K.; Pate, S. F.; Patel, L.; Patel, M.; Peng, J.-C.; Perepelitsa, D. V.; Perera, G. D. N.; Peressounko, D. Yu.; Perry, J.; Petti, R.; Pinkenburg, C.; Pinson, R.; Pisani, R. P.; Purschke, M. L.; Qu, H.; Rak, J.; Ramson, B. J.; Ravinovich, I.; Read, K. F.; Reynolds, D.; Riabov, V.; Riabov, Y.; Richardson, E.; Rinn, T.; Riveli, N.; Roach, D.; Rolnick, S. D.; Rosati, M.; Rowan, Z.; Rubin, J. G.; Ryu, M. S.; Sahlmueller, B.; Saito, N.; Sakaguchi, T.; Sako, H.; Samsonov, V.; Sarsour, M.; Sato, S.; Sawada, S.; Schaefer, B.; Schmoll, B. K.; Sedgwick, K.; Seele, J.; Seidl, R.; Sekiguchi, Y.; Sen, A.; Seto, R.; Sett, P.; Sexton, A.; Sharma, D.; Shaver, A.; Shein, I.; Shibata, T.-A.; Shigaki, K.; Shimomura, M.; Shoji, K.; Shukla, P.; Sickles, A.; Silva, C. L.; Silvermyr, D.; Singh, B. K.; Singh, C. P.; Singh, V.; Skolnik, M.; Slunečka, M.; Snowball, M.; Solano, S.; Soltz, R. A.; Sondheim, W. E.; Sorensen, S. P.; Sourikova, I. V.; Stankus, P. W.; Steinberg, P.; Stenlund, E.; Stepanov, M.; Ster, A.; Stoll, S. P.; Stone, M. R.; Sugitate, T.; Sukhanov, A.; Sumita, T.; Sun, J.; Sziklai, J.; Takahara, A.; Taketani, A.; Tanaka, Y.; Tanida, K.; Tannenbaum, M. J.; Tarafdar, S.; Taranenko, A.; Tennant, E.; Tieulent, R.; Timilsina, A.; Todoroki, T.; Tomášek, M.; Torii, H.; Towell, C. L.; Towell, R.; Towell, R. S.; Tserruya, I.; van Hecke, H. W.; Vargyas, M.; Vazquez-Zambrano, E.; Veicht, A.; Velkovska, J.; Vértesi, R.; Virius, M.; Vrba, V.; Vznuzdaev, E.; Wang, X. R.; Watanabe, D.; Watanabe, K.; Watanabe, Y.; Watanabe, Y. S.; Wei, F.; Whitaker, S.; White, A. S.; Wolin, S.; Woody, C. L.; Wysocki, M.; Xia, B.; Xue, L.; Yalcin, S.; Yamaguchi, Y. L.; Yanovich, A.; Yokkaichi, S.; Yoo, J. H.; Yoon, I.; You, Z.; Younus, I.; Yu, H.; Yushmanov, I. E.; Zajc, W. A.; Zelenski, A.; Zhou, S.; Zou, L.; Phenix Collaboration
2016-03-01
The invariant yields, d N /d y , for J /ψ production at forward rapidity (1.2 <|y |<2.2 ) in U +U collisions at √{sNN}=193 GeV have been measured as a function of collision centrality. The invariant yields and nuclear-modification factor RA A are presented and compared with those from Au +Au collisions in the same rapidity range. Additionally, the direct ratio of the invariant yields from U +U and Au +Au collisions within the same centrality class is presented, and used to investigate the role of c c ¯ coalescence. Two different parametrizations of the deformed Woods-Saxon distribution were used in Glauber calculations to determine the values of the number of nucleon-nucleon collisions in each centrality class, Ncoll, and these were found to give significantly different Ncoll values. Results using Ncoll values from both deformed Woods-Saxon distributions are presented. The measured ratios show that the J /ψ suppression, relative to binary collision scaling, is similar in U +U and Au +Au for peripheral and midcentral collisions, but that J /ψ show less suppression for the most central U +U collisions. The results are consistent with a picture in which, for central collisions, increase in the J /ψ yield due to c c ¯ coalescence becomes more important than the decrease in yield due to increased energy density. For midcentral collisions, the conclusions about the balance between c c ¯ coalescence and suppression depend on which deformed Woods-Saxon distribution is used to determine Ncoll.
Testing of nuclear grade lubricants and their effects on A540 B24 and A193 B7 bolting materials
International Nuclear Information System (INIS)
Czajkowski, C.J.
1985-01-01
An investigation was performed on eleven commonly used lubricants by the nuclear power industry. The investigation included EDS analysis of the lubricants, notched-tensile constant extension rate testing of bolting materials with the lubricants, frictional testing of the lubricants and weight loss testing of a bonded solid film lubricant. The report generally concludes that there is a significant amount of variance in the mechanical properties of common bolting materials; that MoS 2 can hydrolyze to form H 2 S at 100 0 C and cause stress corrosion cracking (SCC) of bolting materials, and that the use of copper-containing lubricants can be potentially detrimental to high strength steels in an aqueous environment. Additionally, the testing of various lubricants disclosed that some lubricants contain potentially detrimental elements (e.g. S, Sb) which can promote SCC of the common bolting materials. One of the most significant findings of this report is the observation that both A193 B7 and A540 B24 bolting materials are susceptible to transgranular stress corrosion cracking in demineralized H 2 O at 280 0 C in notched tensile tests
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
International Nuclear Information System (INIS)
Chang, C.-M.; Huang, Y.-H.; Liu, S.-Y.; Lee, Y.-P.; Pombar-Perez, Marta; Martinez-Nunez, Emilio; Vazquez, Saulo A.
2008-01-01
Following photodissociation of 2-chloropropene (H 2 CCClCH 3 ) at 193 nm, vibration-rotationally resolved emission spectra of HCl (υ≤6) in the spectral region of 1900-2900 cm -1 were recorded with a step-scan time-resolved Fourier-transform spectrometer. All vibrational levels show a small low-J component corresponding to ∼400 K and a major high-J component corresponding to 7100-18 700 K with average rotational energy of 39± 3 11 kJ mol -1 . The vibrational population of HCl is inverted at υ=2, and the average vibrational energy is 86±5 kJ mol -1 . Two possible channels of molecular elimination producing HCl+propyne or HCl+allene cannot be distinguished positively based on the observed internal energy distribution of HCl. The observed rotational distributions fit qualitatively with the distributions of both channels obtained with quasiclassical trajectories (QCTs), but the QCT calculations predict negligible populations for states at small J. The observed vibrational distribution agrees satisfactorily with the total QCT distribution obtained as a weighted sum of contributions from both four-center elimination channels. Internal energy distributions of HCl from 2-chloropropene and vinyl chloride are compared.
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
Wang, Chuanyuan; Liu, Xing; Guo, Jie; Lv, Yingchun; Li, Yuanwei
2018-09-15
Bioremediation, mainly by indigenous bacteria, has been regarded as an effective way to deal with the petroleum pollution after an oil spill accident. The biodegradation of crude oil by microorganisms co-incubated from sediments collected from the Penglai 19-3 oil platform, Bohai Sea, China, was examined. The relative susceptibility of the isomers of alkylnaphthalenes, alkylphenanthrenes and alkyldibenzothiophene to biodegradation was also discussed. The results showed that the relative degradation values of total petroleum hydrocarbon (TPH) are 43.56% and 51.29% for sediments with untreated microcosms (S-BR1) and surfactant-treated microcosms (S-BR2), respectively. TPH biodegradation results showed an obvious decrease in saturates (biodegradation rate: 67.85-77.29%) and a slight decrease in aromatics (biodegradation rate: 47.13-57.21%), while no significant difference of resins and asphaltenes was detected. The biodegradation efficiency of alkylnaphthalenes, alkylphenanthrenes and alkyldibenzothiophene for S-BR1 and S-BR2 samples reaches 1.28-84.43% and 42.56-86.67%, respectively. The efficiency of crude oil degradation in sediment with surfactant-treated microcosms cultures added Tween 20, was higher than that in sediment with untreated microcosms. The biodegradation and selective depletion is not only controlled by thermodynamics but also related to the stereochemical structure of individual isomer compounds. Information on the biodegradation of oil spill residues by the bacterial community revealed in this study will be useful in developing strategies for bioremediation of crude oil dispersed in the marine ecosystem. Copyright © 2018 Elsevier Inc. All rights reserved.
Alligood, Bridget W.; FitzPatrick, Benjamin L.; Szpunar, David E.; Butler, Laurie J.
2011-02-01
We use a combination of crossed laser-molecular beam experiments and velocity map imaging experiments to investigate the primary photofission channels of chloroacetone at 193 nm; we also probe the dissociation dynamics of the nascent CH3C(O)CH2 radicals formed from C-Cl bond fission. In addition to the C-Cl bond fission primary photodissociation channel, the data evidence another photodissociation channel of the precursor, C-C bond fission to produce CH3CO and CH2Cl. The CH3C(O)CH2 radical formed from C-Cl bond fission is one of the intermediates in the OH + allene reaction en route to CH3 + ketene. The 193 nm photodissociation laser allows us to produce these CH3C(O)CH2 radicals with enough internal energy to span the dissociation barrier leading to the CH3 + ketene asymptote. Therefore, some of the vibrationally excited CH3C(O)CH2 radicals undergo subsequent dissociation to CH3 + ketene products; we are able to measure the velocities of these products using both the imaging and scattering apparatuses. The results rule out the presence of a significant contribution from a C-C bond photofission channel that produces CH3 and COCH2Cl fragments. The CH3C(O)CH2 radicals are formed with a considerable amount of energy partitioned into rotation; we use an impulsive model to explicitly characterize the internal energy distribution. The data are better fit by using the C-Cl bond fission transition state on the S1 surface of chloroacetone as the geometry at which the impulsive force acts, not the Franck-Condon geometry. Our data suggest that, even under atmospheric conditions, the reaction of OH with allene could produce a small branching to CH3 + ketene products, rather than solely producing inelastically stabilized adducts. This additional channel offers a different pathway for the OH-initiated oxidation of such unsaturated volatile organic compounds, those containing a C=C=C moiety, than is currently included in atmospheric models.
International Nuclear Information System (INIS)
O'Neill, J.A.; Cai, J.Y.; Flynn, G.W.; Weston, R.E. Jr.
1986-01-01
The 193 nm excimer laser photolysis of D 2 S in D 2 S/CO 2 mixtures produces fast deuterium atoms (E/sub TR/approx.2.2 eV) which vibrationally excite CO 2 molecules via inelastic translation--vibration/rotation (T--V/R) energy exchange processes. A high resolution (10 -3 cm -1 ) cw diode laser probe was used to monitor the excitation of ν 3 (antisymmetric stretch) and ν 2 (bend) vibrations in CO 2 . The present results are compared with previous experiments involving hot hydrogen atom excitation of CO 2 in H 2 S/CO 2 mixtures as well as with theoretical calculations of the excitation probability. The probability for excitation of a ν 3 quantum in CO 2 is about 1%--2% per gas kinetic D/CO 2 collision. Bending (ν 2 ) quanta are produced about eight times more efficiently than antisymmetric stretching (ν 3 ) quanta. The thermalization rate for cooling hot D atoms below the threshold for production of a ν 3 vibrational quantum corresponds to less than 2 D*/D 2 S collisions or 15 D*/CO 2 collisions
Maximilien Brice
2012-01-01
18 June 2012 - DST Global Founder Y. Milner signing the guest book with Head of International Relations F. Pauss; visiting the AD facility in building 193 with AEGIS Collaboration Spokesperson M. Doser and Adviser for the Russian Federation T. Kurtyka. Managing Director I. Osborne also present with Mrs J. Milner and DST Global A. Lebedkina.
Alligood, Bridget W.; Straus, Daniel B.; Butler, Laurie J.
2011-07-01
We use a combination of crossed laser-molecular beam scattering experiments and velocity map imaging experiments to investigate the three primary photodissociation channels of chloroacetone at 193 nm: C-Cl bond photofission yielding CH3C(O)CH2 radicals, C-C bond photofission yielding CH3CO and CH2Cl products, and C-CH3 bond photofission resulting in CH3 and C(O)CH2Cl products. Improved analysis of data previously reported by our group quantitatively identifies the contribution of this latter photodissociation channel. We introduce a forward convolution procedure to identify the portion of the signal, derived from the methyl image, which results from a two-step process in which C-Cl bond photofission is followed by the dissociation of the vibrationally excited CH3C(O)CH2 radicals to CH3 + COCH2. Subtracting this from the total methyl signal identifies the methyl photofragments that result from the CH3 + C(O)CH2Cl photofission channel. We find that about 89% of the chloroacetone molecules undergo C-Cl bond photofission to yield CH3C(O)CH2 and Cl products; approximately 8% result in C-C bond photofission to yield CH3CO and CH2Cl products, and the remaining 2.6% undergo C-CH3 bond photofission to yield CH3 and C(O)CH2Cl products.
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
African Journals Online (AJOL)
Administrator
Results: Age >60 years, female sex, presence of diabetic retinopathy (DR), proliferative DR, shorter DM duration, glaucoma, macular ... visual disability was significantly associated with female sex and diabetic retinopathy. .... Only older age,.
International Nuclear Information System (INIS)
Szpunar, D.E.; Liu, Y.; McCullagh, M.J.; Butler, L.J.; Shu, J.
2003-01-01
The photodissociation of allyl-d2 iodide (H2C=CDCH2I) and the dynamics of the nascent allyl-d2 radical (H2CCDCH2) were studied using photofragment translational spectroscopy. A previous study found the allyl radical stable at internal energies up to 15 kcal/mol higher than the 60 kcal/mol barrier to allene + H formation as the result of a centrifugal barrier. The deuterated allyl radical should then also show a stability to secondary dissociation at internal energies well above the barrier due to centrifugal effects. A comparison in this paper shows the allyl-d2 radical is stable to allene + D formation at energies of 2-3 kcal/mol higher than that of the non-deuterated allyl radical following photolysis of allyl iodide at 193 nm. This is most likely a result of a combination of the slight raising of the barrier from the difference in zero-point levels and a reduction of the impact parameter of the dissociative fragments due to the decrease in frequency of the C-D bending modes, and the refore allene + D product orbital angular momentum. Integrated signal taken at m/e = 40 (allene) and m/e = 41 (allene-d1 and propyne-d3) shows a minor fraction of the allyl-d2 radicals isomerize to the 2-propenyl radical, in qualitative support of earlier conclusions of the domination of direct allene + H formation over isomerization
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
Description of identical superdeformed bands of the A ∝ 190 mass region
International Nuclear Information System (INIS)
Dadwal, Anshul; Mittal, H.M.
2017-01-01
The two-parameter formula/model viz. nuclear softness (NS) formula, semiclassical particle rotor model (PRM) and exponential model with pairing attenuation are used for the reliable phenomenological analysis of identical superdeformed bands. These formulae/models are employed to study the identical superdeformed bands of the A ∝ 190 mass region, {"1"9"1Hg(2), "1"9"3Hg(2)}, {"1"9"1Hg(3), "1"9"3Hg(3)}, {"1"9"3Tl(3), "1"9"3Tl(5)}, {"1"9"3Tl(1), "1"9"4Tl(3)}, {"1"9"3Tl(1), "1"9"4Tl(4)}, {"1"9"3Pb(3), "1"9"1Hg(2)}, {"1"9"3Pb(4), "1"9"1Hg(3)}, {"1"9"4Pb(1), "1"9"2Hg(1)}, {"1"9"4Pb(1), "1"9"4Hg(1)} and middle-point identical bands {"1"9"3Tl(1), "1"9"3Tl(2)}, {"1"9"3Tl(1), "1"9"5Tl(1)} and {"1"9"3Tl(2), "1"9"5Tl(2)}. Quantitatively, good results of γ-ray transitions energies and dynamic moment of inertia are obtained using the NS formula. The parameters, band-head moment of inertia (I_0), alignment (i) and effective pairing parameter (Δ_0) are calculated using the least-squares fitting of the γ-ray transitions energies in the NS formula, semiclassical PRM and exponential model with pairing attenuation, respectively. The calculated parameters are found to depend sensitively on the proposed band-head spin. (orig.)
Description of identical superdeformed bands of the A ∝ 190 mass region
Energy Technology Data Exchange (ETDEWEB)
Dadwal, Anshul; Mittal, H.M. [Dr. B.R. Ambedkar National Institute of Technology, Jalandhar (India)
2017-06-15
The two-parameter formula/model viz. nuclear softness (NS) formula, semiclassical particle rotor model (PRM) and exponential model with pairing attenuation are used for the reliable phenomenological analysis of identical superdeformed bands. These formulae/models are employed to study the identical superdeformed bands of the A ∝ 190 mass region, {"1"9"1Hg(2), "1"9"3Hg(2)}, {"1"9"1Hg(3), "1"9"3Hg(3)}, {"1"9"3Tl(3), "1"9"3Tl(5)}, {"1"9"3Tl(1), "1"9"4Tl(3)}, {"1"9"3Tl(1), "1"9"4Tl(4)}, {"1"9"3Pb(3), "1"9"1Hg(2)}, {"1"9"3Pb(4), "1"9"1Hg(3)}, {"1"9"4Pb(1), "1"9"2Hg(1)}, {"1"9"4Pb(1), "1"9"4Hg(1)} and middle-point identical bands {"1"9"3Tl(1), "1"9"3Tl(2)}, {"1"9"3Tl(1), "1"9"5Tl(1)} and {"1"9"3Tl(2), "1"9"5Tl(2)}. Quantitatively, good results of γ-ray transitions energies and dynamic moment of inertia are obtained using the NS formula. The parameters, band-head moment of inertia (I{sub 0}), alignment (i) and effective pairing parameter (Δ{sub 0}) are calculated using the least-squares fitting of the γ-ray transitions energies in the NS formula, semiclassical PRM and exponential model with pairing attenuation, respectively. The calculated parameters are found to depend sensitively on the proposed band-head spin. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Zauderer, B. Ashley; Bolatto, Alberto D.; Vogel, Stuart N.; Curley, Roger; Pound, Marc W.; Mundy, Lee G.; Teng, Stacy H.; Teuben, Peter J. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Carpenter, John M. [California Institute of Technology, Department of Astronomy, MC 249-17, Pasadena, CA 91125 (United States); Peréz, Laura M. [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States); Lamb, James W.; Woody, David P.; Leitch, Erik M.; Muchovej, Stephen J.; Volgenau, Nikolaus H. [California Institute of Technology, Owens Valley Radio Observatory, Big Pine, CA 93513 (United States); Bock, Douglas C.-J. [CSIRO Astronomy and Space Science, P.O. Box 76, Epping NSW 1710 (Australia); Carlstrom, John E.; Culverhouse, Thomas L. [Department of Astronomy and Astrophysics, University of Chicago, 5640 S. Ellis Ave., Chicago, IL 60637 (United States); Plambeck, Richard L. [Radio Astronomy Laboratory, University of California, Berkeley, 601 Campbell Hall, Berkeley, CA 94720 (United States); Marrone, Daniel P. [Department of Astronomy, Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); and others
2016-01-15
Phase fluctuations introduced by the atmosphere are the main limiting factor in attaining diffraction limited performance in extended interferometric arrays at millimeter and submillimeter wavelengths. We report the results of C-PACS, the Combined Array for Research in Millimeter-Wave Astronomy Paired Antenna Calibration System. We present a systematic study of several hundred test observations taken during the 2009–2010 winter observing season where we utilize CARMA's eight 3.5 m antennas to monitor an atmospheric calibrator while simultaneously acquiring science observations with 6.1 and 10.4 m antennas on baselines ranging from a few hundred meters to ∼2 km. We find that C-PACS is systematically successful at improving coherence on long baselines under a variety of atmospheric conditions. We find that the angular separation between the atmospheric calibrator and target source is the most important consideration, with consistently successful phase correction at CARMA requiring a suitable calibrator located ≲6° away from the science target. We show that cloud cover does not affect the success of C-PACS. We demonstrate C-PACS in typical use by applying it to the observations of the nearby very luminous infrared galaxy Arp 193 in {sup 12}CO(2-1) at a linear resolution of ≈70 pc (0.″12 × 0.″18), 3 times better than previously published molecular maps of this galaxy. We resolve the molecular disk rotation kinematics and the molecular gas distribution and measure the gas surface densities and masses on 90 pc scales. We find that molecular gas constitutes ∼30% of the dynamical mass in the inner 700 pc of this object with a surface density ∼10{sup 4} M{sub ⊙} pc{sup −2}; we compare these properties to those of the starburst region of NGC 253.
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
49 CFR 193.2005 - Applicability.
2010-10-01
... Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES..., design, installation, or construction of LNG facilities (including material incorporated by reference in...
2010-10-01
... Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES...] Materials ...
49 CFR 193.2007 - Definitions.
2010-10-01
.... Determine means make an appropriate investigation using scientific methods, reach a decision based on sound..., rights-of-way, and any equipment, facility, or building used in the transportation of gas or in the...
Energy Technology Data Exchange (ETDEWEB)
Conde, J.C.; Chiussi, S.; Gontad, F.; Gonzalez, P. [Dpto. Fisica Aplicada, E.T.S.I.I. University of Vigo, Campus Universitario, Rua Maxwell s/n, 36310 Vigo (Spain); Martin, E. [Dpto. de Mecanica, Maquinas, Motores Termicos y Fluidos, E.T.S.I.I. University of Vigo, Campus Universitario, Rua Maxwell s/n, 36310 Vigo (Spain)
2011-03-15
Research on epitaxial crystalline silicon (c-Si) and silicon-germanium (Si{sub 1-x}Ge{sub x}) alloys growth and annealing for microelectronic purposes, such as Micro- or Nano-Electro-Mechanical Systems (MEMS or NEMS) and Silicon-On-Nothing (SON) devices is continuously in progress. Laser assisted annealing techniques using commercial ArF Excimer Laser sources are based on ultra-rapid heating and cooling cycles induced by the 193 nm pulses of 20 ns, which are absorbed in the near surface region of the heterostructures. During and after the absorption of these laser pulses, complex physical processes appear that strongly depend on sample structure and applied laser pulse energy densities. The control of the experimental parameters is therefore a key task for obtaining high quality alloys. The Finite ElementsMethod (FEM) is a powerful tool for the optimization of such treatments, because it provides the spatial and temporal temperature fields that are produced by the laser pulses. In this work, we have used a FEM commercial software, to predict the temperatures gradients induced by ArF excimer laser over a wide energy densities range, 0.1<{phi}<0.4 J/cm{sup 2}, on different SiO{sub 2}/Si/Si{sub (1-x)}Ge{sub (x)} thin films deposited on SOI substrate. These numerical results allow us to predict the threshold energies needed to reach the melting point (MP) of the Si and SiGe alloy without oxidation of the thin films system. Therefore, it is possible to optimize the conditions to achieve high quality epitaxy films. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
Organizing Committee Panel of Referees 193
Indian Academy of Sciences (India)
, Panjab University. Vipin Bhatnagar, Panjab University. M M Gupta, Panjab University. Manjit Kaur, Panjab University. C N Kumar, Panjab University. Kuldeep Kumar, Panjab University (Secretary). G Rajasekaran, IMSc, Chennai.
Publications | Page 193 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity ... Through books, articles, research publications, and studies, we aim to widen the ... A paper by IDRC partner the International Network for Bamboo and Rattan ... In this region, the supply of houses in rural and urban areas has failed to ...
49 CFR 193.2167 - Covered systems.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... impounding system is prohibited except for concrete wall designed tanks where the concrete wall is an outer...
49 CFR 193.2509 - Emergency procedures.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... emergency, including catastrophic failure of an LNG storage tank. (4) Cooperating with appropriate local...
49 CFR 193.2905 - Protective enclosures.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... surrounded by a protective enclosure: (1) Storage tanks; (2) Impounding systems; (3) Vapor barriers; (4...
49 CFR 193.2067 - Wind forces.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... confining, structure; and (3) In the case of impounding systems for LNG storage tanks, impact forces and...
49 CFR 193.2155 - Structural requirements.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... train, tank car, or tank truck that could reasonably be expected to cause the most severe loading. (b) An LNG storage tank must not be located within a horizontal distance of one mile (1.6 km) from the...
49 CFR 193.2513 - Transfer procedures.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... Practice.” (2) Before transfer, verify that each receiving container or tank vehicle does not contain any... volume of each receiving container or tank vehicle to ensure that expansion of the incoming fluid due to...
49 CFR 193.2619 - Control systems.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES..., and control systems for internal shutoff valves for bottom penetration tanks must be inspected and...
2010-10-01
... and are required to be fitted with a delayed discharge system other than paint and lamp lockers and... as to sound during the 20-second delay period prior to the discharge of carbon dioxide into the space...
Publications | Page 193 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Financing Incidence Analysis of Health Financing in Zimbabwe : skills workshop report, ... The work on Financing Incidence. ... Rapid urbanization in settings of poor economic performance and governance ... We apply propensity score matching techniques to analyze the impact of public financial support to innovation in.
1980-01-01
See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
193-IJBCS-Article-Dr Aboubakar Dandjouma
African Journals Online (AJOL)
RHUMSIKI
Evolution de quelques paramètres de qualité physico–chimique de l'huile de la pulpe des fruits de Canarium schweinfurthii Engl. au cours du stockage. Almeck K. ABOUBAKAR DANDJOUMA 1*, Clergé TCHIEGANG 2 et Michel. PARMENTIER 3. 1 Laboratoire de Technologie Agro–Alimentaire, Station Polyvalente IRAD ...
49 CFR 193.2511 - Personnel safety.
2010-10-01
... Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... or a means of escape. (c) Each LNG plant must be equipped with suitable first-aid material, the...
Publications | Page 193 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact ... in a variety of disciplines, generating ideas and building international networks. ENACQKT-ing : Caribbean nurses enhancing care, quality and knowledge ... On-the-job learning and earnings : comparative evidence from Morocco and ...
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
1983-01-01
PARKIN LOT MAINTENANCE YUIA ARIZONA 82 82 ZILLOENS HEIAN ASSOCIATES YUMA ARIZONA 272 272 20,462 13,094 6,681 60 627 1,359,748 428,327 353,827 545,807...INC MORGANZA LOUISIANA 335 335 1,715 29 1,686 RAYS CONSTRUCTION CO NAIRN LOUISIANA 400 400 400 400 MARY LOU FASHIONS NATCHITOCHES LOUISIANA 193 193 193
Photodissociation dynamics of polyatomic molecules
Energy Technology Data Exchange (ETDEWEB)
Zhao, Hequan [Iowa State Univ., Ames, IA (United States)
1998-02-23
This report consists of five studies as follows: A laser photofragmentation time-of-flight mass spectrometric study of acetophenone at 193 and 248 nm; A 193 nm laser photofragmentation time-of-flight mass spectrometric study of dimethylsulfoxide; 193 nm laser photofragmentation time-of-flight mass spectrometric study of HSCH2CH2SH; Thiophene biradical decay of the primary laser photofragmentation product at 193 nm; and Scattering cross sections for O(3P)[SO(X,3Σ-)] + He[Ne, Ar, Kr]. Chapters are included for the introduction and general conclusions.
Energy Technology Data Exchange (ETDEWEB)
Jetzt, Amanda E. [Department of Animal Sciences, Rutgers, The State University of New Jersey, New Brunswick, NJ 08901-8520 (United States); Li, Xiao-Ping; Tumer, Nilgun E. [Department of Plant Biology and Pathology, Rutgers, The State University of New Jersey, New Brunswick, NJ 08901-8520 (United States); Cohick, Wendie S., E-mail: cohick@aesop.rutgers.edu [Department of Animal Sciences, Rutgers, The State University of New Jersey, New Brunswick, NJ 08901-8520 (United States)
2016-11-01
Ricin is a potent ribotoxin that is considered a bioterror threat due to its ease of isolation and possibility of aerosolization. In yeast, mutation of arginine residues away from the active site results in a ricin toxin A chain (RTA) variant that is unable to bind the ribosome and exhibits reduced cytotoxicity. The goal of the present work was to determine if these residues contribute to ribosome binding and cytotoxicity of RTA in mammalian cells. The RTA mutant R193A/R235A did not interact with mammalian ribosomes, while a G212E variant with a point mutation near its active site bound ribosomes similarly to wild-type (WT) RTA. R193A/R235A retained full catalytic activity on naked RNA but had reduced activity on mammalian ribosomes. To determine the effect of this mutant in intact cells, pre R193A/R235A containing a signal sequence directing it to the endoplasmic reticulum and mature R193A/R235A that directly targeted cytosolic ribosomes were each expressed. Depurination and protein synthesis inhibition were reduced by both pre- and mature R193A/R235A relative to WT. Protein synthesis inhibition was reduced to a greater extent by R193A/R235A than by G212E. Pre R193A/R235A caused a greater reduction in caspase activation and loss of mitochondrial membrane potential than G212E relative to WT RTA. These findings indicate that an RTA variant with reduced ribosome binding is less toxic than a variant with less catalytic activity but normal ribosome binding activity. The toxin-ribosome interaction represents a novel target for the development of therapeutics to prevent or treat ricin intoxication. - Highlights: • Arginines 193 and 235 of RTA are critical for binding to the mammalian ribosome. • R193A/R235A has full catalytic activity on RNA but not on mammalian ribosomes. • R193A/R235A is less toxic than a mutant that targets the active site. • The toxin-ribosome interaction is a therapeutic target for ricin intoxication.
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
40 CFR 98.193 - Calculating GHG emissions.
2010-07-01
.... Calcium oxide and magnesium oxide content must be analyzed monthly for each lime type: ER30OC09.073 Where... subpart) (metric tons CO2/metric tons MgO). CaOi,n = Calcium oxide content for lime type i, for month n... = Calcium oxide content for sold lime byproduct/waste type i, for month n (metric tons CaO/metric ton lime...
Overall view of AA in Bld. 193
1980-01-01
See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
49 CFR 193.2001 - Scope of part.
2010-10-01
... Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES... LNG facilities used in the transportation of gas by pipeline that is subject to the pipeline safety...
49 CFR 193.2013 - Incorporation by reference.
2010-10-01
... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL... incorporated materials are available for inspection in the Pipeline and Hazardous Materials Safety... referenced material 49 CFR Reference A. American Gas Association (AGA): (1) “Purging Principles and Practices...
14 CFR 21.193 - Experimental certificates: general.
2010-01-01
... three-view dimensioned photographs of the aircraft. (e) In the case of a light-sport aircraft assembled... aircraft kit manufacturer and issued a special airworthiness certificate in the light-sport category. (2... supplement. (6) In addition to paragraphs (e)(1) through (e)(5) of this section, for an aircraft kit...
34 CFR 668.193 - Loan servicing appeals.
2010-07-01
... default rate; or (2) Any cohort default rate upon which a loss of eligibility under § 668.187 is based. (b... request for preclaims or default aversion assistance to the guaranty agency; and (ii) Submit a...
32 CFR 193.4 - Authorities and responsibilities.
2010-07-01
... Assistant Secretary of Defense (Installations and Logistics), will: (1) Coordinate the defense... transportation engineering practices, statutory provisions, and policies and procedures of the Bureau of Public... utilization of such highways by military vehicles. (7) Provide highway traffic engineering services to DoD...
Liu, Zhanqi; Panousis, Con; Smyth, Fiona E; Murphy, Roger; Wirth, Veronika; Cartwright, Glenn; Johns, Terrance G; Scott, Andrew M
2003-08-01
The chimeric monoclonal antibody ch806 specifically targets the tumor-associated mutant epidermal growth factor receptor (de 2-7EGFR or EGFRVIII) and is currently under investigation for its potential use in cancer therapy. The humanised monoclonal antibody hu3S193 specifically targets the Lewis Y epithelial antigen and is currently in Phase I clinical trials in patients with advanced breast, colon, and ovarian carcinomas. To assist the clinical evaluation of ch806 and hu3S193, laboratory assays are required to monitor their serum pharmacokinetics and quantitate any immune responses to the antibodies. Mice immunized with ch806 or hu3S193 were used to generate hybridomas producing antibodies with specific binding to ch806 or hu3S193 and competitive for antigen binding. These anti-idiotype antibodies (designated Ludwig Melbourne Hybridomas, LMH) were investigated as reagents suitable for use as positive controls for HAHA or HACA analyses and for measuring hu3S193 or ch806 in human serum. Anti-idiotypes with the ability to concurrently bind two target antibody molecules were identified, which enabled the development of highly reproducible, sensitive, specific ELISA assays for determining serum concentrations of hu3S193 and ch806 with a 3 ng/mL limit of quantitation using LMH-3 and LMH-12, respectively. BIAcore analyses determined high apparent binding affinity for both idiotypes: LMH-3 binding immobilized hu3S193, Ka = 4.76 x 10(8) M(-1); LMH-12 binding immobilised ch806, Ka = 1.74 x 10(9) M(-1). Establishment of HAHA or HACA analysis of sera samples using BIAcore was possible using LMH-3 and LMH-12 as positive controls for quantitation of immune responses to hu3S193 or ch806 in patient sera. These anti-idiotypes could also be used to study the penetrance and binding of ch806 or hu3S193 to tumor cells through immunohistochemical analysis of tumor biopsies. The generation of anti-idiotype antibodies capable of concurrently binding a target antibody on each variable
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
African Journals Online (AJOL)
Items 151 - 193 of 193 ... Vol 4 (2005), Promoting aquatic tourism potentials of Nigerian parks: a case ... Vol 9 (2011), Rural Poultry Production in Ondo South Senatorial District ... doses of antibiotic-enrofloxacin (10%) on induced pseudomonas ...
Kim, Yong-Hak; Song, Wooseok; Kim, Jin-Sik; Jiao, Li; Lee, Kangseok; Ha, Nam-Chul
2015-08-01
The bacterial 2-nitroreductase NbaA is the primary enzyme initiating the degradation of 2-nitrobenzoate (2-NBA), and its activity is controlled by posttranslational modifications. To date, the structure of NbaA remains to be elucidated. In this study, the crystal structure of a Cys194Ala NbaA mutant was determined to a 1.7-Å resolution. The substrate analog 2-NBA methyl ester was used to decipher the substrate binding site by inhibition of the wild-type NbaA protein. Tandem mass spectrometry showed that 2-NBA methyl ester produced a 2-NBA ester bond at the Tyr193 residue in the wild-type NbaA but not residues in the Tyr193Phe mutant. Moreover, covalent binding of the 2-NBA methyl ester to Tyr193 reduced the reactivity of the Cys194 residue on the peptide link. The Tyr193 hydroxyl group was shown to be essential for enzyme catalysis, as a Tyr193Phe mutant resulted in fast dissociation of flavin mononucleotide (FMN) from the protein with the reduced reactivity of Cys194. FMN binding to NbaA varied with solution NaCl concentration, which was related to the catalytic activity but not to cysteine reactivity. These observations suggest that the Cys194 reactivity is negatively affected by a posttranslational modification of the adjacent Tyr193 residue, which interacts with FMN and the substrate in the NbaA catalytic site. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
DNA damage in cultured human skin fibroblasts exposed to excimer laser radiation
Energy Technology Data Exchange (ETDEWEB)
Rimoldi, D.; Miller, A.C.; Freeman, S.E.; Samid, D. (Department of Pathology, Uniformed Services University of the Health Sciences, Bethesda, MD (USA))
1991-06-01
Ultraviolet excimer lasers are being considered for use in a variety of refractive and therapeutic procedures, the long-term biologic consequences of which are unknown. The effect of sublethal doses of 193-nm laser radiation on cellular DNA was examined in cultured human skin fibroblasts. In contrast to 248 nm, treatments with the 193-nm laser radiation below 70 J/m2 did not cause significant pyrimidine dimer formation in the skin cells. This was indicated by the lack of excision repair activities (unscheduled DNA synthesis assay), and further demonstrated by direct analysis of pyrimidine dimers in DNA from irradiated cells. However, a low level of unscheduled DNA synthesis could be detected following irradiation at 193 nm with 70 J/m2. Both the 193-nm and 248-nm radiation were able to induce chromosomal aberrations, as indicated by a micronucleus assay. A dose-dependent increase in micronuclei frequency was observed 48 and 72 h after laser irradiation. These results indicate that exposure of actively replicating human skin fibroblasts to sublethal doses of either 193- or 248-nm laser radiation can result in genotoxicity.
Composition of heteropods in the Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Aravindakshan, P.N.; Stephen, R.
stream_size 4 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_193.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_193.pdf.txt Content-Encoding ISO-8859...
NCBI nr-aa BLAST: CBRC-CJAC-01-1298 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1298 ref|ZP_01054714.1| type I secretion target repeat protein [Roseob...acter sp. MED193] gb|EAQ47205.1| type I secretion target repeat protein [Roseobacter sp. MED193] ZP_01054714.1 5e-17 40% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1553 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1553 ref|ZP_01057726.1| Holliday junction DNA helicase RuvA [Roseobact...er sp. MED193] gb|EAQ44205.1| Holliday junction DNA helicase RuvA [Roseobacter sp. MED193] ZP_01057726.1 1.4 34% ...
Digital Repository Service at National Institute of Oceanography (India)
Raveendran, T.V.; Harada, E.
stream_size 9 stream_content_type text/plain stream_name Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt stream_source_info Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
High-Power, Solid-State, Deep Ultraviolet Laser Generation
Directory of Open Access Journals (Sweden)
Hongwen Xuan
2018-02-01
Full Text Available At present, deep ultraviolet (DUV lasers at the wavelength of fourth harmonics of 1 μm (266 nm/258 nm and at the wavelength of 193 nm are widely utilized in science and industry. We review the generation of these DUV lasers by nonlinear frequency conversion processes using solid-state/fiber lasers as the fundamental frequency. A DUV laser at 258 nm by fourth harmonics generation (FHG could achieve an average power of 10 W with a beam quality of M2 < 1.5. Moreover, 1 W of average power at 193 nm was obtained by sum-frequency generation (SFG. A new concept of 193-nm DUV laser generation by use of the diamond Raman laser is also introduced. A proof-of-principle experiment of the diamond Raman laser is reported with the conversion efficiency of 23% from the pump to the second Stokes wavelength, which implies the potential to generate a higher power 193 nm DUV laser in the future.
South Asia | Page 193 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Avec un revenu annuel d'environ 200 dollars US par habitant, la République ... examine the role of foreign private-sector firms, especially from Japan and the United States, in the recent and rapid economic growth and integration in East Asia.
South Asia | Page 193 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
With an annual income of approximately $200 US per capita, the Socialist Republic of ... the role of foreign private-sector firms, especially from Japan and the United States, in the recent and rapid economic growth and integration in East Asia.
Lifescience Database Archive (English)
Full Text Available skt*m*m**sw*kmlcxdsl**sl*frlwxrf*mxn*t*wfrxlcpfrktx xttt*km**xmptrp*mxsxstwkrmlrccpxttxkmlfkmsxkt*m*sqplw*rm...*xmptrp*mxsxstwkrmlrccpxttxkmlfkmsxkt*m*sqplw*rmxc*s sprxmfixmstrp*mxxxstwkrmxrccp*tttkmlxkmstxt*m*xqslw*rml
46 CFR 193.01-3 - Incorporation by reference.
2010-10-01
... http://www.archives.gov/federal_register/code_of_federal_regulations/ibr_locations.html. Also, it is... Conshohocken, PA 19428-2959, telephone 610-832-9585, http://www.astm.org. (1) ASTM F 1121-87 (1993), Standard... Park, Quincy, MA 02269-9101, telephone 800-344-3555, http://www.nfpa.org. (1) NFPA 13-1996, Standard...
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
EST Table: FS736730 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS736730 E_FL_bmmt_06M14_R_0 10/09/28 100 %/193 aa ref|NP_001037510.1| elongation f... dbj|BAA02601.1| elongation factor 1 alpha [Bombyx mori] 10/09/03 95 %/193 aa FBpp0257399|DyakGE12389-PA 10/
Characteristics of Low-latitude Coronal Holes near the Maximum of Solar Cycle 24
DEFF Research Database (Denmark)
Hofmeister, Stefan J.; Veronig, Astrid; Reiss, Martin A.
2017-01-01
We investigate the statistics of 288 low-latitude coronal holes extracted from SDO/AIA-193 filtergrams over the time range of 2011 January 01–2013 December 31. We analyze the distribution of characteristic coronal hole properties, such as the areas, mean AIA-193 intensities, and mean magnetic fie...
Directory of Open Access Journals (Sweden)
Ann Marie E Faust
Full Text Available In Saccharomyces cerevisiae mitosis, the protein Slk19 plays an important role in the initial release of Cdc14 phosphatase from the nucleolus to the nucleus in early anaphase, an event that is critical for proper anaphase progression. A role for Slk19 in later mitotic stages of Cdc14 regulation, however, has not been demonstrated. While investigating the role of Slk19 post-translational modification on Cdc14 regulation, we found that a triple point mutant of SLK19, slk19(3R (three lysine-to-arginine mutations, strongly affects Cdc14 localization during late anaphase and mitotic exit. Using fluorescence live-cell microscopy, we found that, similar to slk19Δ cells, slk19(3R cells exhibit no defect in spindle stability and only a mild defect in spindle elongation dynamics. Unlike slk19Δcells, however, slk19(3R cells exhibit no defect in Cdc14 release from the nucleolus to the nucleus. Instead, slk19(3R cells are defective in the timing of Cdc14 movement from the nucleus to the cytoplasm at the end of anaphase. This mutant has a novel phenotype: slk19(3R causes premature Cdc14 movement to the cytoplasm prior to, rather than concomitant with, spindle disassembly. One consequence of this premature Cdc14 movement is the inappropriate activation of the mitotic exit network, made evident by the fact that slk19(3R partially rescues a mutant of the mitotic exit network kinase Cdc15. In conclusion, in addition to its role in regulating Cdc14 release from the nucleolus to the nucleus, we found that Slk19 is also important for regulating Cdc14 movement from the nucleus to the cytoplasm at the end of anaphase.
2010-10-14
453.08 A 6530014667131 STRETCHER SURGICAL EASY ROLLING CASTERS 4 WHEEL BRAKE & STEER EA 1 1 500.00 30.00 $10,193.72 500.00 30.00 $10,193.72 A...required equipment and consumable items. Review of the output informs the appropriate modifications to the 917F line list for the Air Combat Command
African Journals Online (AJOL)
intentionally or accidentally), 10 (19.3%), and burning sensation, 10 (19.3%). The chest has the most symptomatic lesions with 15 (28.8%) and 9 (17.3%) patients having painful and itching lesions respectively. Attention needs to be paid to treatment of keloid symptoms which may make life unbearable to patients in addition ...
NOSC (Naval Ocean Systems Center) Program Manager’s Handbook.
1986-07-01
19-3 19.1.3 Summary............................................................. 19-3 19. Gene r...Component Optimum System Performance Benefits of Human Factors Engineering HFE Methodological Tools and Design Aids Allocation of Function or Who Does What...those investigators who treat the human user as part of the system design process. Human factors engineering, or HFE , is the practice of designing
DEFF Research Database (Denmark)
Bakker, Peter
2015-01-01
this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212.......this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212....
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
African Journals Online (AJOL)
Items 151 - 193 of 193 ... Vol 14, No 1 (2012), The absorption spectra of natural dyes and their suitability as a sensitiser in organic solar cell application, Abstract. DM Mulati, NS Timonah, W Bjorn. Vol 16, No 1 ... Vol 14, No 2 (2012), The effect of pumping water from wells in an aquifer, Abstract. KG Warul, GX Stower, JK Sigey.
Causes of death among the Caesars (27 BC-AD 476) | Retief | Acta ...
African Journals Online (AJOL)
The Roman Empire was ruled by 77 emperors between 27 BC and AD 476 (503 years); 18 (23,4%) of them held sway during the Early Empire (27 BC–AD 193, 220 years), and 59 (76,6%) during the Late Empire (193-476, 283 years). On the average emperors in the Early Empire ruled for a longer period (12,7 years as ...
Unscheduled DNA synthesis in human skin after in vitro ultraviolet-excimer laser ablation
International Nuclear Information System (INIS)
Green, H.A.; Margolis, R.; Boll, J.; Kochevar, I.E.; Parrish, J.A.; Oseroff, A.R.
1987-01-01
DNA damage repaired by the excision repair system and measured as unscheduled DNA synthesis (UDS) was assessed in freshly excised human skin after 193 and 248 nm ultraviolet (UV)-excimer laser ablative incisions. Laser irradiation at 248 nm induced DNA damage throughout a zone of cells surrounding the ablated and heat-damaged area. In contrast, with 193 nm irradiation UDS was not detected in cells adjacent to the ablated area, even though DNA strongly absorbs this wavelength. Our results suggest that the lack of UDS after 193 nm irradiation is due to: ''shielding'' of DNA by the cellular interstitium, membrane, and cytoplasm, DNA damage that is not repaired by excision repair, or thermal effects that either temporarily or permanently inhibit the excision repair processes
37 CFR 2.193 - Trademark correspondence and signature requirements.
2010-07-01
... general partner of a partnership) must sign. In the case of joint owners who are not represented by a... of a partnership) must sign. In the case of joint petitioners, all must sign. (6) Requests for... practice before the Office under § 11.14 of this chapter. In the case of joint owners who are not...
All projects related to | Page 193 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
In Central America, nearly 24,000 community-based organizations supply drinking water to rural and peri-urban residents. End Date: ... The Maipo River Basin in central Chile is home to six million people, most residing in the city of Santiago.
46 CFR 193.10-10 - Fire hydrants and hose.
2010-10-01
... the vessel, other than main machinery spaces, may be reached with at least 2 streams of water from separate outlets, at least one of which must be from a single length of hose. In main machinery spaces, all... decks where no protection is afforded to the hose in heavy weather, the hose may be temporarily removed...
RT-PCR protocols [Methods in molecular biology, v. 193
National Research Council Canada - National Science Library
O'Connell, Joseph
2002-01-01
.... Here the newcomer will find readily reproducible protocols for highly sensitive detection and quantification of gene expression, the in situ localization of gene expression in tissue, and the cloning...
Inside Hall 193 for the Antiproton Accumulator (AA) ring
1979-01-01
Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .
193 A Contrastive Morphological Analysis of Tense Formation in ...
African Journals Online (AJOL)
Nigeria is a multilingual country with over 500 languages. Over ... expected to show keen interest in learning one another's language. In the Nigerian educational system, the Igbo and Yoruba ... As the world has become a global village, with its attendant ... comes in contact with a foreign language will find some features of.
40 CFR 264.193 - Containment and detection of releases.
2010-07-01
... conducted at least annually. [Note: The practices described in the American Petroleum Institute (API... stress of daily operation (including stresses from nearby vehicular traffic). (2) Placed on a foundation... provisions outlined in the Steel Tank Institute's (STI) “Standard for Dual Wall Underground Steel Storage...
40 CFR 265.193 - Containment and detection of releases.
2010-07-01
... to be assessed. Note: The practices described in the American Petroleum Institute (API) Publication... conditions, the stress of installation, and the stress of daily operation (including stresses from nearby... outlined in the Steel Tank Institute's (STI) “Standard for Dual Wall Underground Steel Storage Tank” may be...
Unscheduled DNA synthesis in human skin after in vitro ultraviolet-excimer laser ablation
Energy Technology Data Exchange (ETDEWEB)
Green, H.A.; Margolis, R.; Boll, J.; Kochevar, I.E.; Parrish, J.A.; Oseroff, A.R.
1987-08-01
DNA damage repaired by the excision repair system and measured as unscheduled DNA synthesis (UDS) was assessed in freshly excised human skin after 193 and 248 nm ultraviolet (UV)-excimer laser ablative incisions. Laser irradiation at 248 nm induced DNA damage throughout a zone of cells surrounding the ablated and heat-damaged area. In contrast, with 193 nm irradiation UDS was not detected in cells adjacent to the ablated area, even though DNA strongly absorbs this wavelength. Our results suggest that the lack of UDS after 193 nm irradiation is due to: ''shielding'' of DNA by the cellular interstitium, membrane, and cytoplasm, DNA damage that is not repaired by excision repair, or thermal effects that either temporarily or permanently inhibit the excision repair processes.
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
DEFF Research Database (Denmark)
Liu, Ying; Emilion, Gracy; Mungall, Andrew J
2002-01-01
We have previously shown a high frequency of allele loss at D6S193 (62%) on chromosomal arm 6q27 in ovarian tumours and mapped the minimal region of allele loss between D6S297 and D6S264 (3 cM). We isolated and mapped a single non-chimaeric YAC (17IA12, 260-280 kb) containing D6S193 and D6S297...
1981-08-31
4, and F. Reislor and C. Wittig, J. Che.:,. Phys. 69 (1978) 3729. 17. G. flerzborg, Molecular Spectra andri3 Iolcul ’r StrulCt e, Vol-. 1, Spe~ctra... emision from reaction (1) vs 02 pressure. C2 1" was gencr~ted by : C2 HCHO photolysis at 193 nm; /k C2! 2 photo~ysis at 193 ni; [J C2 fBr photolysis at
Energy Technology Data Exchange (ETDEWEB)
Choi, Tae Won [Department of Radiology, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Lee, Jeong Min; Kim, Jung Hoon [Department of Radiology, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Institute of Radiation Medicine, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Yu, Mi Hye [Department of Radiology, Konkuk University Medical Center, Seoul 05030 (Korea, Republic of); Han, Joon Koo; Choi, Byung Ihn [Department of Radiology, Seoul National University Hospital, Seoul 03080 (Korea, Republic of); Institute of Radiation Medicine, Seoul National University Hospital, Seoul 03080 (Korea, Republic of)
2016-11-01
To compare multidetector computed tomography (MDCT) and MRI for lesion conspicuity, as well as the detection and characterization of small solid pancreatic lesions (SPLs). 193 patients with small SPLs (< 3 cm) and 52 patients with normal pancreas who underwent both multiphasic MDCT and gadobutrol-enhanced MRI were included in our study. Two radiologists blinded to the pathologic diagnoses independently reviewed those images, and determined the detection of 'SPL per se' and 'SPL in consideration of secondary features', the lesion conspicuity, the probability of pancreatic ductal adenocarcinoma (PDAC), and the most likely specific diagnosis. The sensitivity of MRI for 'detection of SPL per se' was significantly higher than that of CT in both reviewers: 92.7% (179/193) and 97.9% (189/193), respectively, for reviewer 1 (p = 0.031) and 90.7% (175/193) and 99.5% (192/193), respectively, for reviewer 2 (p < 0.001). In addition, MRI provided better lesion conspicuity than MDCT for both reviewers (p < 0.001). However, CT and MRI did not show significant difference in sensitivity for 'detection of SPL in consideration of secondary features', specificity for SPL detection, and differentiation of PDAC vs. non-PDAC (p > 0.05). The accuracies of CT and MRI for making a specific diagnosis were as follows: 85.7% (210/245) vs. 86.9% (213/245), respectively, for reviewer 1 (p = 0.736), and 91.8% (225/245) vs. 93.5% (229/245), respectively, for reviewer 2 (p = 0.454). MRI showed better lesion conspicuity than MDCT, but did not show significantly different diagnostic performance compared with MDCT for detecting and characterizing small SPLs.
Directory of Open Access Journals (Sweden)
Luc eDannhoffer
2011-08-01
Full Text Available Cystic Fibrosis is a major inherited disorder involving abnormalities of fluid and electrolyte transport in a number of different organs due to abnormal function of Cystic Fibrosis Transmembrane conductance Regulator (CFTR protein. We recently identified a family of CFTR activators, which contains the hit: RP107 [7-n-butyl-6-(4-hydroxyphenyl[5H]-pyrrolo[2,3-b]pyrazine]. Here, we further evaluated the effect of the chemical modifications of the RP107-OH radical on CFTR activation. The replacement of the OH radical by a fluorine atom at position 2 (RP193 or 4 (RP185 significantly decreased the toxicity of the compounds without altering the ability to activate CFTR, especially for RP193. The non-toxic compound RP193 has no effect on cAMP production but stimulates the channel activity of wild-type CFTR in stably transfected CHO cells, in human bronchial epithelial NuLi-1 cells and in primary culture of human bronchial epithelial cells. Whole cell and single patch clamp recordings showed that RP193 induced a linear, time and voltage-independent current, which was fully inhibited by two different and selective CFTR inhibitors (CFTRinh-172 and GPinh-5a. Moreover, RP193 stimulates CFTR in temperature-rescued CuFi-1 (F508del/F508del human bronchial epithelial cells and in CHO cells stably expressing G551D-CFTR. This study shows that it is feasible to reduce cytotoxicity of chemical compounds without affecting their potency to activate CFTR and to rescue the class 2 F508del-CFTR and class 3 G551D-CFTR CF mutant activities.
Molecular mechanisms of cancer
National Research Council Canada - National Science Library
Weber, Georg F
2007-01-01
... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 4. Cellular Senescence . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 193 5...
2010-03-12
... near future. For 2011, the model produces an ABC 15,000 mt higher than the proposed ABC. The SSC...,110,000 815,000 295,000 AI 19,000 19,000 0 19,000 19,000 0 Bogoslof 50 10 40 50 10 40 Pacific cod BSAI 168,780 193,030 -24,250 207,580 193,030 14,550 Sablefish BS 2,790 2,520 270 2,500 2,520 -20 AI 2,070 2...
Mass determination of heavy nuclei by the (α, 8He) reaction
International Nuclear Information System (INIS)
Kato, S.; Kubono, S.; Tanaka, M.H.
1991-07-01
The atomic mass excesses of 86 Zr, 88 Mo, 181 Re, 193 Au, and 200 Pb were determined from the Q-value measurements of the (α, 8 He) reaction on 90 Zr, 92 Mo, 185 Re, 197 Au, and 204 Pb. Further, the mass excesses of 181 Os, 193 Hg, 204 Po, 208 Rn, 212 Ra, and 216 Th were deduced from the measured mass excesses and the known Q values of alpha and beta decays. (author)
Stability of Procainamide Injection in Clear Glass Vials and Polyvinyl Chloride Bags.
Donnelly, Ronald F
2017-11-01
The objective of this study was to evaluate the chemical stability of procainamide hydrochloride, 100 mg/mL, when repackaged in clear glass vials or diluted to 3 mg/mL with normal saline and packaged in polyvinyl chloride (PVC) bags when stored at either 23°C and exposed to light (ETL) or 5°C and protected from light (PFL). Solutions were assayed using a stability-indicating high-performance liquid chromatography method. Samples (5 mL) were collected from triplicate containers on days 0, 7, 14, 21, 28, 56, 91, and 193. Color/clarity and pH changes were also monitored at each time interval. During the study, all samples remained clear and there was only a slight pH change. The color of the solutions stored at 23°C intensified but did not correlate with a significant decrease in concentration, while solutions stored at 5°C remained unchanged. Solutions repackaged in glass vials were stable for 193 days when stored at 23ºC and ETL or 5ºC and PFL. When further diluted to 3 mg/mL with normal saline and packaged in PVC bags, procainamide was also stable for 193 days at either 23ºC and ETL or 5°C and PFL. The stability of procainamide, 100 mg/mL, repackaged in clear glass vials was 193 days when stored at either 23ºC and ETL or 5ºC or PFL. If diluted further to 3 mg/mL with normal saline and packaged in PVC bags, the drug was also stable for 193 days at either 23ºC and ETL or 5°C and PFL.
Aerial image measurement technique for automated reticle defect disposition (ARDD) in wafer fabs
Zibold, Axel M.; Schmid, Rainer M.; Stegemann, B.; Scheruebl, Thomas; Harnisch, Wolfgang; Kobiyama, Yuji
2004-08-01
The Aerial Image Measurement System (AIMS)* for 193 nm lithography emulation has been brought into operation successfully worldwide. A second generation system comprising 193 nm AIMS capability, mini-environment and SMIF, the AIMS fab 193 plus is currently introduced into the market. By adjustment of numerical aperture (NA), illumination type and partial illumination coherence to match the conditions in 193 nm steppers or scanners, it can emulate the exposure tool for any type of reticles like binary, OPC and PSM down to the 65 nm node. The system allows a rapid prediction of wafer printability of defects or defect repairs, and critical features, like dense patterns or contacts on the masks without the need to perform expensive image qualification consisting of test wafer exposures followed by SEM measurements. Therefore, AIMS is a mask quality verification standard for high-end photo masks and established in mask shops worldwide. The progress on the AIMS technology described in this paper will highlight that besides mask shops there will be a very beneficial use of the AIMS in the wafer fab and we propose an Automated Reticle Defect Disposition (ARDD) process. With smaller nodes, where design rules are 65 nm or less, it is expected that smaller defects on reticles will occur in increasing numbers in the wafer fab. These smaller mask defects will matter more and more and become a serious yield limiting factor. With increasing mask prices and increasing number of defects and severability on reticles it will become cost beneficial to perform defect disposition on the reticles in wafer production. Currently ongoing studies demonstrate AIMS benefits for wafer fab applications. An outlook will be given for extension of 193 nm aerial imaging down to the 45 nm node based on emulation of immersion scanners.
Zhao, Zhenzhen; Liu, Wen; Liu, Jincheng; Wang, Jiayi; Luo, Bing
2017-10-01
Epstein-Barr virus (EBV) is an important DNA tumor virus that is associated with approximately 10% of gastric carcinomas and 99% of nasopharyngeal cancers (NPC). DNA methylation and microRNAs (miRNAs) are the most studied epigenetic mechanisms that can prompt disease susceptibility. This study aimed to detect the effect of EBV on Wnt inhibitory factor 1 (WIF1), Nemo-like kinase (NLK), and adenomatous polyposis coli (APC) gene methylation, and expression in gastric carcinoma and NPC. The WIF1, NLK, and APC gene mRNA expression levels were measured by real-time quantitative RT-PCR in four EBV-positive cell lines and four EBV-negative cell lines. Bisulfite genomic sequencing or methylation-specific PCR was used to detect the methylation status of the WIF1, NLK, and APC promoters. All cell lines were treated with 5-azacytidine (5-aza-dC), miR-BART19-3p mimics or an inhibitor, and analyzed by flow cytometry and MTT cell proliferation assays. The WIF1, NLK, and APC promoters were hypermethylated in all eight cell lines. 5-Aza-dC displayed a growth inhibitory effect on cells . After transfection with miR-BART19-3p mimics, the expression of WIF1, and APC decreased, and the cellular proliferation rate increased. After transfection with the miR-BART19-3p inhibitor, the expression levels were higher, and the cell growth was inhibited. In the NPC and GC cell lines, the promoters of WIF1, NLK, and APC are highly methylated, and the expression of these three genes is regulated by miR-BART19-3p. The activity of the Wnt pathway in EBV-associated tumors may be enhanced by miR-BART19-3p. © 2017 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Giuseppe Noto
2012-09-01
Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.
Raley, Angélique; Lee, Joe; Smith, Jeffrey T.; Sun, Xinghua; Farrell, Richard A.; Shearer, Jeffrey; Xu, Yongan; Ko, Akiteru; Metz, Andrew W.; Biolsi, Peter; Devilliers, Anton; Arnold, John; Felix, Nelson
2018-04-01
We report a sub-30nm pitch self-aligned double patterning (SADP) integration scheme with EUV lithography coupled with self-aligned block technology (SAB) targeting the back end of line (BEOL) metal line patterning applications for logic nodes beyond 5nm. The integration demonstration is a validation of the scalability of a previously reported flow, which used 193nm immersion SADP targeting a 40nm pitch with the same material sets (Si3N4 mandrel, SiO2 spacer, Spin on carbon, spin on glass). The multi-color integration approach is successfully demonstrated and provides a valuable method to address overlay concerns and more generally edge placement error (EPE) as a whole for advanced process nodes. Unbiased LER/LWR analysis comparison between EUV SADP and 193nm immersion SADP shows that both integrations follow the same trend throughout the process steps. While EUV SADP shows increased LER after mandrel pull, metal hardmask open and dielectric etch compared to 193nm immersion SADP, the final process performance is matched in terms of LWR (1.08nm 3 sigma unbiased) and is only 6% higher than 193nm immersion SADP for average unbiased LER. Using EUV SADP enables almost doubling the line density while keeping most of the remaining processes and films unchanged, and provides a compelling alternative to other multipatterning integrations, which present their own sets of challenges.
Induction of lambda prophage near the site of focused UV laser radiation
Energy Technology Data Exchange (ETDEWEB)
Matchette, L.S.; Waynant, R.W.; Royston, D.D.; Hitchins, V.M.; Elespuru, R.K.
1989-02-01
DNA damage from photon scatter or beam spread during UV excimer laser irradiation was investigated using the induction of bacteriophage lambda in E. coli BR339. Prophage induction in these cells leads to the production of ..beta..-galactosidase which can be detected colorimetrically by the application of appropriate substates. An agar surface overlayed with BR339 cells was placed at various distances from the focal point of a converging lens and exposed to either 193 or 248 nm laser radiation. Energy densities ranging from approximately 5 mJ/cm/sup 2/ to 30 J/cm/sup 2/ were used. Ablation with 193 nm laser radiation produced an 800 ..mu..m wide clear 'trench' surrounded by a 500 ..mu..m zone of cells in which lambda had been induced. Following ablation with 248 nm laser radiation, the zone of induction was several millimeters wide. Exposures to 193 nm radiation at 170 mJ/cm/sup 2//pulse produced visible ablation of the agar surface at 1.7 J/cm/sup 2/. Lambda induction was observed surrounding cleared ablation areas. The presence of induction in this system suggests that both 248 and 193 nm excimer laser radiation delivered at high energy densities has sufficient spread or scatter to damage DNA in cells surrounding areas of ablation.
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AEQRRFAANASHELRTPLAITQALLDVARNDPDVDTGELIERLRTVNTRAI 193 ... MLAQLEAHVAEQRR...FAANASHELRTPLAITQALLDVARNDPDVDTGELIERLRTVNTRAI Sbjct: 1 ... MLAQLEAHVAEQRRFAANASHELRTPLAITQALLDVARNDPDVDTGELIERLRTVNTRAI 60 ...
Investigation of level energies and B(E2) values for rotation-aligned bands in Hg isotopes
International Nuclear Information System (INIS)
Mertin, D.; Tischler, R.; Kleinrahm, A.; Kroth, R.; Huebel, H.; Guenther, C.
1978-01-01
High spin states in 191 192 193 195 197 199 Hg were investigated by observing γ-rays and conversion electrons in the compound reactions 192 194 198 Pt(α,xn) and 192 Pt ( 3 He,4n). In 197 Hg the decoupled band built on the 13/2 + state and the semi-decoupled negative-parity band are observed up to Isup(π)=41/2 + and 33/2 - , respectively. A careful investigation of 199 Hg revealed no new high spin states above the previously known levels with Isup(π)=25/2 + and 31/2 - . Half-lives were determined for the 10 + , 7 - , 8 - and 16 - states in 192 Hg, the 33/2 states in 191 193 Hg and the 25/2 - states in 191 193 195 197 Hg. The systematics of the level energies and B(E2) values for the positive parity ground and 13/2 + bands and the negative-parity semi-decoupled bands in 190-200 Hg is discussed. (Auth.)
Bakshi, Vivek
2018-01-01
Extreme ultraviolet lithography (EUVL) is the principal lithography technology-beyond the current 193-nm-based optical lithography-aiming to manufacture computer chips, and recent progress has been made on several fronts: EUV light sources, scanners, optics, contamination control, masks and mask handling, and resists. This book covers the fundamental and latest status of all aspects of EUVL used in the field. Since 2008, when SPIE Press published the first edition of EUVL Lithography, much progress has taken place in the development of EUVL as the choice technology for next-generation lithography. In 2008, EUVL was a prime contender to replace 193-nm-based optical lithography in leading-edge computer chip making, but not everyone was convinced at that point. Switching from 193-nm to 13.5-nm wavelengths was a much bigger jump than the industry had attempted before. It brought several difficult challenges in all areas of lithography-light source, scanner, mask, mask handling, optics, optics metrology, resist, c...
International Nuclear Information System (INIS)
Suwa, Masato; Kogawa, Osamu; Hashimoto, Yutaka
1992-01-01
A promising antitumor drug, cis-1,1-cyclobutane-dicarboxylato (2R)-2-methyl-1,4-butanediamine platinum (II), NK121, was synthesized from radionuclides of platinum such as 193m Pt, 195m Pt and 191 Pt which were produced by neutron irradiation of enriched 192 Pt. The overall yield was 38.6% in a synthesis time of 10 hours. The radioactivities present in 8.39 mg of NK121 were 115.3 μCi as 193m Pt, 29.9 μCi as 197 Pt, 22.0 μCi as 195m Pt, and 4.8 μCi as 191 Pt at the end of synthesis. The specific activity of the NK121 was 13.7 μCi ( 193m Pt)/mg NK121 at the end of synthesis. The radiochemical purity of NK121 was typically 99%. HPLC analyses confirmed that NK121 was in an adequate chemical purity and suitable for animal experimentation. (author)
Energy Technology Data Exchange (ETDEWEB)
Suwa, Masato; Kogawa, Osamu; Hashimoto, Yutaka (Nippon Kayaku Co. Ltd., Tokyo (Japan). Research Labs. of Pharmaceuticals Group); Nowatari, Hiroyoshi (Nippon Kayaku Co. Ltd., Takasaki, Gumma (Japan). Takasaki Research Labs.); Murase, Yuko; Homma, Yoshio (Kyoritsu Coll. of Pharmacy, Tokyo (Japan))
1992-05-01
A promising antitumor drug, cis-1,1-cyclobutane-dicarboxylato (2R)-2-methyl-1,4-butanediamine platinum (II), NK121, was synthesized from radionuclides of platinum such as {sup 193m}Pt, {sup 195m}Pt and {sup 191}Pt which were produced by neutron irradiation of enriched {sup 192}Pt. The overall yield was 38.6% in a synthesis time of 10 hours. The radioactivities present in 8.39 mg of NK121 were 115.3 {mu}Ci as {sup 193m}Pt, 29.9 {mu}Ci as {sup 197}Pt, 22.0 {mu}Ci as {sup 195m}Pt, and 4.8 {mu}Ci as {sup 191}Pt at the end of synthesis. The specific activity of the NK121 was 13.7 {mu}Ci ({sup 193m}Pt)/mg NK121 at the end of synthesis. The radiochemical purity of NK121 was typically 99%. HPLC analyses confirmed that NK121 was in an adequate chemical purity and suitable for animal experimentation. (author).
People and things. CERN Courier, May 1979, v. 19(3)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1979-05-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news on upcoming or past events, for example the annual meeting of the High Energy Discussion Group. There will be reports of recent work at the AGS and for ISABELLE and future plans in these areas will be reviewed.
31 CFR 103.193 - Special measures against Banco Delta Asia.
2010-07-01
... FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs...-money laundering program requirement; (viii) A broker or dealer in securities registered, or required to... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Special measures against Banco Delta...
People and things. CERN Courier, May 1979, v. 19(3)
International Nuclear Information System (INIS)
Anon.
1979-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news on upcoming or past events, for example the annual meeting of the High Energy Discussion Group. There will be reports of recent work at the AGS and for ISABELLE and future plans in these areas will be reviewed
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Query: 134 KSFTYAASSSTYGDHPSLPKVEDLIGKPLSPYAVTKYVNELYADVFARCYGFNTIGLRYF 193 ... KSFTYAASSSTYGDHPSLP...KVEDLIGKPLSPYAVTKYVNELYADVFARCYGFNTIGLRYF Sbjct: 121 KSFTYAASSSTYGDHPSLPKVEDLIGKPLSPYAVTKYVNELYADVFARCYGFNTI
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
Fujimura, Yoshihiro; Matsumoto, Masanori; Kokame, Koichi; Isonishi, Ayami; Soejima, Kenji; Akiyama, Nobu; Tomiyama, Junji; Natori, Kazuhiko; Kuranishi, Yasunobu; Imamura, Yutaka; Inoue, Nobumasa; Higasa, Satoshi; Seike, Masako; Kozuka, Teruhiko; Hara, Masamichi; Wada, Hideo; Murata, Mitsuru; Ikeda, Yasuo; Miyata, Toshiyuki; George, James N
2009-03-01
Upshaw-Schulman syndrome (USS) is a congenital thrombotic thrombocytopenic purpura (TTP) due to mutations in the gene that encodes for ADAMTS13 (ADAMTS13), but its clinical signs may be mild or absent during childhood. We have identified 37 patients with USS (24 females, 13 males) belonging to 32 families. The nine women from six families who were diagnosed during their first pregnancy are the focus of this report. Six of the nine women had episodes of thrombocytopenia during childhood misdiagnosed as idiopathic thrombocytopenic purpura. Thrombocytopenia occurred during the second-third trimesters in each of their 15 pregnancies, with 16 babies (one twin pregnancy), often followed by TTP. Of 15 pregnancies, eight babies were stillborn or died soon after birth, and the remaining seven were all premature except one, who was born naturally following plasma infusions to the mother that had started at 8 weeks' gestation. All nine USS women had severely deficient ADAMTS13 activity. ADAMTS13 analyses demonstrated that eight women were compound heterozygotes of Y304C/G525D (2 siblings), R125VfsX6/Q1302X (2 siblings), R193W/R349C (2 siblings), I178T/Q929X, and R193W/A606P; one woman was homozygous for R193W. Only the R193W mutation has been previously reported. These observations emphasize the importance of measuring ADAMTS13 activity in the evaluation of thrombocytopenia during childhood and pregnancy.
ORF Alignment: NC_002578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NKIKDVFNVSKTPIREAIISLENEEVVKKNGKSYFVSFIEP 60 ... Query: 134 SLIAKASGNKYIESCVNSMRLKLRIVRVTLFTSIERREDEYKEHFGIFEAIKNKDADKAR... 193 ... SLIAKASGNKYIESCVNSMRLKLRIVRVTLFTSIERREDEYKEHFGIFEAIKNKDADKAR... Sbjct: 121 SLIAKASGNKYIESCVNSMRLKLRIVRVTLFTSIERREDEYKEHFGIFEAIKNKDADKAR 180 ...
ORF Alignment: NC_003424 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 193 ... Query: 222 LTGEQKLIELELKTICEIGLVGLPNAGKSTLLNCLTASKSKVGEY...EFTTIYPKIGTIKTT 281 ... LTGEQKLIELELKTICEIGLVGLPNAGKSTLLNCLTASKSKVGEYEFTTIYPKIGTIKTT Sbjct: 1 ... LTGEQKLIELELKTICE
ArF excimer laser modulation of TNF-alpha and gelatinase B in NIH 3T3 cells
International Nuclear Information System (INIS)
Naudy-Vives, C.; Courant, D.; Perot, J.C.; Garcia, J.; Fretier, P.; Court, L.; Dormont, D.
1995-01-01
The effects on TNF-alpha and gelatinase B activity in mammalian cells induced by 193 nm argon fluoride excimer laser have been investigated. The data show that a secretion of 92 kDa type IV collagenase and TNF-alpha were increased in cell culture supernatants. Moreover, the 193 nm laser radiation produces a decrease of cell proliferation and an increase of cell activation 8 hours after irradiation. The total protein amount increases with the delivered dose. Same, but less effects were obtained after exposure to a conventional UV lamp at 254 nm. (author)
3K3A-activated protein C stimulates postischemic neuronal repair by human neural stem cells in mice
DEFF Research Database (Denmark)
Wang, Yaoming; Zhao, Zhen; Rege, Sanket V
2016-01-01
-APC (Lys191-193Ala) mutant in which three Lys residues (KKK191-193) were replaced with alanine, and/or its other mutants with reduced (>90%) anticoagulant activity, engineered to reduce APC-associated bleeding risk while retaining normal cell-signaling activity, have shown benefits in preclinical models...... of ischemic stroke, brain trauma, multiple sclerosis, amyotrophic lateral sclerosis, sepsis, ischemic and reperfusion injury of heart, kidney and liver, pulmonary, kidney and gastrointestinal inflammation, diabetes and lethal body radiation. On the basis of proof-of-concept studies and an excellent safety...
Superdeformed bands of odd nuclei in A=190 region in the quasiparticle picture
International Nuclear Information System (INIS)
Terasaki, J.; Flocard, H.; Heenen, P.H.; Bonche, P.
1996-07-01
Properties of the superdeformed (SD) bands of 195 Pb and 193 Hg have been studied by the cranked Hartree-Fock-Bogoliubov method. The calculations reproduce the flat behavior of the dynamical moment of inertia of two of the SD bands of 195 Pb measured recently. Possible configuration assignments for the observed bands 3 and 4 of 195 Pb are discussed. The two interacting SD bands of 193 Hg have also been calculated. The analysis confirms the superiority of a density-dependent pairing force over a seniority pairing interaction. (author)
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PIRYF 60 ... Query: 134 IDDDGQPLPDILATCFPFADDVLIDGPELVSFLADHTINFIGEPSCVLARRXXXXXXXXX 193 ... IDDDGQPLPDILATCFPFADDVLIDGPELVSFLADH...TINFIGEPSCVLARR ... Sbjct: 121 IDDDGQPLPDILATCFPFADDVLIDGPELVSFLADHTINFIGEPSCVLARRADLLALGNA 180 ...
Energy Technology Data Exchange (ETDEWEB)
Yadav, Sunishtha S.; Ruwali, Munindra; Shah, Parag P. [Developmental Toxicology Division, Indian Institute of Toxicology Research, CSIR P.O. Box 80, M.G. Marg, Lucknow 226001 (India); Mathur, Neeraj [Environmental Epidemiology Division, Indian Institute of Toxicology Research, CSIR P.O. Box 80, M.G. Marg, Lucknow 226001 (India); Singh, Ram L. [Department of Biochemistry, Dr. R.M.L. Awadh University, Faizabad 224 001, U.P. (India); Pant, Mohan C. [Department of Radiotherapy, C.S.M. Medical University, Shahmina Road, Lucknow 226 001 (India); Parmar, Devendra [Developmental Toxicology Division, Indian Institute of Toxicology Research, CSIR P.O. Box 80, M.G. Marg, Lucknow 226001 (India)], E-mail: parmar_devendra@hotmail.com
2008-09-26
A case-control study consisting of 300 patients and an equal number of healthy controls was carried out to investigate the association of polymorphism in cytochrome P450 2C19 (CYP2C19), which results in poor and extensive metabolizers (PMs and EMs) genotypes, with squamous cell carcinoma of head and neck (HNSCC) and treatment response in patients receiving combination of chemo-radiotherapy. A higher frequency of CYP2C19*2 variants was observed in the cases resulting in significantly higher risk to HNSCC (Ad OR 3.36, 95% CI 1.94-5.82, p-value < 0.05). The PM genotype of CYP2C19*3 was also found to be slightly increased in the cases, though the increase in risk was not significant when analyzed by multivariate logistic regression model. Tobacco chewing amongst the cases resulted in almost 13-fold increase in the risk with CYP2C19*2 (OR: 12.39) and 3-fold with CYP2C19*3 genotype (OR: 2.90) when compared to the tobacco chewers amongst the controls. Likewise, cigarette smoking in the cases increased the risk approximately 9-fold and 3-fold with CYP2C19*2 (OR: 8.93) and CYP2C19*3 (OR: 2.18) genotypes respectively when compared to smokers amongst the controls. Similar increase in risk was associated with alcohol use amongst the cases carrying variant genotypes of CYP2C19*2 (OR: 7.75) or CYP2C19*3 (OR: 2.60), demonstrating the importance of gene-environment interaction in modifying susceptibility to HNSCC. Interestingly, patients with PMs of CYP2C19 (CYP2C19*2 and CYP2C19*3) exhibited little response to the respective chemotherapy than the patients carrying wild-type genotype demonstrating that functional enzyme deficiencies due to polymorphism in CYPs may not only be important in modifying the susceptibility to HNSCC but also in determining chemotherapeutic response.
García-Pérez, M A
2001-11-01
This paper presents an analysis of research published in the decade 1989-1998 by Spanish faculty members in the areas of statistical methods, research methodology, and psychometric theory. Database search and direct correspondence with faculty members in Departments of Methodology across Spain rendered a list of 193 papers published in these broad areas by 82 faculty members. These and other faculty members had actually published 931 papers over the decade of analysis, but 738 of them addressed topics not appropriate for description in this report. Classification and analysis of these 193 papers revealed topics that have attracted the most interest (psychophysics, item response theory, analysis of variance, sequential analysis, and meta-analysis) as well as other topics that have received less attention (scaling, factor analysis, time series, and structural models). A significant number of papers also dealt with various methodological issues (software, algorithms, instrumentation, and techniques). A substantial part of this report is devoted to describing the issues addressed across these 193 papers--most of which are written in the Spanish language and published in Spanish journals--and some representative references are given.
ORF Alignment: NT_033777 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Query: 134 SDCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF 193 ... SDCHELDEGVRVDGVYRFLVP...ERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF Sbjct: 1 ... SDCHELDEGVRVDGVYRFLVPERNEVQRDL...YERYCAFATDGPAWTVIQSRGGSFDPHENF 60 ... Query: 254 SYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQ 3
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TGVTC Sbjct: 1 ... PNDLIRQAVAAEQAGFDFVEISDHFHPWLDNQGHSPFAWSVLGAIAARTERIGLATGVTC 60 ... Query: 134 IIRLLWQGGYRSYEGKYLQLSDARIFD...LPETPPVIXXXXXXXXXXXXXXXXXXXXXXTEP 193 ... IIRLLWQGGYRSYEGKYLQLSDARIFDLPETPPVI ... ... ... TEP Sbjct: 121 IIRLLWQGGYRSYEGKYLQLSDARIFDLPETPPVIAVAAGGPAAARLAADLGDGLF
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NLVVLQELNPYSYFCQSENPKFFDLGEYFEEDKAFFS 60 ... Query: 134 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEE...KKRQQ 193 ... DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ... Sbjct: 121 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ 180 ... Query: 254 EEILYAEIELERTEEVRRM
DEFF Research Database (Denmark)
Jørgensen, Søren Thorndal; Liu, Fulai; Ouédraogo, M.
2010-01-01
during soil drying, Uniswa Red could be defined as a 'water-saver' such that it maintains leaf water status to a great extent of soil water deficit. This strategy is important for survival during intermittent drought. While S19-3 could be defined as a 'water-spender' with a late closure of stomata, hence...... a late declining of transpiration rate during soil drying allowed the landrace to maximize its water use despite giving up its leaf water relations. Such drought response together with a fast phenological development of S19-3 indicates that the landrace is capable of escaping from terminal drought while...
DNA damages induced by Ar F laser
Energy Technology Data Exchange (ETDEWEB)
Chapel, C.; Rose, S.; Chevrier, L.; Cordier, E.; Courant, D. [CEA Fontenay-aux-Roses, 92 (France). Dept. de Radiobiologie et de Radiopathologie
2006-07-01
The photo ablation process used in corneal refractive surgery by the Argon Fluoride (Ar F) laser emitting in ultraviolet C at 193 nm, exposes viable cells round the irradiated zone to sub ablative doses (< 400 joules.m -2). Despite that DNA absorption is higher at 193 nm than 254 nm, cytotoxicity of 193 nm laser radiation is lower than radiation emitted by 254 nm UV-C lamps. In situ, DNA could be protected of laser radiation by cellular components. Consequently, some authors consider that this radiation does not induce genotoxic effect whereas others suspect it to be mutagenic. These lasers are used for fifteen years but many questions remain concerning the long term effects on adjacent cells to irradiated area. The purpose of this study is to describe the effect of 193 nm laser radiation on DNA of stromal keratocytes which are responsible of the corneal structure. The 193 nm laser irradiation induces directly DNA breakage in keratocytes as it has been shown by the comet assay under alkaline conditions. Two hours post irradiation, damages caused by the highest exposure (150 J.m-2) are not repaired as it has been measured with the Olive Tail Moment (product of tail length and tail DNA content). They give partly evidence of induction of an apoptotic process in cells where DNA could be too damaged. In order to characterize specifically double strand breaks, a comparative analysis by immunofluorescence of the H2 Ax histone phosphorylation (H2 Ax) has been performed on irradiated keratocytes and unirradiated keratocytes. Results show a dose dependent increase of the number of H2 Ax positive cells. Consequences of unrepaired DNA lesions could be observed by the generation of micronuclei in cells. Results show again an increase of micronuclei in laser irradiated cells. Chromosomal aberrations have been pointed out by cytogenetic methods 30 mn after irradiation. These aberrations are dose dependent (from 10 to 150 J.m-2). The number of breakage decreases in the long run
193nm high power lasers for the wide bandgap material processing
Fujimoto, Junichi; Kobayashi, Masakazu; Kakizaki, Koji; Oizumi, Hiroaki; Mimura, Toshio; Matsunaga, Takashi; Mizoguchi, Hakaru
2017-02-01
Recently infrared laser has faced resolution limit of finer micromachining requirement on especially semiconductor packaging like Fan-Out Wafer Level Package (FO-WLP) and Through Glass Via hole (TGV) which are hard to process with less defect. In this study, we investigated ablation rate with deep ultra violet excimer laser to explore its possibilities of micromachining on organic and glass interposers. These results were observed with a laser microscopy and Scanning Electron Microscope (SEM). As the ablation rates of both materials were quite affordable value, excimer laser is expected to be put in practical use for mass production.
Asie du sud | Page 193 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
With an annual income of approximately $200 US per capita, the Socialist Republic of ... the role of foreign private-sector firms, especially from Japan and the United States, in the recent and rapid economic growth and integration in East Asia.
1935 15' Quad #193 Aerial Photo Mosaic Index - 2 of 2
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
1 CFR 19.3 - Routing and certification of originals and copies.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Routing and certification of originals and... certification of originals and copies. (a) If the order or proclamation is signed by the President, the original...: “Certified to be a true copy of the original.” ...
: tous les projets | Page 193 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: Poverty alleviation, CHILDREN, MALNUTRITION, SOUTHEAST ASIA, EDUCATION, DIET, INTEGRATED DEVELOPMENT. Région: Far East Asia, Philippines, Central Asia, South Asia. Programme: Agriculture et sécurité alimentaire. Financement total : CA$ 354,100.00. Démarche intégrée pour assurer la sécurité ...
Bancerz-Kisiel, Agata; Szczerba-Turek, Anna; Platt-Samoraj, Aleksandra; Michalczyk, Maria; Szweda, Wojciech
2017-03-01
Y. enterocolitica is the causative agent of yersiniosis. The objective of the article was a study of single nucleotide polymorphism in the ystB gene of Y. enterocolitica strains isolated from various wild animal species. High-resolution melting (HRM) analysis was applied to identify single nucleotide polymorphism (SNP) of ystB gene fragments of 88 Y. enterocolitica biotype 1A strains isolated from wild boar, roe deer, red deer and wild ducks. HRM analysis revealed 14 different melting profiles - 4 of them were defined as regular genotypes (G1, G2, G3, G4), whereas 10 as variations. 24 of the examined Y. enterocolitica strains were classified as G1, 18 strains as a G2, 21 strains as a G3, and 15 strains as a G4. Nucleotide sequences classified as G1 revealed 100% similarity with the Y. enterocolitica D88145.1 sequence (NCBI). Analysis of G2 revealed one point mutation - transition T111A. One mutation was also found in G3, but SNP was placed in a different gene region - transition G193A. Two SNPs - transitions G92C and T111A - were identified in G4. Direct sequencing of 10 variations revealed 5 new variants of the ystB nucleotide sequence: V1 - transition G129A (3 strains); V2 - transitions T111A and G193A (2 strains); V3 - transitions C118T and G193A (1 strain); V4 - transitions C141A and G193A (2 strains); and V5 characterized by 19 SNPs: G83A, T93A, A109G, G114T, C116T, A123G, T134C, T142G, T144C, A150C, G162A, T165G, T170G, T174A, T177G, G178A, A179G, A184G and G193A (2 strains). The predominant genotype in isolates from wild ducks was G1; in red deer G2; in wild boar G3; in roe deer G1 and G4. The proposed HRM method could be used to analyze Y. enterocolitica biotype 1A strains isolated from different sources, including humans.
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
RAFT technology for the production of advanced photoresist polymers
Sheehan, Michael T.; Farnham, William B.; Okazaki, Hiroshi; Sounik, James R.; Clark, George
2008-03-01
Reversible Addition Fragmentation Chain Transfer (RAFT) technology has been developed for use in producing high yield low polydispersity (PD) polymers for many applications. RAFT technology is being used to produce low PD polymers and to allow control of the polymer architecture. A variety of polymers are being synthesized for use in advanced photoresists using this technique. By varying the RAFT reagent used we can modulate the system reactivity of the RAFT reagent and optimize it for use in acrylate or methacrylate monomer systems (193 and 193i photoresist polymers) or for use in styrenic monomer systems (248 nm photoresist polymers) to achieve PD as low as 1.05. RAFT polymerization technology also allows us to produce block copolymers using a wide variety of monomers. These block copolymers have been shown to be useful in self assembly polymer applications to produce unique and very small feature sizes. The mutual compatibilities of all the components within a single layer 193 photoresist are very important in order to achieve low LWR and low defect count. The advent of immersion imaging demands an additional element of protection at the solid/liquid interface. We have used RAFT technology to produce block copolymers comprising a random "resist" block with composition and size based on conventional dry photoresist materials, and a "low surface energy" block for use in 193i lithography. The relative block lengths and compositions may be varied to tune solution behavior, surface energy, contact angles, and solubility in developer. The use of this technique will be explored to produce polymers used in hydrophobic single layer resists as well as additives compatible with the main photoresist polymer.
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available um USDA ... 110] ... Length = 193 ... Query: 37 ... VANSSTLIYGERDAVLVDTFLTAGQSKTLLDWVASCERNLTTIYVTHG...HGDHFFGLAPLL 96 ... VANSSTLIYGERDAVLVDTFLTAGQSKTLLDWVASCERNLTTIYVTHGHGDHFF...GLAPLL Sbjct: 1 ... VANSSTLIYGERDAVLVDTFLTAGQSKTLLDWVASCERNLTTIYVTHGHGDHFFGLAPLL 60 ... Query: 157 VVIDMGRTDTARST
International Nuclear Information System (INIS)
Rahn, T.; Wahlen, M.; Zhang Hui; Blake, G.
2002-01-01
Nitrous oxide plays an important role in greenhouse forcing and stratospheric ozone regulation. It is destructed in the stratosphere mainly by UV photolysis. Laboratory studies of N 2 O-N 2 mixtures irradiated at 193 and 207 nm reveal a significant enrichment of the residual heavy nitrous oxide isotopomers. The isotopic signatures are well described by an irreversible Rayleigh distillation process, with large enrichment factors of ε 15,18 (193 nm) = -18.4, -14.5 per mil and ε 15,18 (207 nm) = -48.7, -46.0 per mil. These results, when combined with diffusive mixing processes might help to explain the stratospheric enrichments previously observed. (author)
Integrating attachment and depression in the confluence model of sexual assault perpetration.
Nguyen, David; Parkhill, Michele R
2014-08-01
This study sought to extend the confluence model of sexual assault perpetration by examining attachment insecurity and depression as additional predictors of sexual aggression. Male college students (N = 193) completed an online questionnaire assessing confluence model constructs in addition to attachment and history of depression. Overall, the model fit the data well, χ(2)(11, 193) = 19.43, p = ns; root mean square error of approximation = .063; comparative fit index = .94. Attachment and depression demonstrated both direct and indirect relationships with perpetration severity. The results contribute to elucidating the process by which certain men become susceptible to perpetrating sexual assault. Implications are discussed. © The Author(s) 2014.
Ultraviolet-laser ablation of skin
Energy Technology Data Exchange (ETDEWEB)
Lane, R.J.; Linsker, R.; Wynne, J.J.; Torres, A.; Geronemus, R.G.
1985-05-01
The authors report on the use of pulsed ultraviolet-laser irradiation at 193 nm from an argon-fluoride laser and at 248 nm from a krypton-fluoride laser to ablate skin. In vitro, both wavelengths performed comparably, removing tissue precisely and cleanly, and leaving minimal thermal damage to the surrounding tissue. In vivo, the 193-nm laser radiation failed to remove tissue after bleeding began. The 248-nm radiation, however, continued to remove tissue despite bleeding and left a clean incision with only minimal thermal damage. The krypton-fluoride excimer laser beam at 248 nm, which should be deliverable through a quartz optical fiber, has great potential as a surgical instrument.
Energy Technology Data Exchange (ETDEWEB)
Morelli, J.; Kibbi, A.G.; Farinelli, W.; Boll, J.; Tan, O.T.
1987-06-01
Multiple dermatologic conditions that are currently treated with traditional cold-knife surgery are amenable to laser therapy. The ideal surgical treatment would be precise and total removal of abnormal tissue with maximal sparing of remaining structures. The ultraviolet (UV) excimer laser is capable of such precise tissue removal due to the penetration depth of 193 nm and 248 nm irradiation of 1 micron per pulse. This type of ablative tissue removal requires a high repetition rate for efficient lesional destruction. Excimer laser radiation at 193 nm is capable of high repetition rates, which are necessary while 248 nm radiation causes increasing nonspecific thermal injury as the laser repetition rate is increased.
Khan, Enamul H.; Weber, Marc H.; McCluskey, Matthew D.
2013-07-01
Positron annihilation spectra reveal isolated zinc vacancy (VZn) creation in single-crystal ZnO exposed to 193-nm radiation at 100mJ/cm2 fluence. The appearance of a photoluminescence excitation peak at 3.18 eV in irradiated ZnO is attributed to an electronic transition from the VZn acceptor level at ˜100meV to the conduction band. The observed VZn density profile and hyperthermal Zn+ ion emission support zinc vacancy-interstitial Frenkel pair creation by exciting a wide 6.34 eV Zn-O antibonding state at 193-nm photon—a novel photoelectronic process for controlled VZn creation in ZnO.
Novel mutation of the PRNP gene of a clinical CJD case
Directory of Open Access Journals (Sweden)
Collinge John
2006-11-01
Full Text Available Abstract Background Transmissible spongiform encephalopathies (TSEs, a group of neurodegenerative diseases, are thought to be caused by an abnormal isoform of a naturally occurring protein known as cellular prion protein, PrPC. The abnormal form of prion protein, PrPSc accumulates in the brain of affected individuals. Both isoforms are encoded by the same prion protein gene (PRNP, and the structural changes occur post-translationally. Certain mutations in the PRNP gene result in genetic TSEs or increased susceptibility to TSEs. Case presentation A 70 year old woman was admitted to the hospital with severe confusion and inability to walk. Relatives recognized memory loss, gait and behavioral disturbances over a six month period prior to hospitalization. Neurological examination revealed Creutzfeldt-Jakob disease (CJD related symptoms such as incontinence, Babinski sign and myoclonus. EEG showed periodic sharp waves typical of sporadic CJD and cerebrospinal fluid analysis (CSF was positive for the presence of the 14-3-3-protein. As the disease progressed the patient developed akinetic mutism and died in the tenth month after onset of the disease symptoms. Unfortunately, no autopsy material was available. PRNP sequencing showed the occurrence of a point mutation on one allele at codon 193, which is altered from ACC, coding for a threonine, to ATC, encoding an isoleucine (T193I. Conclusion Here we report a novel mutation of the PRNP gene found in an elderly female patient resulting in heterozygosity for isoleucine and threonine at codon 193, in which normally homozygosity for threonine is expected (T193. The patient presented typical clinical symptoms of CJD. EEG findings and the presence of the 14-3-3 protein in the CSF, contributed to CJD diagnosis, allowing the classification of this case as a probable CJD according to the World Health Organization (WHO accepted criteria.
Classification and printability of EUV mask defects from SEM images
Cho, Wonil; Price, Daniel; Morgan, Paul A.; Rost, Daniel; Satake, Masaki; Tolani, Vikram L.
2017-10-01
Classification and Printability of EUV Mask Defects from SEM images EUV lithography is starting to show more promise for patterning some critical layers at 5nm technology node and beyond. However, there still are many key technical obstacles to overcome before bringing EUV Lithography into high volume manufacturing (HVM). One of the greatest obstacles is manufacturing defect-free masks. For pattern defect inspections in the mask-shop, cutting-edge 193nm optical inspection tools have been used so far due to lacking any e-beam mask inspection (EBMI) or EUV actinic pattern inspection (API) tools. The main issue with current 193nm inspection tools is the limited resolution for mask dimensions targeted for EUV patterning. The theoretical resolution limit for 193nm mask inspection tools is about 60nm HP on masks, which means that main feature sizes on EUV masks will be well beyond the practical resolution of 193nm inspection tools. Nevertheless, 193nm inspection tools with various illumination conditions that maximize defect sensitivity and/or main-pattern modulation are being explored for initial EUV defect detection. Due to the generally low signal-to-noise in the 193nm inspection imaging at EUV patterning dimensions, these inspections often result in hundreds and thousands of defects which then need to be accurately reviewed and dispositioned. Manually reviewing each defect is difficult due to poor resolution. In addition, the lack of a reliable aerial dispositioning system makes it very challenging to disposition for printability. In this paper, we present the use of SEM images of EUV masks for higher resolution review and disposition of defects. In this approach, most of the defects detected by the 193nm inspection tools are first imaged on a mask SEM tool. These images together with the corresponding post-OPC design clips are provided to KLA-Tencor's Reticle Decision Center (RDC) platform which provides ADC (Automated Defect Classification) and S2A (SEM
Study of the odd-${A}$, high-spin isomers in neutron-deficient trans-lead nuclei with ISOLTRAP
Herfurth, F; Blaum, K; Beck, D; Kowalska, M; Schwarz, S; Stanja, J; Huyse, M L; Wienholtz, F
We propose to measure the excitation energy of the $\\frac{13^{+}}{2}$ isomers in the neutron-deficient isotopes $^{193,195,197}$Po with the ISOLTRAP mass spectrometer. The assignment of the low- and high-spin isomers will be made by measuring the energy of the $\\alpha$- particles emitted in the decay of purified beams implanted in a windmill system. Using $\\alpha$-decay information, it is then also possible to determine the excitation energy of the similar isomers in the $\\alpha$-daughter nuclei $^{189,191,193}$Pb, $\\alpha$-parent nuclei $^{197,199,201}$Rn, and $\\alpha$-grand-parent nuclei $^{201,203,205}$Ra. The polonium beams are produced with a UC$_{\\textrm{x}}$ target and using the RILIS.
Energy Technology Data Exchange (ETDEWEB)
Bobkov, K K; Rybaltovsky, A A; Vel' miskin, V V; Likhachev, M E; Bubnov, M M; Dianov, E M [Fiber Optics Research Center, Russian Academy of Sciences, Moscow (Russian Federation); Umnikov, A A; Gur' yanov, A N; Vechkanov, N N [G.G.Devyatykh Institute of Chemistry of High-Purity Substances, Russian Academy of Sciences, Nizhnii Novgorod (Russian Federation); Shestakova, I A [Open Joint-Stock Company M.F. Stel' makh Polyus Research Institute, Moscow (Russian Federation)
2014-12-31
We have studied photodarkening in ytterbium-doped fibre preforms with an aluminosilicate glass core. Analysis of their absorption and luminescence spectra indicates the formation of stable Yb{sup 2+} ions in the glass network under IR laser pumping at a wavelength λ = 915 nm and under UV irradiation with an excimer laser (λ = 193 nm). We have performed comparative studies of the luminescence spectra of the preforms and crystals under excitation at a wavelength of 193 nm. The mechanism behind the formation of Yb{sup 2+} ions and aluminium – oxygen hole centres (Al-OHCs), common to ytterbium-doped YAG crystals and aluminosilicate glass, has been identified: photoinduced Yb{sup 3+} charge-transfer state excitation. (optical fibres)
VizieR Online Data Catalog: Chemical abundances of giants and subgiants (Jofre+, 2015)
Jofre, E.; Petrucci, R.; Saffe, C.; Saker, L.; Artur de La Villarmois, E.; Chavero, C.; Gomez, M.; Mauas, P. J. D.
2014-10-01
For most of the objects in our sample we used publicly available high signal-to-noise (S/N>~150) and high resolution spectra gathered with four different instruments: HARPS (3.6m ESO telescope, La Silla, Chile), FEROS (2.2m ESO/MPI telescope, La Silla, Chile), ELODIE (1.93m telescope, OHP, France), and SOPHIE (1.93m telescope, OHP, France). In addition we obtained high resolution and high signal-to-noise (S/N>~150) spectra with the EBASIM spectrograph at the Jorge Sahade 2.15m telescope (CASLEO, San Juan, Argentina) for 7 stars in our sample. Our EBASIM observations were taken between June 2012 and August 2013. (5 data files).
Strengthening Resilience in Post-disaster Situations
International Development Research Centre (IDRC) Digital Library (Canada)
Demistifying Terminologies and Definitions: Same Terms, Different Meanings? 193. 15. ... Transforming the Value Chains through Business Development Approach ...... livelihoods and maintenance of the communities' natural resource capital.
Jiang, Linlin; Huang, Jia; Chen, Yaxiao; Yang, Yabo; Li, Ruiqi; Li, Yu; Chen, Xiaoli; Yang, Dongzi
2016-07-01
This study aimed to detect serum microRNAs (miRNAs) differentially expressed between polycystic ovary syndrome (PCOS) patients with impaired glucose metabolism (IGM), PCOS patients with normal glucose tolerance (NGT), and healthy controls. A TaqMan miRNA array explored serum miRNA profiles as a pilot study, then selected miRNAs were analyzed in a validation cohort consisting of 65 PCOS women with IGM, 65 PCOS women with NGT, and 45 healthy women The relative expression of miR-122, miR-193b, and miR-194 was up-regulated in PCOS patients compared with controls, whereas that of miR-199b-5p was down-regulated. Furthermore, miR-122, miR-193b, and miR-194 were increased in the PCOS-IGM group compared with the PCOS-NGT group. Multiple linear regression analyses revealed that miR-193b and body mass index contributed independently to explain 43.7 % (P ovarian follicle development pathways, including the insulin signaling pathway, the neurotrophin signaling pathway, the PI3K-AKT signaling pathway, and regulation of actin cytoskeleton. This study expands our knowledge of the serum miRNA expression profiles of PCOS patients with IGM and the predicted target signal pathways involved in disease pathophysiology.
Sheehan, Michael T.; Farnham, William B.; Chambers, Charles R.; Tran, Hoang V.; Okazaki, Hiroshi; Brun, Yefim; Romberger, Matthew L.; Sounik, James R.
2011-04-01
Reversible Addition Fragmentation Chain Transfer (RAFT) polymerization technology enables the production of polymers possessing low polydispersity (PD) in high yield for many applications. RAFT technology also enables control over polymer architecture. With synthetic control over these polymer characteristics, a variety of polymers can be designed and manufactured for use in advanced electronic applications. By matching the specific RAFT reagent and monomer combinations, we can accommodate monomer reactivity and optimize acrylate or methacrylate polymerizations (193 and 193i photoresist polymers) or optimize styrenic monomer systems (248 nm photoresist polymers) to yield polymers with PD as low as 1.05. For 193i lithography, we have used RAFT technology to produce block copolymers comprising of a random "resist" block with composition and size based on conventional dry photoresist materials and a "low surface energy" block The relative block lengths and compositions may be varied to tune solution migration behavior, surface energy, contact angles, and solubility in developer. Directed self assembly is proving to be an interesting and innovative method to make 2- and even 3-dimensional periodic, uniform patterns. Two keys to acceptable performance of directed self assembly from block copolymers are the uniformity and the purity of the materials will be discussed.
Expanding and Contracting Coronal Loops as Evidence of Vortex Flows Induced by Solar Eruptions
Energy Technology Data Exchange (ETDEWEB)
Dudík, J. [Astronomical Institute of the Czech Academy of Sciences, Fričova 298, 251 65 Ondřejov (Czech Republic); Zuccarello, F. P.; Aulanier, G.; Schmieder, B.; Démoulin, P., E-mail: jaroslav.dudik@asu.cas.cz [LESIA, Observatoire de Paris, Psl Research University, CNRS, Sorbonne Universits, UPMC Univ. Paris 06, Univ. Paris Diderot, Sorbonne Paris Cit, 5 place Jules Janssen, F-92195 Meudon (France)
2017-07-20
Eruptive solar flares were predicted to generate large-scale vortex flows at both sides of the erupting magnetic flux rope. This process is analogous to a well-known hydrodynamic process creating vortex rings. The vortices lead to advection of closed coronal loops located at the peripheries of the flaring active region. Outward flows are expected in the upper part and returning flows in the lower part of the vortex. Here, we examine two eruptive solar flares, the X1.1-class flare SOL2012-03-05T03:20 and the C3.5-class SOL2013-06-19T07:29. In both flares, we find that the coronal loops observed by the Atmospheric Imaging Assembly in its 171 Å, 193 Å, or 211 Å passbands show coexistence of expanding and contracting motions, in accordance with the model prediction. In the X-class flare, multiple expanding and contracting loops coexist for more than 35 minutes, while in the C-class flare, an expanding loop in 193 Å appears to be close by and cotemporal with an apparently imploding loop arcade seen in 171 Å. Later, the 193 Å loop also switches to contraction. These observations are naturally explained by vortex flows present in a model of eruptive solar flares.
EnviroAtlas - Durham, NC - Ecosystem Services by Block Group
U.S. Environmental Protection Agency — This EnviroAtlas dataset presents environmental benefits of the urban forest in 193 block groups in Durham, North Carolina. Carbon attributes, temperature reduction,...
9 CFR 381.193 - Poultry carcasses, etc., not intended for human food.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Poultry carcasses, etc., not intended..., DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Transportation...
17 CFR 201.193 - Applications by barred individuals for consent to associate.
2010-04-01
... misstatements or omissions of fact may constitute criminal violations of 18 U.S.C. 1001 et seq. and other... return to the securities business; and (8) Any other information material to the application. (e...
Low leaching and low LWR photoresist development for 193 nm immersion lithography
Ando, Nobuo; Lee, Youngjoon; Miyagawa, Takayuki; Edamatsu, Kunishige; Takemoto, Ichiki; Yamamoto, Satoshi; Tsuchida, Yoshinobu; Yamamoto, Keiko; Konishi, Shinji; Nakano, Katsushi; Tomoharu, Fujiwara
2006-03-01
With no apparent showstopper in sight, the adoption of ArF immersion technology into device mass production is not a matter of 'if' but a matter of 'when'. As the technology matures at an unprecedented speed, many of initial technical difficulties have been cleared away and the use of a protective layer known as top coat, initially regarded as a must, now becomes optional, for example. Our focus of interest has also sifted to more practical and production related issues such as defect reducing and performance enhancement. Two major types of immersion specific defects, bubbles and a large number of microbridges, were observed and reported elsewhere. The bubble defects seem to decrease by improvement of exposure tool. But the other type defect - probably from residual water spots - is still a problem. We suspect that the acid leaching from resist film causes microbridges. When small water spots were remained on resist surface after exposure, acid catalyst in resist film is leaching into the water spots even though at room temperature. After water from the spot is dried up, acid molecules are condensed at resist film surface. As a result, in the bulk of resist film, acid depletion region is generated underneath the water spot. Acid catalyzed deprotection reaction is not completed at this acid shortage region later in the PEB process resulting in microbridge type defect formation. Similar mechanism was suggested by Kanna et al, they suggested the water evaporation on PEB plate. This hypothesis led us to focus on reducing acid leaching to decrease residual water spot-related defect. This paper reports our leaching measurement results and low leaching photoresist materials satisfying the current leaching requirements outlined by tool makers without topcoat layer. On the other hand, Nakano et al reported that the higher receding contact angle reduced defectivity. The higher receding contact angle is also a key item to increase scan speed. The effort to increase the receding contact angle become very important issue for not only defectivity but also scanner throughput. Some of our experimental results along this line of study are also included in the report. The last topic covered is LWR (Line Width Roughness) as an essential leverage for performance improvement, especially for the smaller CD that immersion lithography is aiming to define. Our recent effort to find effect and working concept to reduce LWR with low leaching materials is also described.
Directory of Open Access Journals (Sweden)
Márcio Neves Bóia
2009-02-01
Full Text Available O objetivo do estudo foi estimar as freqüências de tuberculose e parasitoses intestinais na em comunidades indígenas da localidade de Iauareté (AM, em 2001. Estudo transversal (n=333 visando à obtenção de dados demográficos e amostras biológicas para exames de escarro e fezes. Dentre os 43 sintomáticos respiratórios, seis foram positivos na pesquisa de bacilos álcool-ácido resistentes no escarro. As parasitoses intestinais apresentaram freqüência significativamente maior entre a população Hüpda do que entre os índios que habitam os demais bairros (37,5% vs. 19,3% para Ascaris lumbricoides, 32,4% vs. 16,3% para Trichuris trichiura, 75% vs. 19,3% para ancilostomídeos, 75% vs. 35,4% para Entamoeba histolyticaD dispar e 33,3% vs. 10,7% para Giardia lamblia. Conclui-se que a tuberculose e o parasitismo intestinal são freqüentes nessas comunidades, exigindo medidas de controle e melhorias na assistência à saúde.El objetivo del estudio fue estimar las frecuencias de tuberculosis y parasitosis intestinales en las comunidades indígenas de la localidad de Iauareté (Norte de Brasil, en 2001. Estudio transversal (n=333 intentando obtener datos demográficos y muestras biológicas para examenes de esputo y heces. Entre los 43 sintomáticos respiratorios, seis fueron positivos en la pesquisa de bacilos alcohol-ácido resistentes en el esputo. Las parasitosis intestinales presentaron frecuencia significativamente mayor entre la población Hüpda que entre los indios que habitan las demás localidades (37,5% vs. 19,3% para Ascaris lumbricoides, 32,4% vs. 16,3% para Trichuris trichiura, 75% vs. 19,3% para ancilostomídeos, 75% vs. 35,4% para Entamoeba histolytica/dispar y 33,3% vs. 10,7% para Giardia lamblia. Se concluyó que la tuberculosis y el parasitismo intestinal son frecuentes en esas comunidades, exigiendo medidas de control y mejorías en la asistencia a la salud.The objective of the survey was to estimate the frequencies of
Auf dem Weg zum Portalverbund – das neue Onlinezugangsgesetz (OZG) / Thorsten Siegel
Siegel, Thorsten
2018-01-01
Haldusteenustele liidu ja liidumaade tasandil infotehnoloogilise juurdepääsu tagamisest ühtse portaali loomise ja seadustamisega; põhiseaduse artikli 91 tõlgendamisest. Vt samal teemal ka lk. 193-198
Two new polypore species from the southwestern USA: Fomitiporia fissurata and F. deserticola
Czech Academy of Sciences Publication Activity Database
Vlasák, Josef; Vlasák, J.
2016-01-01
Roč. 131, č. 1 (2016), s. 193-203 ISSN 0093-4666 Institutional support: RVO:60077344 Keywords : Basidiomycota * Hymenochaetales * Hymenochaetaceae Subject RIV: EF - Botanics Impact factor: 0.538, year: 2016
Statistical analysis of Japanese Thorotrast-administered autopsy cases--1980
Energy Technology Data Exchange (ETDEWEB)
Mori, T. (National Inst. of Radiological Sciences, Anagawa, Japan); Kato, Y.; Aoki, N.; Hatakeyama, S.
1983-01-01
In 193 cases autopsied between 1945 and 1980, all persons who had been intravascularly injected with Thorotrast in life, the authors found 131 malignant hepatic tumors, 20 liver cirrhoses, 6 myeloid leukemias, 4 erythroleukemias, 5 aplastic anemias, 4 lung cancers, 1 mesothelioma and 1 osteosarcoma. The causes of death in the Thorotrast-administered autopsy group (193 cases) were compared with those of a non-Thorotrast-administered autopsy group (95,000 cases) of the same sex and age at death as recorded in the Annals of Japanese Pathological Autopsy cases from 1958 to 1978. This comparison revealed that the frequencies of malignant hepatic tumors, liver cirrhosis, erythroleukemia, and aplastic anemia were significantly higher in the Thorotrast-administered group than in the non-Thorotrast-administered group.
Measurements of barium photocathode quantum yields at four excimer laser wavelengths
International Nuclear Information System (INIS)
Van Loy, M.D.; Young, A.T.; Leung, K.N.
1992-06-01
The electron quantum yields from barium cathodes excited by excimer laser radiation at 193, 248, 308, and 351 nm have been determined. Experiments with different cathode surface preparation techniques reveal that deposition of barium film a few microns thick on a clean copper surface under moderate vacuum conditions achieves relatively high quantum efficiencies. Quantum yields measured from surfaces prepared in this manner are 2.3 x 10 -3 at 193 nm, 7.6 x 10 - 4 at 248 nm, 6.1 x 10 -4 at 308 nm, and 4.0 x 10 -4 at 351 nm. Other preparation techniques, such as laser cleaning of a solid barium surface, produced quantum yields that were at least an order of magnitude lower than these values
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
EnviroAtlas - Durham, NC - BenMAP Results by Block Group
U.S. Environmental Protection Agency — This EnviroAtlas dataset demonstrates the effect of changes in pollution concentration on local populations in 193 block groups in Durham, North Carolina. The US...
Czech Academy of Sciences Publication Activity Database
Emmert, František
2014-01-01
Roč. 5, č. 1 (2014), s. 187-193 ISSN 2042-6402 Institutional support: RVO:68378122 Keywords : State Citizenship Act; * ius sanguinis * individual rights * Czech citizens Subject RIV: AG - Legal Sciences
Directory of Open Access Journals (Sweden)
Mehmet Demir Kaya
2012-03-01
Full Text Available Salinity reduces germination, delays emergence, and inhibits seedling growth of linseed (Linum usitatissimum L. while some varieties are less affected by salinity than others. In this study, we aimed to determine the effects of NaCl levels (0, 5, 10, 20 and 30 dS m-1 on germination and seedling growth of 10 linseed genotypes (lines 87, 89, 104, 114, 193, 194, 209, 215, C-90 and cv. San-85 and to classify the genotypes for salinity tolerance using germination and seedling characteristics. Germination percentage, mean germination time, root and shoot length, seedling fresh and dry weight, Na+ content and Na:K ratio of seedlings were investigated. Classification of linseed genotypes for salinity tolerance was done according to (i combination of Principal Component and Cluster Analysis, (ii Na+ content, and (iii Na:K ratio of seedling. The results showed that the highest values were obtained from lines 193, 194 and 215 except for mean germination time, while germination percentage was not adversely influenced by NaCl up to 20 dS m-1. Seedling growth was inhibited at 20 dS m-1 although genotypes exhibited varying responses. Na+ content was enhanced by NaCl, but seedling from lines 194, 193 and 215 had the lowest Na+ content at all NaCl levels. Cluster analysis performed by multiple parameters revealed three groups for salinity tolerance. It was concluded that lines 193, 194, and 215 were tolerant, lines 87, 209, C-90, and cv. Sari-85 were moderately tolerant and lines 89, 104, and 114 were salt-sensitive genotypes. Classification of genotypes for Na+ content and Na:K ratio showed similar result for tolerant genotypes while different genotypes for sensitive group were detected.La salinidad reduce germinación, retrasa emergencia, e inhibe el crecimiento de plántulas de lino (Linum usitatissimum L. mientras algunas variedades son menos afectadas por la salinidad que otras. El objetivo de este estudio fue determinar los efectos de niveles de NaCl (0, 5
Pediatric Palliative Care: A Personal Story
Full Text Available ... University (NEOMED) 26,193 views 5:39 Little Stars – Paediatric Palliative Care – Charlie's Story - Duration: 10:35. Little Stars 12,759 views 10:35 Teen Cancer Stories | ...
Brominated Oxylipins and Oxylipin Glycosides from Red Sea Corals
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Dembitsk, V. M.
- (2003), s. 309-316 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : glycosides * natural products * oxylipins Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2003
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Dembitsky, V. M.
- (2003), s. 2144-2152 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : glycosides * lactones * natural products Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2003
Druhý život Kralické bible v 18. a na začátku 19. století - edice hallská a prešpurská
Czech Academy of Sciences Publication Activity Database
Pišna, Jan
2014-01-01
Roč. 5, č. 2 (2014), s. 175-193 ISSN 1804-1132 Institutional support: RVO:68378068 Keywords : old printed Bible s * Bible Czech * Pietism * editing Subject RIV: AJ - Letters, Mass-media, Audiovision
Eight-Membered Cyclic 1,2,3-Trithiocane Derivatives from Perophora viridis, an Atlantic Tunicate
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Dembitsky, V. M.
- (2002), s. 2400-2404 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : natural * products * sulfur heterocycles Subject RIV: EE - Microbiology, Virology Impact factor: 2.195, year: 2002
Retention of carotenoids in egg yolks of laying hens supplemented with heterotrophic Chlorella
Czech Academy of Sciences Publication Activity Database
Kotrbáček, V.; Skřivan, M.; Kopecký, Jiří; Pěnkava, O.; Hudečková, P.; Uhríková, I.; Doubek, J.
2013-01-01
Roč. 58, č. 5 (2013), s. 193-200 ISSN 1212-1819 Institutional support: RVO:61388971 Keywords : lutein * zeaxanthin * enriched eggs Subject RIV: EE - Microbiology, Virology Impact factor: 0.871, year: 2013
77 FR 27065 - Agency Forms Undergoing Paperwork Reduction Act Review
2012-05-08
... Prevention and Health Promotion (NCCDPHP), Centers for Disease Control and Prevention (CDC) and the Center..., cigarette smoking costs more than $193 billion; $97 billion in lost productivity plus $96 billion in health...
Evidence for dipolar bands in mercury isotopes using EUROGAM multi-detector
International Nuclear Information System (INIS)
Le Coz, Y.
1995-01-01
This thesis is devoted to the study of nuclear structure around mass A 190 and in particular, to the search of oblate rotational dipole bands in mercury isotopes. The reactions used to populate high spin states in 192 Hg and 193 Hg were 160 Gd ( 36 S,n) 192 Hg and 150 Nd( 48 Ca, 5n) 193 Hg at beam energies of 159 and 213 MeV. Gamma-rays have been detected using the EUROGAM phase I array. Level schemes of those two nuclei have been extended up to an excitation energy of about 10 MeV and approximately spin 35h. In 192 Hg, two new dipole bands have been observed. Those two structures, as well as two similar structures in 193 Hg, have been connected to the low-lying states; so, excitation energy and bandhead spin of those bands have been deduced. Angular distribution and correlation analysis (specific to EUROGRAM phase I) have confirmed that the transitions are dipoles. After a general presentation of dipole bands in this A = 190 mass region, experimental results are compared with mean-field Hartree-Fock + BCS calculations, using the rotor plus quasi-particles model. The results are consistent with weakly oblate structures based on configurations which involve high-K proton orbitals driving the nucleus to an oblate shape. (author). 81 refs., 47 figs., 8 tabs., 4 ann
A homozygous missense mutation in human KLOTHO causes severe tumoral calcinosis
Ichikawa, Shoji; Imel, Erik A.; Kreiter, Mary L.; Yu, Xijie; Mackenzie, Donald S.; Sorenson, Andrea H.; Goetz, Regina; Mohammadi, Moosa; White, Kenneth E.; Econs, Michael J.
2007-01-01
Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia due to inactivating mutations in FGF23 or UDP-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). Herein we report a homozygous missense mutation (H193R) in the KLOTHO (KL) gene of a 13-year-old girl who presented with severe tumoral calcinosis with dural and carotid artery calcifications. This patient exhibited defects in mineral ion homeostasis with marked hyperphosphatemia and hypercalcemia as well as elevated serum levels of parathyroid hormone and FGF23. Mapping of H193R mutation onto the crystal structure of myrosinase, a plant homolog of KL, revealed that this histidine residue was at the base of the deep catalytic cleft and mutation of this histidine to arginine should destabilize the putative glycosidase domain (KL1) of KL, thereby attenuating production of membrane-bound and secreted KL. Indeed, compared with wild-type KL, expression and secretion of H193R KL were markedly reduced in vitro, resulting in diminished ability of FGF23 to signal via its cognate FGF receptors. Taken together, our findings provide what we believe to be the first evidence that loss-of-function mutations in human KL impair FGF23 bioactivity, underscoring the essential role of KL in FGF23-mediated phosphate and vitamin D homeostasis in humans. PMID:17710231
Energy Technology Data Exchange (ETDEWEB)
Rutz, Natalja; Heilbronn, Regine; Weger, Stefan, E-mail: stefan.weger@charite.de
2015-08-28
Based on its specific interaction with cullin3 mediated by an N-terminal BTB/POZ homologous domain, KCTD5 has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases. In the present study we tried to validate this hypothesis through identification and characterization of additional KCTD5 interaction partners. For the replication protein MCM7, the zinc finger protein ZNF711 and FAM193B, a yet poorly characterized cytoplasmic protein, we could demonstrate specific interaction with KCTD5 both in yeast two-hybrid and co-precipitation studies in mammalian cells. Whereas trimeric complexes of cullin3 and KCTD5 with the respective KCTD5 binding partner were formed, KCTD5/cullin3 induced polyubiquitylation and/or proteasome-dependent degradation of these binding partners could not be demonstrated. On the contrary, KCTD5 or Cullin3 overexpression increased ZNF711 protein stability. - Highlights: • KCTD5 nuclear translocation depends upon M phase and protein oligomerization. • Identification of MCM7, ZNF711 and FAM193 as KCTD5 interaction partners. • Formation of trimeric complexes of KCTD5/cullin3 with MCM7, ZNF711 and FAM193B. • KCTD5 is not involved in polyubiquitylation of MCM7 replication factor. • The KCTD5/cullin3 complex stabilizes ZNF711 transcription factor.
Directory of Open Access Journals (Sweden)
Ilona Kołodziejska
2013-01-01
Full Text Available The effect of moderate pressure at subzero temperature on natural microflora of minced cod, salmon, pork and beef meat was studied. Pressure of 193 MPa at –20 °C caused the reduction of total bacterial count in pork and beef meat by 1.1 and 0.6 log cycles, respectively, and by about 1.5 log cycles in fish meat. Under these conditions the psychrophilic and psychrotrophic bacteria were below the detection limit (<10 CFU/g of sample in pork and beef meat, while in cod and salmon meat they were reduced only by 1.3 and 2.0 log cycles, respectively. In all tested samples of meat treated with the pressure of 193 MPa at –20 °C, the number of coliforms was below 10 CFU/g. Under these conditions a significant reduction in the number of coagulase-positive Staphylococcus was also observed. During storage of samples at 4 °C after pressurization at 193 MPa and –20 °C, the inhibition of growth of all tested groups of bacteria was observed. Moderate pressure at subzero temperature does not ensure complete inactivation of bacteria; however, it allows the improvement of microbiological quality and extension of shelf life of food, which depends on the level of bacterial contamination of the initial raw material.
International Nuclear Information System (INIS)
Nahas, Nabil; Khatab, Abdelhakim; Ait-Kadi, Daoud; Nourelfath, Mustapha
2008-01-01
This paper deals with preventive maintenance optimization problem for multi-state systems (MSS). This problem was initially addressed and solved by Levitin and Lisnianski [Optimization of imperfect preventive maintenance for multi-state systems. Reliab Eng Syst Saf 2000;67:193-203]. It consists on finding an optimal sequence of maintenance actions which minimizes maintenance cost while providing the desired system reliability level. This paper proposes an approach which improves the results obtained by genetic algorithm (GENITOR) in Levitin and Lisnianski [Optimization of imperfect preventive maintenance for multi-state systems. Reliab Eng Syst Saf 2000;67:193-203]. The considered MSS have a range of performance levels and their reliability is defined to be the ability to meet a given demand. This reliability is evaluated by using the universal generating function technique. An optimization method based on the extended great deluge algorithm is proposed. This method has the advantage over other methods to be simple and requires less effort for its implementation. The developed algorithm is compared to than in Levitin and Lisnianski [Optimization of imperfect preventive maintenance for multi-state systems. Reliab Eng Syst Saf 2000;67:193-203] by using a reference example and two newly generated examples. This comparison shows that the extended great deluge gives the best solutions (i.e. those with minimal costs) for 8 instances among 10
Enabling Quantitative Optical Imaging for In-die-capable Critical Dimension Targets
Barnes, B.M.; Henn, M.-A.; Sohn, M. Y.; Zhou, H.; Silver, R. M.
2017-01-01
Dimensional scaling trends will eventually bring semiconductor critical dimensions (CDs) down to only a few atoms in width. New optical techniques are required to address the measurement and variability for these CDs using sufficiently small in-die metrology targets. Recently, Qin et al. [Light Sci Appl, 5, e16038 (2016)] demonstrated quantitative model-based measurements of finite sets of lines with features as small as 16 nm using 450 nm wavelength light. This paper uses simulation studies, augmented with experiments at 193 nm wavelength, to adapt and optimize the finite sets of features that work as in-die-capable metrology targets with minimal increases in parametric uncertainty. A finite element based solver for time-harmonic Maxwell's equations yields two- and three-dimensional simulations of the electromagnetic scattering for optimizing the design of such targets as functions of reduced line lengths, fewer number of lines, fewer focal positions, smaller critical dimensions, and shorter illumination wavelength. Metrology targets that exceeded performance requirements are as short as 3 μm for 193 nm light, feature as few as eight lines, and are extensible to sub-10 nm CDs. Target areas measured at 193 nm can be fifteen times smaller in area than current state-of-the-art scatterometry targets described in the literature. This new methodology is demonstrated to be a promising alternative for optical model-based in-die CD metrology. PMID:28757674
Directory of Open Access Journals (Sweden)
Malinowska-Pańczyk Edyta
2018-06-01
Full Text Available The aim of this study was to determine changes in the activity of proteolytic enzymes and transglutaminase of fish and mammal meat after pressurization at subzero temperatures. The activity was measured at the optimal pHs determined for enzymes from particular types of tested meat. It was found that increasing the pressure in the range of 60-193 MPa, did not change significantly the activity of acidic proteases of cod flesh, while the activity of neutral and alkaline proteases decreased drastically. Proteolytic enzymes from salmon flesh were more resistant than those from cod flesh. They maintained or increased (neutral protease activity after pressurization. The activity of the endogenous enzymes of bovine meat increased with pressure increase, except for acidic proteases, the activity of which was reduced after treatment at 193 MPa to the level similar to unpressurized meat. Endogenous proteases of porcine meat were activated by high-pressure treatment. It has been shown that activity of TGase in unpressurized flesh from cod was 5 times higher than that from unpressurized salmon. Depending on the type of meat, these enzymes were also significantly different in their sensitivity to pressure. The pressure of 60 and 193 MPa led to a complete inactivation of the TGase in cod flesh, while the activity of salmon flesh TGase was decreased only by 15 and 21%, respectively.
An enantioselective formal synthesis of (-)-thujopsene
Institute of Scientific and Technical Information of China (English)
Chen Xi Zhang; Li Jing Fang; Fu Qiang Bi; Yu Lin Li
2008-01-01
Dihydromayurone (3), a key intermediate to synthesize (-)-thujopsene (1), was efficient enantiocontrolled synthesized from (+)-dihydrocarvone through 9 steps in an overall yield of 19.3%. The key step was the Simmons-Smith reaction.
A new invasive hawkweed, Hieracium glomeratum (Lactuceae, Asteraceae), in the Pacific Northwest
Czech Academy of Sciences Publication Activity Database
Wilson, L. M.; Fehrer, Judith; Bräutigam, S.; Grosskopf, G.
2006-01-01
Roč. 84, - (2006), s. 133-142 ISSN 0008-4026 Institutional research plan: CEZ:AV0Z60050516 Keywords : Hieracium * invasives * DNA fingerprinting Subject RIV: EF - Botanics Impact factor: 1.193, year: 2006
Chagosensine, a New Chlorinated Macrolide from the Red Sea Sponge Leucetta chagosensis
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Hanuš, L.; Dembitsky, V. M.
- (2003), s. 4073-4079 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : chagosensine * sixteen-membered * clorinated macrolide Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2003
Cyclodextrin glucanotransferase production by cell biocatalysts of alkaliphilic bacilli
Czech Academy of Sciences Publication Activity Database
Atanasova, N.; Kitayska, T.; Yankov, D.; Šafaříková, Miroslava; Tonkova, A.
2009-01-01
Roč. 46, - (2009), s. 278-285 ISSN 1369-703X Institutional research plan: CEZ:AV0Z60870520 Keywords : alkaliphilic bacilli * immobilization Subject RIV: CE - Biochemistry Impact factor: 2.193, year: 2009
Czech Academy of Sciences Publication Activity Database
Dinca, E.; Hartmann, P.; Smrček, Jakub; Dix, I.; Jones, P. G.; Jahn, Ullrich
-, č. 24 (2012), s. 4461-4482 ISSN 1434-193X Institutional support: RVO:61388963 Keywords : carbonyl compounds * oxidation * radicals * electron transfer * enolates Subject RIV: CC - Organic Chemistry Impact factor: 3.344, year: 2012
Forest reclamation of fly ash deposit: a field study on appraisal of mycorrhizal inoculation
Czech Academy of Sciences Publication Activity Database
Sýkorová, Z.; Rydlová, J.; Slavíková, Renata; Ness, T.; Kohout, P.; Püschel, David
2016-01-01
Roč. 24, č. 2 (2016), s. 184-193 ISSN 1061-2971 Institutional support: RVO:61388971 Keywords : arbuscular mycorrhiza * ectomycorrhiza * inoculum tracing Subject RIV: EE - Microbiology, Virology Impact factor: 1.724, year: 2016
An Assessment of Demand for a Combined PharmD-MBA Program at the University of Saskatchewan.
Mansell, Kerry; Bruneau-Bouchard, Antoine; Bruni-Bossio, Vincent
2016-05-13
(1) Background: Combined MBA programs are becoming increasingly popular, and it is anticipated that there will be 60 combined pharmacy-MBA programs across North America in 2015. We aimed to see if there would be support for a combined PharmD-MBA program at the University of Saskatchewan. (2) Methods: A questionnaire was distributed to 1st, 2nd, and 3rd year pharmacy students at the University of Saskatchewan. A separate questionnaire was developed and all practicing pharmacists in Saskatchewan were emailed a link to SurveyMonkey ® (Palo Alto, CA, USA) to fill it out online. In-person and phone interviews were conducted with pharmacy stakeholders in Saskatchewan and across the country. (3) Results: Of the 265 students, 193 (72.8%) were present on the days the questionnaires were distributed, and they all completed the questionnaires. When asked if they would have pursued a combined degree if the U of S had offered it when they entered the pharmacy program, 16.6% (32/193) and 37.3% (72/193) either strongly agreed or agreed and 29.0% (56/193) were unsure. When pharmacists were asked if an MBA would be valuable or applicable in their current job, 42.2% (128/303) agreed and 13.9% (42/303) strongly agreed. When asked if they felt students graduating with a combined degree would be at an advantage for certain job opportunities upon graduation, 33.6% (100/298) strongly agreed and 55.4% (165/298) agreed. A total of 8 interviews were conducted with key stakeholders from across Canada. Of these 8 stakeholders, only 2 were aware that other combined programs were offered. All of the stakeholders were in favour of the idea of a combined degree. Some felt it was important for the program to have a clear value proposition and healthcare related content would be desirable. (4) Conclusions: Overall, pharmacist, pharmacy student, and stakeholder input indicate that a combined program could be supported at the University of Saskatchewan.
An Assessment of Demand for a Combined PharmD–MBA Program at the University of Saskatchewan
Mansell, Kerry; Bruneau-Bouchard, Antoine; Bruni-Bossio, Vincent
2016-01-01
(1) Background: Combined MBA programs are becoming increasingly popular, and it is anticipated that there will be 60 combined pharmacy–MBA programs across North America in 2015. We aimed to see if there would be support for a combined PharmD–MBA program at the University of Saskatchewan. (2) Methods: A questionnaire was distributed to 1st, 2nd, and 3rd year pharmacy students at the University of Saskatchewan. A separate questionnaire was developed and all practicing pharmacists in Saskatchewan were emailed a link to SurveyMonkey® (Palo Alto, CA, USA) to fill it out online. In-person and phone interviews were conducted with pharmacy stakeholders in Saskatchewan and across the country. (3) Results: Of the 265 students, 193 (72.8%) were present on the days the questionnaires were distributed, and they all completed the questionnaires. When asked if they would have pursued a combined degree if the U of S had offered it when they entered the pharmacy program, 16.6% (32/193) and 37.3% (72/193) either strongly agreed or agreed and 29.0% (56/193) were unsure. When pharmacists were asked if an MBA would be valuable or applicable in their current job, 42.2% (128/303) agreed and 13.9% (42/303) strongly agreed. When asked if they felt students graduating with a combined degree would be at an advantage for certain job opportunities upon graduation, 33.6% (100/298) strongly agreed and 55.4% (165/298) agreed. A total of 8 interviews were conducted with key stakeholders from across Canada. Of these 8 stakeholders, only 2 were aware that other combined programs were offered. All of the stakeholders were in favour of the idea of a combined degree. Some felt it was important for the program to have a clear value proposition and healthcare related content would be desirable. (4) Conclusions: Overall, pharmacist, pharmacy student, and stakeholder input indicate that a combined program could be supported at the University of Saskatchewan. PMID:28970393
2. The Data Librarian: introducing the Data Librarian
Liscouski, Joe
1997-01-01
This paper provides some initial considerations into the design and function of the Data Librarian. The first part (Liscouski, J., 1997, Journal of Automatic Chemistry, 19, 193-197) described the need for the Librarian.
Quality of Care: A Review Of Maternal Deaths In A Regional ...
African Journals Online (AJOL)
AJRH Managing Editor
emergency obstetric care services to prevent further maternal deaths. (Afr J Reprod Health 2015; 19[3]: 68-76). Keywords: Maternal death, Review, Quality of care, Sub-saharan Africa, Ghana .... technology, adequate human resource, health.
Czech Academy of Sciences Publication Activity Database
Šturma, Pavel
2009-01-01
Roč. 8, č. 7 (2009), s. 193-197 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences
WELFARE REFORM: Progress in Meeting Work-Focused TANF Goals
National Research Council Canada - National Science Library
2001-01-01
.... The 1996 Personal Responsibility and Work Opportunity Reconciliation Act of 1996 (P.L. 104-193) (PRWORA) significantly changed federal welfare policy for low-income families with children, building upon and expanding state-level reforms...
Czech Academy of Sciences Publication Activity Database
Kadlec, Jaroslav; Kocurek, G.; Mohrig, D.; Shinde, D. P.; Murari, M. K.; Varma, V.; Stehlík, F.; Beneš, V.; Singhvi, A. K.
2015-01-01
Roč. 232, 1 March (2015), s. 193-208 ISSN 0169-555X Institutional support: RVO:67985530 Keywords : Quaternary * Czech Republic * Fluvio-aeolian Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.813, year: 2015
Logic Reduced To Bare (Proof-Theoretical) Bones
Czech Academy of Sciences Publication Activity Database
Peregrin, Jaroslav
2015-01-01
Roč. 24, č. 2 (2015), s. 193-209 ISSN 0925-8531 Institutional support: RVO:67985955 Keywords : inference * incompatibility * proof theory * intuitionistic logic Subject RIV: AA - Philosophy ; Religion Impact factor: 0.450, year: 2015
E2 and M1 Transition Probabilities in Odd Mass Hg Nuclei
Energy Technology Data Exchange (ETDEWEB)
Berg, V; Baecklin, A; Fogelberg, B; Malmskog, S G
1969-10-15
L- and M-subshell ratios have been measured for the 39.5 keV transition in {sup 193}Hg and the 37.1 and 16.2 keV transitions in {sup 195}Hg yielding 0.38 {+-} 0.12 , <0.02 and 0.08 {+-} 0.03 per cent E2, respectively. The half-lives of the 39.5 keV level in {sup 193}Hg and the 53.3 and 37.1 keV levels in {sup 195}Hg have been measured by the delayed coincidence method, yielding values of 0.63 {+-} 0.03, 0.72 {+-} 0.03 and <0.05 nsec respectively. A systematic compilation of reduced E2 and M1 transition probabilities in odd mass Pt, Hg and Pb nuclei is given and compared to theoretical predictions.
Frailty in Chinese Peritoneal Dialysis Patients: Prevalence and Prognostic Significance
Directory of Open Access Journals (Sweden)
Jack Kit-Chung Ng
2016-10-01
Full Text Available Background/Aims: Previous studies showed that frailty is prevalent in both pre-dialysis and dialysis patients. However, the prevalence and prognostic implication of frailty in Chinese peritoneal dialysis (PD patients remain unknown. Methods: We used a validated questionnaire to determine the Frailty Score of 193 unselected prevalent PD patients. All patients were then followed for 2 years for their need of hospitalization and mortality. Results: Amongst the 193 patients, 134 (69.4% met the criteria of being frail. Frailty Score significantly correlated with Charlson's comorbidity score (r = 0.40, p Conclusions: Frailty is prevalent among Chinese PD patients. Frail PD patients have a high risk of requiring hospitalization and their hospital stay tends to be prolonged. Early identification may allow timely intervention to prevent adverse health outcomes in this group of patients.
e-beam induced EUV photomask repair: a perfect match
Waiblinger, M.; Kornilov, K.; Hofmann, T.; Edinger, K.
2010-05-01
Due to the updated ITRS roadmap EUV might enter the market as a productive solution for the 32 nm node1. Since the EUV-photomask is used as mirror and no longer as transitive device the severity of different defect types has changed significantly. Furthermore the EUV-photomask material stack is much more complex than the conventional 193nm photomask materials which expand the field of critical defect types even further. In this paper we will show, that "classical" 193 mask repair processes cannot be applied to EUV material. We will show the performance of a new repair process based on the novel ebeam repair tool MeRiT® HR 32. Furthermore this process will be applied on real EUV mask defects and the success of these repairs confirmed by wafer prints.
CEBAF SRF Performance during Initial 12 GeV Commissioning
International Nuclear Information System (INIS)
Bachimanchi, Ramakrishna; Allison, Trent; Daly, Edward; Drury, Michael; Hovater, J; Lahti, George; Mounts, Clyde; Nelson, Richard; Plawski, Tomasz
2015-09-01
The Continuous Electron Beam Accelerator Facility (CEBAF) energy upgrade from 6 GeV to 12 GeV includes the installation of eleven new 100 MV cryomodules (88 cavities). The superconducting RF cavities are designed to operate CW at an accelerating gradient of 19.3 MV/m with a Q L of 3x10 7 . Not all the cavities were operated at the minimum gradient of 19.3 MV/m with the beam. Though the initial 12 GeV milestones were achieved during the initial commissioning of CEBAF, there are still some issues to be addressed for long term reliable operation of these modules. This paper reports the operational experiences during the initial commissioning and the path forward to improve the performance of C100 (100 MV) modules.
2010-12-30
..., 6231, 6232, 6233, 6239. facilities. Personal and laundry services 8122, 8123. Residential/private... States Postal Service, 946 F.2d 189, 193 (2d Cir. 1991); Iowa Power & Light Co. v. United States, 712 F...
Idea národa československého na stránkách týdeníku Přítomnost (1924-1938)
Czech Academy of Sciences Publication Activity Database
Harna, Josef
2009-01-01
Roč. 17, č. 1 (2009), s. 169-193 ISSN 1210-6860 Institutional research plan: CEZ:AV0Z80150510 Keywords : 20th Century * Czechoslovak history * Czecho-Slovak relations * czechoslovakianism * journalism Subject RIV: AB - History
Excitation of triplet states of hypericin in water mediated by hydrotropic cromolyn sodium salt
Czech Academy of Sciences Publication Activity Database
Keša, P.; Jančura, D.; Kudláčová, Júlia; Valušová, E.; Antalík, M.
2018-01-01
Roč. 193, 15 March (2018), s. 185-191 ISSN 1386-1425 Institutional support: RVO:61389013 Keywords : cromolyn * hydrotrope * hypericin Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.536, year: 2016
climate changes and farmers' endogenous adaptation strategies
African Journals Online (AJOL)
Prof. Adipala Ekwamu
20, Issue Supplement s2, pp. 193 - 202 ... SOCIO ECONOMIC ANALYSIS OF THE DYNAMIC USE OF AGRICULTURAL LANDS IN. CENTRAL ... adaptation actually occurs in economic and social ... land fertility is generally known as bad now.
FastStats: Self-Inflicted Injury/Suicide
... this? Submit What's this? Submit Button NCHS Home Suicide and Self-Inflicted Injury Recommend on Facebook Tweet ... Tables, table 17 [PDF – 676 KB] Mortality All suicides Number of deaths: 44,193 Deaths per 100, ...
Carpentier, P.J.; Knapen, L.J.; Gogh, M.T. van; Buitelaar, J.K.; Jong, C.A.J. de
2012-01-01
This retrospective cross-sectional study examines whether conduct disorder and attention deficit hyperactivity disorder are associated with problem severity and psychiatric comorbidity in 193 middle-aged, opioid-dependent patients. Conduct disorder history, attention deficit hyperactivity disorder,
2010-12-30
... and residential care 6221, 6231, 6232, 6233, 6239. facilities. Personal and laundry services 8122..., 997 (6th Cir. 1993); Dun & Bradstreet Corp. v. United States Postal Service, 946 F.2d 189, 193 (2d Cir...
Czech Academy of Sciences Publication Activity Database
Sabuni, C. A.; Van Houtte, N.; Maganga, S. L. S.; Makundi, R. H.; Leirs, H.; Goüy de Bellocq, Joëlle
2015-01-01
Roč. 7, č. 1 (2015), s. 193-195 ISSN 1877-7252 Institutional support: RVO:68081766 Keywords : Rhynchocyon petersi * Vulnerable afrotherian * Microsatellites * 454 Sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.446, year: 2015
Pediatric Palliative Care: A Personal Story
Full Text Available ... NEOMED) 26,193 views 5:39 Little Stars – Paediatric Palliative Care – Charlie's Story - Duration: 10:35. Little Stars 12,759 ... in to add this to Watch Later Add to Loading playlists...
Bambusurils bearing nitro groups and their further modifications
Czech Academy of Sciences Publication Activity Database
Yawer, M. A.; Sleziakova, K.; Pavlovec, Lukáš; Šindelář, V.
2018-01-01
Roč. 2018, č. 1 (2018), s. 41-47 ISSN 1434-193X Institutional support: RVO:61389013 Keywords : macrocycles * bambusurils * template Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.834, year: 2016
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Siřišťová, L.; Melzoch, K.; Sigler, Karel
2010-01-01
Roč. 7, č. 4 (2010), s. 300-313 ISSN 1570-193X Institutional research plan: CEZ:AV0Z50200510 Keywords : bacteriohopanol * apci * hplc Subject RIV: EE - Microbiology, Virology Impact factor: 2.284, year: 2010
Czech Academy of Sciences Publication Activity Database
Antón-Pardo, Maria; Armengol, X.; Ortells, R.
2016-01-01
Roč. 75, č. 1 (2016), s. 193-203 ISSN 1129-5767 Institutional support: RVO:60077344 Keywords : Crustaceans * dispersal * diversity * metacommunity dynamics * rotifers * similarity * singularity Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.451, year: 2016
EST Table: FS748350 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available PREDICTED: similar to fetal alzheimer antigen, falz [Nasonia vitripennis] 10/09/08 37 %/193 aa FBpp0290563|E...811424.1| PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] FS748350 caL- ...
Detection of low concentrations of fine-grained iron oxides by voltammetry of microparticles
Czech Academy of Sciences Publication Activity Database
Oorschot van, I. H. M.; Grygar, Tomáš; Dekkers, M. J.
2001-01-01
Roč. 193, 3-4 (2001), s. 631-642 ISSN 0012-821X Institutional research plan: CEZ:AV0Z4032918 Keywords : hematite * goethite * analysis Subject RIV: CA - Inorganic Chemistry Impact factor: 2.700, year: 2001
Reconciling Nationalism and Stability in Eurasia
National Research Council Canada - National Science Library
Bond, Clifford G
1992-01-01
.... Left to their own devices, the new Eurasian states could repeat the ethnic strife and political instability that became endemic in Central Europe in the 1920s and invited great power intervention in the 193Os...
Examining the attunement between health literacy and hope in ...
African Journals Online (AJOL)
Journal of Fundamental and Applied Sciences ... The population was 193 patients with ACS admitted to the hospitals of Jahrom University of Medical Sciences in 2016. ... Data analysis was done in spss 18 using descriptive statistics (mean, ...
National Research Council Canada - National Science Library
Fife, J
2001-01-01
.... The on-board Servo Accelerometer Assembly (SAA) measured spacecraft acceleration. The mean values of thrust, specific impulse and thrust efficiency are 1.93 +/- 0.06 Newtons, 786.2 +/- 43.0 seconds and 0.267 +/- 0.021, respectively...
2016-2017 Travel Expense Reports for Stephen McGurk, Vice ...
International Development Research Centre (IDRC) Digital Library (Canada)
Beata Bialic
-08-22 to 2016-08-23. Destination(s):. Montreal. Airfare: $0.00. Other. Transportation: $193.45. Accommodation: $421.63. Meals and. Incidentals: $94.01. Other: $0.00. Total: $709.09. Comments: 2016-2017 Travel Expense Reports for.
African Zoology - Vol 44, No 2 (2009)
African Journals Online (AJOL)
) in the Okavango Delta, Botswana · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Rutledge S. Boyes, Michael R. Perrin, 181-193. http://dx.doi.org/10.3377/004.044.0206 ...
Thermoelectric properties and nonstoichiometry of GaGeTe
Czech Academy of Sciences Publication Activity Database
Drašar, Č.; Kucek, V.; Beneš, L.; Lošťák, P.; Vlček, Milan
2012-01-01
Roč. 193, SI (2012), s. 42-46 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z40500505 Keywords : gallium germanium telluride * thermoelectric properties * stoichiometry Subject RIV: CA - Inorganic Chemistry Impact factor: 2.040, year: 2012
Lifescience Database Archive (English)
Full Text Available tric agent ... DG01941 ... Benzamide antipsychotic ATC code: N05AL06 ... Benzamide derivative ... CAS: 66644-81-3 PubChem: 51091648 ChEMBL: CHEMBL2105581 LigandBox: D07311 NIKKAJI: J19.193K ...
: tous les projets | Page 564 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: ECONOMIC REFORM, ECONOMIC LIBERALIZATION, ECONOMIC GROWTH, ECONOMIC BEHAVIOUR, MICROECONOMICS, Poverty alleviation. Région: Tanzania, North of Sahara, South of Sahara. Programme: Emploi et croissance. Financement total : CA$ 193,000.00. Perspectives microéconomiques de ...
African Journals Online (AJOL)
Items 1 - 50 of 193 ... Vol 9 (2011), An Investigation on Industrial Fishery in Lagos State, Nigeria, Abstract ... Gas Production and Coefficient of Preference Technique, Abstract ... Vol 4 (2005), Determinants of production level of commercial snail ...
Identification of XMRV infection-associated microRNAs in four cell types in culture.
Directory of Open Access Journals (Sweden)
Ketha V K Mohan
Full Text Available INTRODUCTION: XMRV is a gammaretrovirus that was thought to be associated with prostate cancer (PC and chronic fatigue syndrome (CFS in humans until recently. The virus is culturable in various cells of human origin like the lymphocytes, NK cells, neuronal cells, and prostate cell lines. MicroRNAs (miRNA, which regulate gene expression, were so far not identified in cells infected with XMRV in culture. METHODS: Two prostate cell lines (LNCaP and DU145 and two primary cells, Peripheral Blood Lymphocytes [PBL] and Monocyte-derived Macrophages [MDM] were infected with XMRV. Total mRNA was extracted from mock- and virus-infected cells at 6, 24 and 48 hours post infection and evaluated for microRNA profile in a microarray. RESULTS: MicroRNA expression profiles of XMRV-infected continuous prostate cancer cell lines differ from that of virus-infected primary cells (PBL and MDMs. miR-193a-3p and miRPlus-E1245 observed to be specific to XMRV infection in all 4 cell types. While miR-193a-3p levels were down regulated miRPlus-E1245 on the other hand exhibited varied expression profile between the 4 cell types. DISCUSSION: The present study clearly demonstrates that cellular microRNAs are expressed during XMRV infection of human cells and this is the first report demonstrating the regulation of miR193a-3p and miRPlus-E1245 during XMRV infection in four different human cell types.
S-N Fatigue and Fatigue Crack Propagation Behaviors of X80 Steel at Room and Low Temperatures
Jung, Dae-Ho; Kwon, Jae-Ki; Woo, Nam-Sub; Kim, Young-Ju; Goto, Masahiro; Kim, Sangshik
2014-02-01
In the present study, the S-N fatigue and the fatigue crack propagation (FCP) behaviors of American Petroleum Institute X80 steel were examined in the different locations of the base metal (BM), weld metal (WM), and heat-affected zone (HAZ) at 298 K, 223 K, and 193 K (25 °C, -50 °C, and -80 °C). The resistance to S-N fatigue of X80 BM specimen increased greatly with decreasing temperature from 298 K to 193 K (25 °C to -80 °C) and showed a strong dependency on the flow strength (½(yield strength + tensile strength)). The FCP rates of X80 BM specimen were substantially reduced with decreasing temperature from 298 K to 223 K (25 °C to -50 °C) over the entire ∆ K regime, while further reduction in FCP rates was not significant with temperature from 223 K to 193 K (-50 °C to -80 °C). The FCP rates of the X80 BM and the WM specimens were comparable with each other, while the HAZ specimen showed slightly better FCP resistance than the BM and the WM specimens over the entire ∆K regime at 298 K (25 °C). Despite the varying microstructural characteristics of each weld location, the residual stress appeared to be a controlling factor to determine the FCP behavior. The FCP behaviors of high strength X80 steel were discussed based on the microstructural and the fractographic observations.
Sexospécificités | Page 193 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
The men and women are part of a 180-strong workforce that produces up to 700 mosquito nets each day, marketed under brand names such as "Health Net" and "Sweet Dreams." Read more about Material gain: bednets treated with insecticides improve the lives of Tanzanians. Langue English. Vers le milieu des années ...
46 CFR 193.50-90 - Vessels contracted for prior to March 1, 1968.
2010-10-01
...-10(a). Minor modifications may be made to the same standard as the original installation: Provided... service so long as they are maintained in good condition to the satisfaction of the Officer in Charge... VESSELS FIRE PROTECTION EQUIPMENT Hand Portable Fire Extinguishers and Semiportable Fire Extinguishing...
FCJ-193 Harbouring Dissent: Greek Independent and Social Media and the Antifascist Movement
Directory of Open Access Journals (Sweden)
Sky Croeser
2015-06-01
Full Text Available This article examines Greek activists’ use of a range of communication technologies, including social media, blogs, citizen journalism sites, Web radio, and anonymous networks. Drawing on Anna Tsing’s theoretical model, the article examines key frictions around digital technologies that emerged within a case study of the antifascist movement in Athens, focusing on the period around the 2013 shutdown of Athens Indymedia. Drawing on interviews with activists and analysis of online communications, including issue networks and social media activity, we find that the antifascist movement itself is created and recreated through a process of productive friction, as different groups and individuals with varying ideologies and experiences work together.
Czech Academy of Sciences Publication Activity Database
Polačik, Matej; Janáč, Michal; Trichkova, T.; Vassilev, M.; Keckeis, H.; Jurajda, Pavel
2008-01-01
Roč. 18, 1-2 (2008), s. 193-208 ISSN 0945-3784 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : Neogobius fishes * Danube River Subject RIV: EH - Ecology, Behaviour
Czech Academy of Sciences Publication Activity Database
Pateman-Jones, C.; Rasotto, M. B.; Reichard, Martin; Liao, C.; Liu, H.; Zieba, G.; Smith, C.
2011-01-01
Roč. 103, č. 3 (2011), s. 622-632 ISSN 0024-4066 Institutional research plan: CEZ:AV0Z60930519 Keywords : reproduction * sperm competition * sperm depletion * sperm economy Subject RIV: EG - Zoology Impact factor: 2.193, year: 2011
African Journals Online (AJOL)
raoul
2011-11-25
Nov 25, 2011 ... Published in partnership with the African Field Epidemiology Network (AFENET). ... (7.16%), Eosinophils 0.193x109 (4.4%), Basophils 0.035x109 (0.796%). ... World Health Organization defines complicated malaria as those ...
Czech Academy of Sciences Publication Activity Database
Cernusca, S.; Diem, A.; Winter, H. P.; Aumayr, F.; Lörinčík, Jan; Šroubek, Zdeněk
2002-01-01
Roč. 193, - (2002), s. 616-620 ISSN 0168-583X Institutional research plan: CEZ:AV0Z4040901 Keywords : clean metal-surface * slow * polycrystalline gold Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.158, year: 2002
Cell Physiology and Interactions of Biomaterials and Matrices
Czech Academy of Sciences Publication Activity Database
Hunkeler, D.; Vaňková, Radomíra
2003-01-01
Roč. 28, č. 6 (2003), s. 193-197 ISSN 0032-3918 R&D Projects: GA MŠk OC 840.20 Institutional research plan: CEZ:AV0Z5038910 Keywords : Biomaterials * Cell physiology * Encapsulation Subject RIV: CE - Biochemistry
77 FR 29692 - Segun M. Rasaki, M.D.; Decision and Order
2012-05-18
... CFR 1316.67. Dated: May 4, 2012. Michele M. Leonhart, Administrator. Paul E. Soeffing, Esq., for the... reinstatement.'' Stuart A. Bergman, M.D., 70 Fed. Reg. 33,193 (DEA 2005); Roger A. Rodriguez, M.D., 70 Fed. Reg...
Multi-wavelength observations of Asteroid 2100 Ra-Shalom
Czech Academy of Sciences Publication Activity Database
Shepard, M.K.; Clark, B. E.; Nolan, M. C.; Benner, L. A. M.; Ostro, S. J.; Giorgini, J. D.; Vilas, F.; Jarvis, K.; Lederer, S.; Lim, L.F.; McConnochie, T.; Bell, J.; Margot, J. L.; Rivkin, A. S.; Magrik, C.; Scheeres, D.J.; Pravec, Petr
2008-01-01
Roč. 193, č. 1 (2008), s. 20-38 ISSN 0019-1035 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids composition * radar observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.268, year: 2008
National Research Council Canada - National Science Library
Lucey, George
1998-01-01
The U.S. Marine Corps Joint Nonlethal Weapons Directorate tasked the U.S. Army to demonstrate a means of quickly converting the Navy MK19-3 automatic 40-mm grenade launcher between lethal and nonlethal modes of operation...
Substituent effects of the alkyl groups: Polarity vs. polarizability
Czech Academy of Sciences Publication Activity Database
Exner, Otto; Böhm, S.
-, č. 17 (2007), s. 2870-2876 ISSN 1434-193X Institutional research plan: CEZ:AV0Z40550506 Keywords : density functional calculations * hyperconjugation * inductive effect * polarizability Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.914, year: 2007
International Nuclear Information System (INIS)
Wang, Huizheng; Guo, Jiubiao; Pang, Hai; Zhang, Xiuguo
2010-01-01
The MaoC-like dehydratase from P. capsici was cloned, expressed and purified to homogeneity. Crystals were obtained that diffracted to 1.93 Å resolution. MaoC-like dehydratase (MaoC) plays an important role in supplying (R)-3-hydroxyacyl-CoA from the fatty-acid oxidation pathway to polyhydroxyalkanoate (PHA) biosynthetic pathways. PHAs have been attracting much attention as they can be used in the biosynthesis of synthetic plastics. Crystals of MaoC from Phytophora capsici were grown by the hanging-drop vapour-diffusion method at 289 K in a number of screening conditions. An MaoC crystal diffracted to 1.93 Å resolution using X-ray radiation and belonged to the orthorhombic space group P2 1 2 1 2 1 , with unit-cell parameters a = 81.458, b = 82.614, c = 124.228 Å, α = β = γ = 90°
Directory of Open Access Journals (Sweden)
Gilioli R.
2000-01-01
Full Text Available Thirty-one captive maned wolves (Chrysocyon brachyurus, Illiger 1815 from 11 Zoos at the State of São Paulo, Brazil, were screened to investigate the presence of parasites and Salmonella infection by parasitological diagnostic methods and fecal selective culture. The most frequent ecto and endoparasites found were Ctenocephalides felis (56.2%, Rhipicephalus sanguineus (12.5%, Ancylostoma caninum (45.1%, Strongyloides sp. (29.0%, Uncinaria stenocephala (3.2%, Capillaria sp. (3.2%, Entamoeba sp. (22.9%, Sarcocystis sp. (29.0%, Cryptosporidium sp. (19.3%, Eimeria sp. (19.3%, Giardia sp. (9.6% and Isospora sp. (3.2%. Four different serotypes of Salmonella were identified in six animals (25%. Only one infected animal showed clinical signs of diarrhea. The ability to harbor Salmonella spp. as normal nonpathogenic bacteria of the gastrointestinal tract may be a physiological adaptation of this specie.
UV and RIR matrix assisted pulsed laser deposition of organic MEH-PPV films
International Nuclear Information System (INIS)
Toftmann, B.; Papantonakis, M.R.; Auyeung, R.C.Y.; Kim, W.; O'Malley, S.M.; Bubb, D.M.; Horwitz, J.S.; Schou, J.; Johansen, P.M.; Haglund, R.F.
2004-01-01
A comparative study of thin film production based on gentle laser-ablation techniques has been carried out with the luminescent polymer poly[2-methoxy-5-(2'-ethylhexyloxy)-1,4-phenylene vinylene]. Using a free-electron laser films were made by resonant infrared pulsed laser deposition (RIR-PLD). For the first time resonant infrared matrix assisted pulsed laser evaporation (RIR-MAPLE) was successfully demonstrated on a luminescent polymer system. In addition to this, an excimer laser has been used for UV-MAPLE depositions at 193 and 248-nm irradiation. Films deposited onto NaCl and quartz substrates were analyzed by Fourier transform infrared spectroscopy, UV-visible absorbance and photoluminescence. Photoluminescent material was deposited by RIR-MAPLE and 248-nm MAPLE, while the RIR-PLD and 193-nm-MAPLE depositions displayed the smoothest surfaces but did not show photoluminescence
UV and RIR matrix assisted pulsed laser deposition of organic MEH-PPV films
DEFF Research Database (Denmark)
Christensen, Bo Toftmann; Papantonalis, M.R.; Auyeung, R.C.Y.
2004-01-01
-PLD). For the first time resonant infrared matrix assisted pulsed laser evaporation (RIR-MAPLE) was successfully demonstrated on a luminescent polymer system. In addition to this, an excimer laser has been used for UV-MAPLE depositions at 193 and 248-nm irradiation. Films deposited onto NaCl and quartz substrates......A comparative study of thin film production based on gentle laser-ablation techniques has been carried out with the luminescent polymer poly [2-methoxy-5-(2'-ethylhexyloxy)-1,4-phenylene vinylene]. Using a free-electron laser films were made by resonant infrared pulsed laser deposition (RIR...... were analyzed by Fourier transform infrared spectroscopy, UV-visible absorbance and photoluminescence. Photoluminescent material was deposited by RIR-MAPLE and 248-nm MAPLE, while the RIR-PLD and 193-nm-MAPLE depositions displayed the smoothest surfaces but did not show photoluminescence. (C) 2003...
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...
African Journals Online (AJOL)
Items 101 - 150 of 193 ... Vol 13, No 2 (2011), Leaf stomata conductance, leaf water potential and soil ... Vol 14, No 2 (2012), Nanotechnology: The magic bullet towards ... for the treatment of malaria in Oshogbo, south-western Nigeria, Abstract.
Pediatric Palliative Care: A Personal Story
Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,802 views 5: ... University (NEOMED) 26,193 views 5:39 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...
Czech Academy of Sciences Publication Activity Database
Tomek, Filip; Žák, J.; Verner, K.; Holub, F. V.; Sláma, Jiří; Paterson, S. R.; Memeti, V.
2017-01-01
Roč. 174, č. 2 (2017), s. 193-208 ISSN 0016-7649 Institutional support: RVO:67985831 Keywords : tectonics * volcanic rocks * volcanoes * Late Cretaceous * magmatic arc Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.037, year: 2016
Czech Academy of Sciences Publication Activity Database
Šálek, Martin; Červinka, J.; Banea, O. C.; Krofel, M.; Ćirović, D.; Selanec, I.; Penezić, A.; Grill, S.; Riegert, J.
2014-01-01
Roč. 60, č. 2 (2014), s. 193-200 ISSN 1612-4642 Institutional support: RVO:68081766 Keywords : Golden jackal * Acoustic monitoring * Population density * Habitat use * GIS * Farmland * Balkan Peninsula Subject RIV: EG - Zoology Impact factor: 1.634, year: 2014
Pediatric Palliative Care: A Personal Story
Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,836 views 5: ... University (NEOMED) 26,193 views 5:39 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...
Psychosocial Stress Among Patients With Type 2 Diabetes: Habitual ...
African Journals Online (AJOL)
USER
A total of 193 adults with type 2 diabetes took part in this study. Psychosocial stress was ... KEY WORDS: Type 2 diabetes, psychosocial stress, habitual physical activity. INTRODUCTION ..... to address them: A qualitative study. PLoS ONE 9(9):.
Occupational exposure, attitude to HIV-positive patients and uptake ...
African Journals Online (AJOL)
2017-11-13
Nov 13, 2017 ... counselling and testing among health care workers in a tertiary hospital in Nigeria, SAHARA-J: Journal of Social Aspects of HIV/AIDS, 14:1, 193-201, DOI: ..... work and experience of workplace accidents with exposure to.
Tchangské křesťanství („nestoriánství“) v Číně a jeho jesuitská reflexe v 17. století
Czech Academy of Sciences Publication Activity Database
Liščák, Vladimír
-, 9-10 (2016), s. 193-276. ISBN 978-80-87378-84-7. ISSN 1802-8209 Institutional support: RVO:68378009 Keywords : Christianity in China * Nestorianism * Luminous Religion * Xi’an stele * Jesuit stele Subject RIV: AB - History OBOR OECD: Religious studies
Pediatric Palliative Care: A Personal Story
Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,792 views 5: ... University (NEOMED) 26,193 views 5:39 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...
Czech Academy of Sciences Publication Activity Database
Shibata, H.; Branquinho, C.; McDowell, W. H.; Mitchell, J.M.; Monteith, D. T.; Tang, J.; Arvola, L.; Cruz, C.; Cusack, D.F.; Halada, L.; Kopáček, Jiří; Máguas, C.; Sajidu, S.; Schubert, H.; Tokuchi, N.; Záhora, J.
2015-01-01
Roč. 44, č. 3 (2015), s. 178-193 ISSN 0044-7447 Institutional support: RVO:60077344 Keywords : atmospheric deposition * biogeochemistry * water quality * N2O * nitrogen leaching Subject RIV: DJ - Water Pollution ; Quality Impact factor: 2.555, year: 2015
Synthesis of Electron-Rich Sterically Hindered P-1 Phosphazene Bases by the Staudinger Reaction
Czech Academy of Sciences Publication Activity Database
Alexandrova, Anastasia; Mašek, Tomáš; Polyakova, Svetlana; Císařová, I.; Saame, J.; Leito, I.; Lyapkalo, Ilya
-, č. 9 (2013), s. 1811-1823 ISSN 1434-193X Institutional research plan: CEZ:AV0Z40550506 Keywords : phosphazenes * phosphazides * Staudinger reaction * azides * basicity * structure-activity relationships Subject RIV: CC - Organic Chemistry Impact factor: 3.154, year: 2013
Czech Academy of Sciences Publication Activity Database
Vaníčková, Lucie; Břízová, Radka; Pompeiano, A.; Ferreira, L. L.; De Aquino, N. C.; Tavares, R. F.; Rodriguez, L. D.; Mendonca, A. L.; Canal, N. A.; do Nascimento, R. R.
-, č. 540 (2015), s. 193-209 ISSN 1313-2989 Institutional support: RVO:61388963 Keywords : cryptic species * chemotaxonomy * GCxGC/MS * PCA Subject RIV: EG - Zoology Impact factor: 0.938, year: 2015 http://zookeys.pensoft.net/articles.php?id=6224
International Nuclear Information System (INIS)
Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.
2010-01-01
Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.
In Vitro Approaches to Evaluation of Sun Protectin Factor
Czech Academy of Sciences Publication Activity Database
Bendová, H.; Akrman, J.; Krejčí, A.; Kubáč, L.; Jírová, D.; Kejlová, K.; Kolářová, H.; Brabec, Marek; Malý, M.
2007-01-01
Roč. 21, č. 7 (2007), s. 1268-1275 ISSN 0887-2333 Source of funding: V - iné verejné zdroje Keywords : sunscreens * in vitro * SPF * nonparametric model Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.193, year: 2007
A germline RET proto-oncogene mutation in multiple members of an ...
African Journals Online (AJOL)
Makia Marafie
2016-09-17
Sep 17, 2016 ... The Egyptian Journal of Medical Human Genetics (2017) 18, 193–197. HOSTED BY ... been reported in 85% of tested individuals, nearly 50% of them are amino acid .... [1] Krampitz GW, Norton JA. RET gene mutations ...
Effect of compression pressure on mechanical and electrical properties of polyaniline pellets
Czech Academy of Sciences Publication Activity Database
Valentová, H.; Prokeš, J.; Nedbal, J.; Stejskal, Jaroslav
2013-01-01
Roč. 67, č. 8 (2013), s. 1109-1112 ISSN 0366-6352 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : conducting polymer * hardness * mechanical properties Subject RIV: CG - Electrochemistry Impact factor: 1.193, year: 2013
Numerical Model of the Human Cardiovascular System-Korotkoff Sounds Simulation
Czech Academy of Sciences Publication Activity Database
Maršík, František; Převorovská, Světlana; Brož, Z.; Štembera, V.
Vol.4, č. 2 (2004), s. 193-199 ISSN 1432-9077 R&D Projects: GA ČR GA106/03/1073 Institutional research plan: CEZ:AV0Z2076919 Keywords : cardiovascular system * Korotkoff sounds * numerical simulation Subject RIV: BK - Fluid Dynamics
Touchstones and mercury at Hedeby
Czech Academy of Sciences Publication Activity Database
Ježek, Martin; Holub, M.
2014-01-01
Roč. 89, č. 1 (2014), s. 193-204 ISSN 0079-4848 Institutional support: RVO:67985912 Keywords : Hedeby * Viking Age * grave goods * touchstone * precious metal * mercury * chemical microanalysis * archaeometallurgy Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.278, year: 2014
Conducting polymer-silver composites
Czech Academy of Sciences Publication Activity Database
Stejskal, Jaroslav
2013-01-01
Roč. 67, č. 8 (2013), s. 814-848 ISSN 0366-6352 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * polypyrrole * silver Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.193, year: 2013
76 FR 53453 - Environmental Impacts Statements; Notice of Availability
2011-08-26
... ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-8998-7] Environmental Impacts Statements; Notice of....epa.gov/compliance/nepa/ . Weekly receipt of Environmental Impact Statements. Filed 08/15/2011 through... Lease Sale 193, Revised Information, Analyzing the Environmental Impact of Natural Gas Development and...
Verest saab vein : [luuletused] / Mare Osi
Osi, Mare
2003-01-01
Sisu: "Must üü nigu kaaren ..." ; Metamorfoos ; Pettumus ; Skeptiline ; Talisman ; Unetet latsepõli ; Meie kaits ; Sannaõhtu ; "Külmä süä lüüdi lõhki ..." ; "Egäl kevädil ...". Eluloolisi andmeid autori kohta lk. 193
Triterpenoids From the Leaves of Olax mannii Oliv. * MISule, HS
African Journals Online (AJOL)
2. A.A. Ambi. 1Department of Pharmaceutical and Medicinal Chemistry, Faculty of Pharmaceutical Sciences,. Ahmadu Bello University, Zaria-Nigeria. 2Department of Pharmacognosy, Faculty of Pharmaceutical Sciences,. Ahmadu Bello University, Zaria-Nigeria. [*Corresponding Author, E-mail: ibrasule@gmail.com]. 193.
Reaction of thiolesters with nitrogen ylides
Czech Academy of Sciences Publication Activity Database
Voltrová, Svatava; Šrogl, Jiří
-, č. 10 (2008), s. 1677-1679 ISSN 1434-193X Institutional research plan: CEZ:AV0Z40550506 Keywords : thiolesters * nitrogen ylides * ammonium salts * tetrahydrothiophenes * 1,2-thiolata shift Subject RIV: CC - Organic Chemistry Impact factor: 3.016, year: 2008
Czech Academy of Sciences Publication Activity Database
Horáček, Jaromír; Radolf, Vojtěch; Bula, Vítězslav; Laukkanen, A. M.
2014-01-01
Roč. 21, č. 3 (2014), s. 193-200 ISSN 1802-1484 R&D Projects: GA ČR GAP101/12/1306 Institutional support: RVO:61388998 Keywords : biomechanics of voice * subglottal * oral and transglottal pressure * flow resistance Subject RIV: BI - Acoustics
Energy Technology Data Exchange (ETDEWEB)
Kravchenko, Natasa [Brandeis Univ., Waltham, MA (United States)
2008-05-01
We present a measurement of the relative branching ratio of the Cabibbo-suppressed D+ meson decay into three charged pions using 193 pb-1 of data collected by CDF II detector at Fermilab's Tevatron.
Czech Academy of Sciences Publication Activity Database
Klečka, Martin; Poštová Slavětínská, Lenka; Hocek, Michal
2015-01-01
Roč. 2015, č. 36 (2015), s. 7943-7961 ISSN 1434-193X Institutional support: RVO:61388963 Keywords : synthetic methods * cross - coupling * C-H activation * nitrogen heterocycles * nucleobases * deazapurines Subject RIV: CC - Organic Chemistry Impact factor: 3.068, year: 2015
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i