International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
Development of a new osmium-191: Iridium-191m radionuclide generator: Final report
International Nuclear Information System (INIS)
Treves, S.; Packard, A.B.
1986-01-01
The use of iridium-191m (T/sub 1/2/ = 5s) for first-pass radionuclide angiography offers the potential advantages of lower patient radiation dose and the ability to obtain repeated studies without interference from the previously administered radioisotope. These potential advantages have been offset by the absence of satisfactory 191 Os-/sup 191m/Ir generators. The goal of this project was, therefore, the development of an 191 Os-/sup 191m/Ir generator that would be suitable for clinical use. This goal was first sought through modifications of an existing 191 Os-/sup 191m/Ir generator design (i.e., changes in the ion exchange material and eluent) but these changes did not lead to the required improvements. A new approach was then undertaken in which different chemical forms of the 191 Os parent were evaluated in prototype generators. The complex trans-dioxobisoxalatoosmate (VI) led to a generator with higher /sup 191m/Ir yield (25 to 30%/mL) and lower 191 Os breakthrough ( -4 %) with a more physiologically compatible eluent than had been previously achieved. Toxicity studies were conducted on the eluate and an IND subsequently obtained. While this is not a final solution to the problem of developing a clinically acceptable 191 Os-/sup 191m/Ir generator, the ''oxalate'' generator is the most significant improvement of the 191 Os-/sup 191m/Ir generator to date and will be used in an expanded program of clinical studies. 16 refs., 16 tabs
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Development of the osmium-191 → iridium-191m radionuclide generator. Annual report
International Nuclear Information System (INIS)
Treves, S.; Packard, A.B.
1985-01-01
The use of /sup 191m/Ir in radionuclide angiography has been the subject of increasing interest in recent years. The 191 Os-/sup 191m/Ir generator that has been used for these studies suffers, however, from low /sup 191m/Ir yield (10%/ml) and higher than desirable 191 Os breakthrough (5 x 10 -3 %). We have recently developed a /sup 191m/Ir generator that has higher yield (25 to 30%/ml) and lower breakthrough ( -4 %) when eluted with an eluent (0.001 M oxalic acid/0.9% saline) that does not require buffering prior to injection. Studies within the last year have shown the eluate of this generator to be non-toxic at up to 100 times the expected human dose and work is in progress to obtain approval for human use of this system. While a significant improvement over past generator designs, the yield of this generator is still modest and the evaluation of new osmium complexes for use on the generator has continued. Clinical studies involving the use of /sup 191m/Ir for first-pass angiography in adults and children have continued. A comparison of ejection fractions measured in adults with both /sup 99m/Tc and /sup 191m/Ir has confirmed the feasibilty of /sup 191m/Ir for radionuclide angiography in both the left and right ventricles of adults. Studies in collaboration with Baylor Medical College have demonstrated the efficacy of /sup 191m/Ir in combination with the multi-wire gamma camera. 31 refs., 2 figs., 10 tabs
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
2010-07-01
... TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Management and Storage § 191.02 Definitions. Unless... process associated with the management and storage of spent nuclear fuel or radioactive waste is conducted... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 191.02 Section 191.02...
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
International Nuclear Information System (INIS)
Treves, S.; Cheng, C.
1981-01-01
A prototype osmium-191 (T 1/2 = 16 days) → iridium-191m (T 1/2 = 4.9 seconds) generator designed for first pass radionuclide angiography was developed in our laboratory (Os-191 → Ir-191m). Our generator had 14 to 20% Ir-191m yield and a 1 to 3 x 10 -3 % Os-191 breakthrough. Iridium-191m decays with emission of a 65 and a 129 keV photon in 50% and 25% abundance respectively. This radionuclide is advantageous for angiography since it provides higher photon flux and results in much lower radiation dose to the patient than Tc-99m. One objective of this research is to improve the Os-191 → Ir-191m generator for first pass radionuclide angiography at an increase in the Ir-191m yield and a decrease in the Os-191 breakthrough. In addition, we would like to develop an Os-191 → Ir-191m generator for continuous infusion which will be used for ECG gated blood pool ventriculography, venography, and arteriography. Another approach will be to develop a carrier free Os-191 → Ir-191m generator in combination with organic or inorganic exchangers. Iridium-191m from our current generator has been employed successfully in two patient studies for the quantitation left-to-right shunting and the measurement of right and left ventricular ejection fractions. These types of studies will be expanded and further evaluated
34 CFR 75.191 - Consultation costs.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Consultation costs. 75.191 Section 75.191 Education... Development of Curricula Or Instructional Materials § 75.191 Consultation costs. An applicant may budget reasonable consultation fees or planning costs in connection with the development of curricula or...
19 CFR 191.13 - Packaging materials.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Packaging materials. 191.13 Section 191.13 Customs... (CONTINUED) DRAWBACK General Provisions § 191.13 Packaging materials. (a) Imported packaging material... packaging material when used to package or repackage merchandise or articles exported or destroyed pursuant...
22 CFR 191.21 - Applicable benefits.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 191.21 Section 191.21 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF HOSTAGE RELIEF ASSISTANCE Medical Benefits § 191.21 Applicable benefits. A person eligible for benefits under this part shall be eligible for authorized medical...
Chemical and physical parameters affecting the performance of the Os-191/Ir-191m generator
International Nuclear Information System (INIS)
Packard, A.B.; Butler, T.A.; Knapp, F.F.; O'Brien, G.M.; Treves, S.
1984-01-01
The development of an Os-191/Ir-191m generator suitable for radionuclide angiography in humans has elicited much interest. This generator employs ''(OsO 2 Cl 4 ) 2- '' on AG MP-1 anion exchange resin with a Dowex-2 scavenger column and is eluted with normal saline at pH 1. The parent Os species is, however, neither welldefined nor homogeneous leading to less than optimal breakthrough of Os-191 (5 x 10 -3 %) and modest Ir-191m yield (10-15%). The effect of a range of parameters on generator performance has been evaluated as has been the way in which the assembly and loading process affects generator performance. In addition, a number of potential alternative generator systems have been evaluated
22 CFR 191.11 - Applicable benefits.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 191.11 Section 191.11...' and Sailors' Civil Relief Act § 191.11 Applicable benefits. (a) Eligible persons are entitled to the benefits provided by the Soldiers' and Sailors' Civil Relief Act of 1940 (50 U.S.C. App. 501, et seq...
40 CFR 191.11 - Applicability.
2010-07-01
... of spent nuclear fuel or high-level or transuranic radioactive wastes; (2) Radiation doses received... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 191.11 Section 191.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION PROGRAMS...
19 CFR 191.153 - Continuous Customs custody.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Continuous Customs custody. 191.153 Section 191.153 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191.153...
International Nuclear Information System (INIS)
Malmskog, S.G.; Baecklin, A.
1969-03-01
Gamma ray and conversion electron energies and intensities for transitions in 191 Ir have been measured in the decay of 191 Os using a Ge(Li) detector and a double focusing beta spectrometer. The following energies (in keV) and transition multipolarities were found: 41.92 ± 0.02 (E3), 47.05 ± 0.03 (E2), 82.46 ± 0.04 (56% M1 + 44% E2) and 129.52 + 0.02 (88% M1 + 12% E2). From a delayed coincidence measurement the half-life of the 129.52 keV level in 191 Ir was found to be (1.26 ± 0.11) x 10 -10 sec
19 CFR 191.10 - Certificate of delivery.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Certificate of delivery. 191.10 Section 191.10... TREASURY (CONTINUED) DRAWBACK General Provisions § 191.10 Certificate of delivery. (a) Purpose; when... other party a certificate of delivery, certified by the importer or other party through whose possession...
2010-07-01
...) Management and storage of spent nuclear fuel or high-level or transuranic radioactive wastes at all... and storage of spent nuclear fuel or high-level or transuranic radioactive wastes at all facilities... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Standards. 191.03 Section 191.03...
40 CFR 191.01 - Applicability.
2010-07-01
... wastes at any facility regulated by the Nuclear Regulatory Commission or by Agreement States, to the... storage of spent nuclear fuel or high-level or transuranic wastes at any disposal facility that is... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 191.01 Section 191.01...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
40 CFR 191.13 - Containment requirements.
2010-07-01
... requirements. (a) Disposal systems for spent nuclear fuel or high-level or transuranic radioactive wastes shall... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Containment requirements. 191.13 Section 191.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION...
International Nuclear Information System (INIS)
Weininger, J.; Issachar, D.; Lubin, E.; Zabari, M.; Trumper, J.
1990-01-01
The influence of four pH adjustment agents on the biologic behavior of osmium-191 (191Os) impurity in 191Os/191mIr generator eluates was studied. Extended body clearance and biodistribution studies were performed in mice. The solutions to be injected were obtained by eluting generators with a 0.9% NaCl solution at pH 1. The pH of these eluates was adjusted to 5-9 with succinate, phosphate, lysine or NaOH solution. Our results demonstrate that the biologic behavior of these generator eluates is significantly dependent on the agent used for pH adjustment. Buffering with lysine leads to the best results: (a) the mice show no adverse reaction after injection of 150 human doses and the body clearance is very rapid and (b) more than 75% I.D. at 24 hr postinjection. Preliminary calculations based on these results suggest a significant decrease in the estimated patient radiation dose when lysine buffered 191Os/191mIr generator eluates are used for radionuclide angiography
19 CFR 191.76 - Landing certificate.
2010-04-01
... landing certificate shall be waived by the requiring Customs authority if the claimant demonstrates... 19 Customs Duties 2 2010-04-01 2010-04-01 false Landing certificate. 191.76 Section 191.76 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY...
19 CFR 19.1 - Classes of customs warehouses.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Classes of customs warehouses. 19.1 Section 19.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN § 19.1 Classes of...
Energy Technology Data Exchange (ETDEWEB)
Malmskog, S G; Baecklin, A
1969-03-15
Gamma ray and conversion electron energies and intensities for transitions in {sup 191}Ir have been measured in the decay of {sup 191}Os using a Ge(Li) detector and a double focusing beta spectrometer. The following energies (in keV) and transition multipolarities were found: 41.92 {+-} 0.02 (E3), 47.05 {+-} 0.03 (E2), 82.46 {+-} 0.04 (56% M1 + 44% E2) and 129.52 + 0.02 (88% M1 + 12% E2). From a delayed coincidence measurement the half-life of the 129.52 keV level in {sup 191}Ir was found to be (1.26 {+-} 0.11) x 10{sup -10} sec.
32 CFR 191.7 - Civilian EEO program staff.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Civilian EEO program staff. 191.7 Section 191.7...) MISCELLANEOUS THE DOD CIVILIAN EQUAL EMPLOYMENT OPPORTUNITY (EEO) PROGRAM § 191.7 Civilian EEO program staff. (a) EEO Managers, including SEP Managers and other staff who are responsible for EEO and affirmative...
19 CFR 191.44 - Destruction under Customs supervision.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.44 Section 191.44 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Rejected Merchandise § 191.44 Destruction under Customs supervision. A claimant may destroy merchandise an...
19 CFR 191.37 - Destruction under Customs supervision.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.37 Section 191.37 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Unused Merchandise Drawback § 191.37 Destruction under Customs supervision. A claimant may destroy...
19 CFR 191.25 - Destruction under Customs supervision.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Destruction under Customs supervision. 191.25 Section 191.25 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Manufacturing Drawback § 191.25 Destruction under Customs supervision. A claimant may destroy merchandise...
19 CFR 191.103 - Additional requirements.
2010-04-01
... which the alcohol was withdrawn; (iv) Date of withdrawal; (v) Serial number of the tax-paid stamp or... 19 Customs Duties 2 2010-04-01 2010-04-01 false Additional requirements. 191.103 Section 191.103 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...
27 CFR 20.191 - Bulk articles.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bulk articles. 20.191... Users of Specially Denatured Spirits Operations by Users § 20.191 Bulk articles. Users who convey articles in containers exceeding one gallon may provide the recipient with a photocopy of subpart G of this...
2010-10-01
... forms. Copies of the prescribed report forms are available without charge upon request from the address... 49 Transportation 3 2010-10-01 2010-10-01 false Report forms. 191.19 Section 191.19 Transportation... size and kind of paper. In addition, the information required by these forms may be submitted by any...
International Nuclear Information System (INIS)
Fotiades, N.; Andreyev, A.
1997-01-01
Prompt, in-beam γ rays in coincidence with evaporation residues were measured in the 164,166 Er + 164 MeV 32 S reactions. A level scheme built on the 13/2 + isomer has been deduced from four transitions assigned to 191 Pb. The states in 191 Pb are interpreted in terms of a weak coupling of the odd i 13/2 neutron-hole to the spherical states in the even-mass 192 Pb core. (orig.). With 4 figs
40 CFR 191.15 - Individual protection requirements.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Individual protection requirements. 191.15 Section 191.15 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION... Individual protection requirements. (a) Disposal systems for waste and any associated radioactive material...
19 CFR 191.152 - Merchandise released from Customs custody.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise released from Customs custody. 191.152 Section 191.152 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191...
22 CFR 191.5 - Relationships among agencies.
2010-04-01
... Family Member of such employee, is determined to be eligible for benefits under this subchapter. (b) In... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Relationships among agencies. 191.5 Section 191... Relationships among agencies. (a) The Assistant Secretary of State for Administration shall promptly inform the...
19 CFR 191.184 - Merchandise transferred from continuous Customs custody.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise transferred from continuous Customs custody. 191.184 Section 191.184 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... From Customs Territory § 191.184 Merchandise transferred from continuous Customs custody. (a) Procedure...
37 CFR 2.191 - Business to be transacted in writing.
2010-07-01
... Trademark Cases § 2.191 Business to be transacted in writing. All business with the Office should be... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Business to be transacted in writing. 2.191 Section 2.191 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE...
19 CFR 191.173 - Imported duty-paid derivatives (no manufacture).
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Imported duty-paid derivatives (no manufacture). 191.173 Section 191.173 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... § 191.173 Imported duty-paid derivatives (no manufacture). When the basis for drawback under 19 U.S.C...
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
19 CFR 191.7 - General manufacturing drawback ruling.
2010-04-01
... Section 191.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... production under § 191.2(q) of this subpart. (2) Computer-generated number. With the letter of acknowledgment the drawback office shall include the unique computer-generated number assigned to the acknowledgment...
International Nuclear Information System (INIS)
Li Jianzhong; Chen Xia; Yang Hua; Wang Shuiliang; Guo Baoyu; Yu Long; Wang Zhugang; Fu Jiliang
2006-01-01
Human zinc finger protein 191 (ZNF191/ZNF24) was cloned and characterized as a SCAN family member, which shows 94% identity to its mouse homologue zinc finger protein 191 (Zfp191). ZNF191 can specifically interact with an intronic polymorphic TCAT repeat (HUMTH01) in the tyrosine hydroxylase (TH) gene. Allelic variations of HUMTH01 have been stated to have a quantitative silencing effect on TH gene expression and to correlate with quantitative and qualitative changes in the binding by ZNF191. Zfp191 is widely expressed during embryonic development and in multiple tissues and organs in adult. To investigate the functions of Zfp191 in vivo, we have used homologous recombination to generate mice that are deficient in Zfp191. Heterozygous Zfp191 +/- mice are normal and fertile. Homozygous Zfp191 -/- embryos are severely retarded in development and die at approximately 7.5 days post-fertilization. Unexpectedly, in Zfp191 -/- and Zfp191 +/- embryos, TH gene expression is not affected. Blastocyst outgrowth experiments and the RNA interference-mediated knockdown of ZNF191 in cultured cells revealed an essential role for Zfp191 in cell proliferation. In further agreement with this function, no viable Zfp191 -/- cell lines were obtained by derivation of embryonic stem (ES) cells from blastocysts of Zfp191 +/- intercrosses or by forced homogenotization of heterozygous ES cells at high concentrations of G418. These data show that Zfp191 is indispensable for early embryonic development and cell proliferation
40 CFR 191.25 - Compliance with other Federal regulations.
2010-07-01
... SPENT NUCLEAR FUEL, HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Ground... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance with other Federal regulations. 191.25 Section 191.25 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
19 CFR 191.71 - Drawback on articles destroyed under Customs supervision.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback on articles destroyed under Customs supervision. 191.71 Section 191.71 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Exportation and Destruction § 191.71 Drawback on articles destroyed under Customs...
Studies of radioactive cisplatin (191Pt) for tumour imaging and therapy
International Nuclear Information System (INIS)
Areberg, J.
2000-01-01
A radioactive variant of the cytostatic agent cis-dichlorodiammineplatinum(II), cisplatin, was synthesised from 191 PtCl 4 . The 191 Pt-cisplatin was found to be a sterile product of high radionuclide, radiochemical and chemical purity. The pharmacokinetics of platinum in tumour tissue and organs at risk of fourteen patients undergoing treatment with cisplatin were studied by exchanging a small fraction of the prescribed amount of cisplatin with 191 Pt-cisplatin. The uptake and retention of platinum were investigated by gamma camera measurements up to ten days after infusion of 191 Pt-cisplatin. Highest concentration of platinum was found in the liver, on average 5.7 ± 0.5 μg/g normalised to a given amount of 180 mg cisplatin. Corresponding value for the kidneys was 1.9 ± 0.3 μg/g. Uptake of platinum in tumours was visualised in five patients with an average maximum concentration of 4.9 ± 1.0 μg/g normalised to a given amount of 180 mg cisplatin. The data from the pharmacokinetic study was used together with data from the literature to estimate the absorbed dose and effective dose to patients receiving radioactive cisplatin. The effective doses were calculated to be 0.10 ± 0.02 mSv/MBq, 0.17 ± 0.04 mSv/MBq and 0.23 ± 0.05 mSv/MBq for 191 Pt-, 193m Pt-, and 195m Pt-cisplatin respectively. The combined effect of the radio- and chemotoxicity from 191 Pt-cisplatin was investigated both in vitro and in vivo. A cervical cancer cell line was incubated with cisplatin or 191 Pt-cisplatin with various concentrations and specific activities. It was shown that the surviving fraction was smaller for cells treated with 191 Pt-cisplatin than for cells treated with the same concentration of non-radioactive cisplatin. The surviving fraction decreased with increasing specific activity. Isobologram technique showed that the radio- and chemotoxicity interacted in a supra-additive (synergistic) manner. In an in vivo model, nude mice with xenografted tumours were given
49 CFR 192.191 - Design pressure of plastic fittings.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Design pressure of plastic fittings. 192.191... Components § 192.191 Design pressure of plastic fittings. (a) Thermosetting fittings for plastic pipe must conform to ASTM D 2517, (incorporated by reference, see § 192.7). (b) Thermoplastic fittings for plastic...
27 CFR 479.191 - Applicability of other provisions of internal revenue laws.
2010-04-01
... GUNS, DESTRUCTIVE DEVICES, AND CERTAIN OTHER FIREARMS Other Laws Applicable § 479.191 Applicability of other provisions of internal revenue laws. All of the provisions of the internal revenue laws not... provisions of internal revenue laws. 479.191 Section 479.191 Alcohol, Tobacco Products, and Firearms BUREAU...
9 CFR 381.191 - Distribution of inspected products to small lot buyers.
2010-01-01
... small lot buyers. 381.191 Section 381.191 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE...; Exportation; or Sale of Poultry or Poultry Products § 381.191 Distribution of inspected products to small lot... small lot buyers (such as small restaurants), distributors or jobbers may remove inspected and passed...
2010-04-01
... (CONTINUED) DRAWBACK Internal Revenue Tax on Flavoring Extracts and Medicinal or Toilet Preparations (Including Perfumery) Manufactured From Domestic Tax-Paid Alcohol § 191.102 Procedure. (a) General. Other provisions of this part relating to direct identification drawback (see subpart B of this part) shall apply...
International Nuclear Information System (INIS)
Buettgenbach, S.; Dicke, R.; Gebauer, H.; Kuhnen, R.; Traeber, F.
1978-01-01
The hyperfine interaction constants A and B of six low-lying metastable fine structure states of the two iridium isotopes 191 Ir and 193 Ir and the electronic g-factors of these levels have been measured using the atomic-beam magnetic-resonance method. From the values of the magnetic-dipole interaction constants A, corrected for off-diagonal perturbations, we extracted the hyperfine anomaly of a pure 6s-electron state: 191 Δs 193 = 0.64(7)%. Using nonrelativistic approximations for the effective radial parameters the nuclear electric-quadrupole moments were obtained: Q( 191 Ir) = 0.81(21)b, Q( 193 Ir) = 0.73(19)b (corrected for Sternheimer shielding effects). (orig.) [de
Studies of radioactive cisplatin ({sup 191}Pt) for tumour imaging and therapy
Energy Technology Data Exchange (ETDEWEB)
Areberg, J
2000-01-01
A radioactive variant of the cytostatic agent cis-dichlorodiammineplatinum(II), cisplatin, was synthesised from {sup 191}PtCl{sub 4}. The {sup 191}Pt-cisplatin was found to be a sterile product of high radionuclide, radiochemical and chemical purity. The pharmacokinetics of platinum in tumour tissue and organs at risk of fourteen patients undergoing treatment with cisplatin were studied by exchanging a small fraction of the prescribed amount of cisplatin with {sup 191}Pt-cisplatin. The uptake and retention of platinum were investigated by gamma camera measurements up to ten days after infusion of {sup 191}Pt-cisplatin. Highest concentration of platinum was found in the liver, on average 5.7 {+-} 0.5 {mu}g/g normalised to a given amount of 180 mg cisplatin. Corresponding value for the kidneys was 1.9 {+-} 0.3 {mu}g/g. Uptake of platinum in tumours was visualised in five patients with an average maximum concentration of 4.9 {+-} 1.0 {mu}g/g normalised to a given amount of 180 mg cisplatin. The data from the pharmacokinetic study was used together with data from the literature to estimate the absorbed dose and effective dose to patients receiving radioactive cisplatin. The effective doses were calculated to be 0.10 {+-} 0.02 mSv/MBq, 0.17 {+-} 0.04 mSv/MBq and 0.23 {+-} 0.05 mSv/MBq for {sup 191}Pt-, {sup 193m}Pt-, and {sup 195m}Pt-cisplatin respectively. The combined effect of the radio- and chemotoxicity from {sup 191}Pt-cisplatin was investigated both in vitro and in vivo. A cervical cancer cell line was incubated with cisplatin or {sup 191}Pt-cisplatin with various concentrations and specific activities. It was shown that the surviving fraction was smaller for cells treated with {sup 191}Pt-cisplatin than for cells treated with the same concentration of non-radioactive cisplatin. The surviving fraction decreased with increasing specific activity. Isobologram technique showed that the radio- and chemotoxicity interacted in a supra-additive (synergistic) manner. In
2010-04-01
... under the provision for the substitution of finished petroleum derivatives, § 313(p), as amended (19 U.S... identified for purposes of direct identification drawback by use of the accounting methods provided for in... (CONTINUED) DRAWBACK General Provisions § 191.2 Definitions. For the purposes of this part: (a) Abstract...
28 CFR 0.191 - Changes which affect the overall structure of the Department.
2010-07-01
... structure of the Department. 0.191 Section 0.191 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Sections and Subunits § 0.191 Changes which affect the overall structure of the Department. Changes to the overall structure of the Department include: The establishment...
Structure of $^{191}$Pb from $\\alpha$- and $\\beta$-decay spectroscopy
Cocolios, T E; Van de Walle, J; Franchoo, S; Marsh, B A; Sjoedin, A M; Huyse, M; Zemlyanoy, S; Cocolios, T E; Bastin, B; Barzakh, A; Page, R D; Mane, E; Van Duppen, P; Darby, I G; Venhart, M; Kudryavtsev, Yu; Huber, G; Fedosseev, V N; Andreyev, A N; Keupers, M; Flanagan, K T; Stefan, I; Dexters, W; Koester, U; Antalic, S; Buscher, J; Molkanov, P; Fedorov, D V
2010-01-01
Complementary studies of $^{191}$Pb have been made in the $\\beta$- decay of $^{191}$Bi at LISOL (CRC) and in the $\\alpha$- decay of $^{195}$Po at ISOLDE (CERN). Fine structures in the $\\alpha$- decay of the low-spin and high-spin isomers of $^{195}$Po have been fully resolved. Identification of the parent state is made possible via isomer selection based on narrow-band laser frequency scanning. The $\\alpha$-particle and $\\gamma$-ray energies have been determined with greater precision. New $\\alpha$-particle and $\\gamma$-ray energies are identified. Branching ratios in the decay of $^{195}$Po and $^{191}$Pb have been examined.
Performance of different metrics proposed to CIE TC 1-91
Bhusal, P.; Dangol, R.
2017-01-01
The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS), Feeling of Contrast Index (FCI), Memory colour rendering index (MCRI), Preference of skin (PS),
2010-04-01
... TREASURY LIQUORS BEER Removals Without Payment of Tax Removal of Beer Unfit for Beverage Use § 25.191 General. A brewer may remove sour or damaged beer, or beer which the brewer has deliberately rendered unfit for beverage use, from the brewery without payment of tax for use in manufacturing. Unfit beer may...
40 CFR Appendix B to Part 191 - Calculation of Annual Committed Effective Dose
2010-07-01
... SPENT NUCLEAR FUEL, HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Pt. 191, App. B Appendix B to Part 191... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Calculation of Annual Committed Effective Dose B Appendix B to Part 191 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
19 CFR 191.1 - Authority of the Commissioner of Customs.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority of the Commissioner of Customs. 191.1 Section 191.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Customs. Pursuant to Treasury Department Order No. 165, Revised (T.D. 53654, 19 FR 7241), as amended, the...
Decay out of the yrast superdeformed band in 191Hg
International Nuclear Information System (INIS)
Sien, S.; Reiter, P.; Khoo, T.; Lauritsen, T.; Carpenter, M. P.; Ahmad, I.; Amro, H.; Calderin, I.; Dossing, T.; Fischer, S. M.; Garg, U.; Gassmann, D.; Hackman, G.; Hannachi, F.; Janssens, R. V. F.; Kharraja, B.; Korichi, A.; Lopez-Martens, A.; Moore, E. F.; Nisius, D.; Schuck, C.
1999-01-01
The excitation energies and spins of the yrast superdeformed band in 191 Hg have been determined by analyzing the quasicontinuum spectrum connecting the superdeformed and normal-deformed states. The results from this analysis, combined with that given by one-step decay lines, give confident assignments of the spins and energies of the yrast superdeformed band in 191 Hg
Superdeformation in {sup 191}Tl
Energy Technology Data Exchange (ETDEWEB)
Pilotte, S; Lewis, J M; Riedinger, L L; Yu, C H [Tennessee Univ., Knoxville, TN (United States). Dept. of Physics; Capenter, M P; Janssens, R V.F.; Khoo, T L; Lauritsen, T; Liang, Y; Soramel, F [Argonne National Lab., IL (United States). Physics Div.; Bearden, I G [Purdue Univ., Lafayette, IN (United States)
1992-08-01
High spin states in {sup 191}T1 have been populated via the {sup 159}Tb({sup 36}S,4n) reaction at 165 MeV. Two weak sequences of regularly spaced transitions have been identified. These bands exhibit many of the properties observed in many other superdeformed nuclei in the Hg region. (author). 23 refs., 5 figs.
13 CFR 120.191 - The contents of a business loan application.
2010-01-01
..., among other things, a description of the history and nature of the business, the amount and purpose of... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The contents of a business loan application. 120.191 Section 120.191 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS...
P53-miR-191-SOX4 regulatory loop affects apoptosis in breast cancer.
Sharma, Shivani; Nagpal, Neha; Ghosh, Prahlad C; Kulshreshtha, Ritu
2017-08-01
miRNAs have emerged as key participants of p53 signaling pathways because they regulate or are regulated by p53. Here, we provide the first study demonstrating direct regulation of an oncogenic miRNA, miR-191-5p, by p53 and existence of a regulatory feedback loop. Using a combination of qRT-PCR, promoter-luciferase, and chromatin-immunoprecipitation assays, we show that p53 brings about down-regulation of miR-191-5p in breast cancer. miR-191-5p overexpression brought about inhibition of apoptosis in breast cancer cell lines (MCF7 and ZR-75) as demonstrated by reduction in annexin-V stained cells and caspase 3/7 activity, whereas miR-191-5p down-regulation showed the opposite. We further unveiled that SOX4 was a direct target of miR-191-5p. SOX4 overexpression was shown to increase p53 protein levels in MCF7 cells. miR-191-5p overexpression brought about down-regulation of SOX4 and thus p53 levels, suggesting the existence of a regulatory feedback loop. Breast cancer treatment by doxorubicin, an anti-cancer drug, involves induction of apoptosis by p53; we thus wanted to check whether miR-191-5p affects doxorubicin sensitivity. Interestingly, Anti-miR-191 treatment significantly decreased the IC50 of the doxorubicin drug and thus sensitized breast cancer cells to doxorubicin treatment by promoting apoptosis. Overall, this work highlights the importance of the p53-miR-191- SOX4 axis in the regulation of apoptosis and drug resistance in breast cancer and offers a preclinical proof-of-concept for use of an Anti-miR-191 and doxorubicin combination as a rational approach to pursue for better breast cancer treatment. © 2017 Sharma et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.
Iridium-191m radionuclide angiocardiography detection and quantitation of left-to-rigth shunts
International Nuclear Information System (INIS)
Treves, S.; Fujii, A.; Cheng, C.; Kuruc, A.
1983-01-01
The purpose of this study was to determine whether Iridium-191m (Ir-191m) could replace Technetium-99m (Tc-99m) in the detection and quantitation of left-to-right shunts. It was demonstrated that Ir-191m radionuclide angiography is a safe, rapid, and accurate method for the detection and quantitation of left-to-right shunts with very low radiation dose to the patient. It is also possible with this radiotracer to evaluate other aspects of the anatomy and physiology of the circulation such as ventricular function, patency of major vessels, renal and cerebral perfusion. Further improvements on 0s-191 production, generator design and gamma cameras would expand the use of this ultrashort-lived radionuclide
50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.
2010-10-01
...) Detailed information on the biology of marine mammals within the area, including estimated population size... Important Marine Mammal Areas. 216.191 Section 216.191 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS...
The Low Energy Level Structure of {sup 191}lr
Energy Technology Data Exchange (ETDEWEB)
Malmskog, S G; Berg, V [AB Atomenergi, Nykoeping (Sweden); [Inst. of Physics, U niv. of Stockholm (Sweden); Baecklin, A; Hedin, G [Inst. of Physics, Univ. of Upp sala (Sweden)
1970-02-15
The decay of {sup 191}Pt to {sup 191}Ir has been investigated using Ge(Li)-detectors and a double focusing beta spectrometer. 35 transitions were observed and most of them were placed in a level scheme. Special attention was given to the low energy level band structure. Several multipolarity mixing ratios were determined from L-subshell ratio measurements. Using the delayed coincidence technique the half-life of the 179.05 keV level was measured to 40 {+-} 12 psec. The low level decay properties are discussed in terms of the Nilsson model with the inclusion of Coriolis coupling.
40 CFR Appendix C to Part 191 - Guidance for Implementation of Subpart B
2010-07-01
... to make use of rather complex computational models, analytical theories, and prevalent expert... established in §§ 191.15 and 191.16, respectively. The Agency assumes that compliance can be determined based... exploratory drilling for resources (other than any provided by the disposal system itself) can be the most...
Biological fate of a single administration of 191Pt in rats following different routes of exposure
International Nuclear Information System (INIS)
Moore, W. Jr.; Hysell, D.; Crocker, W.; Stara, J.
1975-01-01
The retention, tissue distribution, and excretion of 191 Pt in adult rats was determined following oral, intravenous (IV), and intratracheal administration. The highest retention was obtained following IV dosing, and lowest retention (less than 0.5 percent) occurred after oral dosing. Tissues containing the highest concentrations of 191 Pt following IV administration were the kidney, adrenal, spleen, and liver. Following a single oral dose, almost all of the 191 Pt was excreted in the feces due to nonabsorption, whereas after IV dosing, similar quantities were excreted in both the urine and feces. Following IV dosing of pregnant rats, 191 Pt was found in all the fetuses; however, the amount was small
Measurement of the ground state spectroscopic quadrupole moments of 191Os and 193Os
International Nuclear Information System (INIS)
Ernst, H.; Hagn, E.; Zech, E.
1979-01-01
Radioactive 191 Os and 193 Os nuclei have been aligned in an Os single crystal at temperatures down to 4 mK. From the temperature dependence of the γ-anisotropy the quadrupole frequencies vsub(Q) = e 2 qQ/h have been determined as vsub(Q)( 191 OsOs) = -278+-9 MHz and vsub(Q)( 193 OsOs) = -96+-15 MHz. With the known electric field gradient for OsOs of eq = (-4.54+-0.24) x 10 17 V/cm 2 the ground state spectroscopic quadrupole moments are deduced to be Q( 191 Os) = +2.53+-0.16 b and Q( 193 Os) = +0.87+-0.15 b. (orig.)
Performance of different colour quality metrics proposed to CIE TC 1-91
Bhusal, Pramod; Dangol, Rajendra
2017-01-01
The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS), Feeling of Contrast Index (FCI), Memory colour rendering index (MCRI), Preference of skin (PS), Relative gamut area index (RGAI) and Illuminating Engineering society Method for evaluating light source colour rendition (IES TM-30). The evaluation and analysis are based on previously conducted exp...
Search for entrance-channel dependence in the population of superdeformed bands in {sup 191}Hg
Energy Technology Data Exchange (ETDEWEB)
Soramel, F.; Khoo, T.L.; Janssens, R.V.F. [and others
1995-08-01
The population intensity of some SD bands in the mass 150 region were observed to depend on the mass symmetry of the entrance channel in the fusion reaction. The authors raised the possibility that the population of SD bands had a memory of the entrance channel. To check this interesting possibility, we made measurements of the population intensities of superdeformed (SD) bands in the {sup 160}Gd({sup 36}S,5n){sup 191}Hg and {sup 130}Te({sup 64}Ni,3n){sup 191}Hg reactions. To ensure that any observed effect was not due to a simple angular momentum difference in the entrance channels, we also measured the average entry points and spin distributions of normal and SD states in {sup 191}Hg in the two reactions. The entry points and spin distributions for {sup 191}Hg are the same and, indeed, so are the SD intensities in the two reactions. Hence, no entrance-channel effect is observed in the population of the SD band in {sup 191}Hg, in contrast with data for SD bands in the mass 150 regions. We suggest that the effect observed previously in the mass 150 region is due to an angular momentum effect. A letter reporting our results was submitted for publication.
Mutation induction in Haemophilus influenzae by ICR-191. Pt. 1
International Nuclear Information System (INIS)
Perdue, S.W.; Kimball, R.F.; McGray, P.C.; Tennessee Univ., Oak Ridge
1981-01-01
The investigation of mutagenic mechanisms in Haemophilus influenzae has been confined until now to mutagens that normally produce mainly base pair substitutions. This paper describes the development of a system suitable for detecting frameshift mutations induced by ICR-191. The system involves reversions from thymidine dependence to thymidine independence. Evidence is presented from a comparison of the responses to ICR-191 and to N-methyl-N'-nitro-N-nitrosoguanidine that the system is specific for frameshift mutations. The genetic recombination involved in transformation leads to a marked increase in spontaneous reversion of the frameshift mutations but not of the base substitution mutations. Presumably, this is a consequence of mispairing, with consequent change in the number of bases, during the recombination. (orig.)
Performance of different metrics proposed to CIE TC 1-91
Directory of Open Access Journals (Sweden)
Pramod Bhusal
2017-12-01
Full Text Available The main aim of the article is to find out the performance of different metrics proposed to CIE TC 1-91. Currently, six different indexes have been proposed to CIE TC 1-91: Colour Quality Scale (CQS, Feeling of Contrast Index (FCI, Memory colour rendering index (MCRI, Preference of skin (PS, Relative gamut area index (RGAI and Illuminating Engineering society Method for evaluating light source colour rendition (IES TM-30. The evaluation and analysis are based on previously conducted experiment in lighting booth. The analysis showed the area based metric FCI was good subjective preference indicator. The subjective preference was measured in terms of naturalness of objects, colourfulness of colour checker chart, and the visual appearance of the lit scene in the booth.
19 CFR 191.24 - Certificate of manufacture and delivery.
2010-04-01
... Section 191.24 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... manufactured or produced under a general manufacturing drawback ruling, the unique computer-generated number... manufactured or produced under a specific manufacturing drawback ruling, either the unique computer number or...
DEFF Research Database (Denmark)
Ollinger, Rupert; Childs, Andrew J; Burgess, Hannah M
2008-01-01
. During male spermatogenesis, Tex19.1 expression is highest in mitotic spermatogonia and diminishes as these cells differentiate and progress through meiosis. In pluripotent stem cells, Tex19.1 expression is also downregulated upon differentiation. However, it is not clear whether Tex19.1 has an essential...... spermatogenesis. Immunostaining and histological analysis revealed defects in meiotic chromosome synapsis, the persistence of DNA double-strand breaks during meiosis, and a loss of post-meiotic germ cells in the testis. Furthermore, expression of a class of endogenous retroviruses is upregulated during meiosis...... in the Tex19.1(-/-) testes. Increased transposition of endogenous retroviruses in the germline of Tex19.1(-/-) mutant mice, and the concomitant increase in DNA damage, may be sufficient to disrupt the normal processes of recombination and chromosome synapsis during meiosis and cause defects...
Nagpal, Neha; Ahmad, Hafiz M.; Chameettachal, Shibu; Sundar, Durai; Ghosh, Sourabh; Kulshreshtha, Ritu
2015-01-01
The molecular mechanisms of hypoxia induced breast cell migration remain incompletely understood. Our results show that hypoxia through hypoxia-inducible factor (HIF) brings about a time-dependent increase in the level of an oncogenic microRNA, miR-191 in various breast cancer cell lines. miR-191 enhances breast cancer aggressiveness by promoting cell proliferation, migration and survival under hypoxia. We further established that miR-191 is a critical regulator of transforming growth factor beta (TGFβ)-signaling and promotes cell migration by inducing TGFβ2 expression under hypoxia through direct binding and indirectly by regulating levels of a RNA binding protein, human antigen R (HuR). The levels of several TGFβ pathway genes (like VEGFA, SMAD3, CTGF and BMP4) were found to be higher in miR-191 overexpressing cells. Lastly, anti-miR-191 treatment given to breast tumor spheroids led to drastic reduction in spheroid tumor volume. This stands as a first report of identification of a microRNA mediator that links hypoxia and the TGFβ signaling pathways, both of which are involved in regulation of breast cancer metastasis. Together, our results show a critical role of miR-191 in hypoxia-induced cancer progression and suggest that miR-191 inhibition may offer a novel therapy for hypoxic breast tumors. PMID:25867965
Observation of superdeformation in 191Hg
International Nuclear Information System (INIS)
Moore, E.F.; Janssens, R.V.F.; Chasman, R.R.
1989-01-01
The first observation of superdeformation in the A ≅ 190 mass region is reported. A rotational band of 12 transitions with an average energy spacing of 37 keV, an average moment of inertia of 110 ℎ 2 MeV -1 , and an average quadrupole moment of 18 ± 3 eb has been observed in 191 Hg. These results are in excellent agreement with a calculation that predicts an ellipsoidal axis ratio of 1.65:1 for the superdeformed shape in this nucleus. Evidence for another discrete superdeformed band and superdeformed structures in the quasi-continuum was also found in the data. 19 refs., 6 figs
30 CFR 250.191 - How does MMS conduct incident investigations?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How does MMS conduct incident investigations... Reporting Requirements § 250.191 How does MMS conduct incident investigations? Any investigation that MMS... meetings conducted by a chairperson appointed by MMS. The following requirements apply to any panel...
Possible detection of an emission feature near 584 A in the direction of G191-B2B
Green, James; Bowyer, Stuart; Jelinsky, Patrick
1990-01-01
A possible spectral emission feature is reported in the direction of the nearby hot white dwarf G191-B2B at 581.5 + or - 6 A with a significance of 3.8 sigma. This emission has been identified as He I 584.3 A. The emission cannot be due to local geocoronal emission or interplanetary backscatter of solar He I 584 A emission because the feature is not detected in a nearby sky exposure. Possible sources for this emission are examined, including the photosphere of G191-B2B, the comparison star G191-B2A, and a possible nebulosity near or around G191-B2B. The parameters required to explain the emission are derived for each case. All of these explanations require unexpected physical conditions; hence we believe this result must receive confirming verification despite the statistical likelihood of the detection.
Possible detection of an emission feature near 584 A in the direction of G191-B2B
International Nuclear Information System (INIS)
Green, J.; Bowyer, S.; Jelinsky, P.
1990-01-01
A possible spectral emission feature is reported in the direction of the nearby hot white dwarf G191-B2B at 581.5 + or - 6 A with a significance of 3.8 sigma. This emission has been identified as He I 584.3 A. The emission cannot be due to local geocoronal emission or interplanetary backscatter of solar He I 584 A emission because the feature is not detected in a nearby sky exposure. Possible sources for this emission are examined, including the photosphere of G191-B2B, the comparison star G191-B2A, and a possible nebulosity near or around G191-B2B. The parameters required to explain the emission are derived for each case. All of these explanations require unexpected physical conditions; hence we believe this result must receive confirming verification despite the statistical likelihood of the detection. 15 refs
Critical comments on the US Environmental Protection Agency Standards 40 CFR 191
International Nuclear Information System (INIS)
Pflum, C.G.; Van Konynenburg, R.A.; Krishna, P.
1993-01-01
This paper is about the US Environmental Protection Agency (EPA) ''Environmental Standards for the Disposal of Spent Nuclear Fuel, High-Level and Transuranic Wastes,'' 40 CFR 191. These standards regulate the disposal of radioactive wastes in geologic repositories. Currently, two repository sites are under investigation: The Waste Isolation Pilot Plant (WIPP) site, located near Carlsbad, New Mexico, may become the repository for defense-generated transuranic waste (TRU); and the Yucca Mountain site, located near Las Vegas, Nevada, may become the repository for spent reactor fuel and a small amount of reprocessing waste (hereinafter called high-level radioactive waste or HLW). The paper was written for readers who have an interest in 40 CFR 191 but do not have the time or inclination to ponder the technical details
26 CFR 1.501(c)(19)-1 - War veterans organizations.
2010-04-01
...) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Exempt Organizations § 1.501(c)(19)-1 War veterans... members of the United States Armed Forces, (iii) Cadets (including only students in college or university... provision described in § 1.501(c)(3)-1(b)(4). (2) The corpus or income cannot be diverted or used other than...
Extreme ultraviolet spectroscopy of G191-B2B - Direct observation of ionization edges
Wilkinson, Erik; Green, James C.; Cash, Webster
1992-01-01
We present the first spectrum of the hot, DA white dwarf G191-B2B (wd 0501 + 527) between 200 and 330 A. The spectrum, which has about 2 A resolution, was obtained with a sounding rocket-borne, grazing incidence spectrograph. The spectrum shows no evidence of He II, the expected primary opacity source in this wavelength region. Three ionization edges and one absorption feature were observed and are suggestive of O III existing in the photosphere of G191-B2B. Also noted is a broad spectral depression that may result from Fe VI in the photosphere.
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
Apiano de Alejandría, traductor (BC IV 45 y V 191
Directory of Open Access Journals (Sweden)
José B. Torres
2006-06-01
Full Text Available This paper defends that Appian regards as translations two passages in his work (cfr. BC IV 45 and V 191. Both translations show different features which may be explained from the point of view of ancient theories concerning translation.
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
Proto-planetary nebulae. I. The extreme bipolar nebulae M2-9 and M1-91
International Nuclear Information System (INIS)
Goodrich, R.W.
1991-01-01
Results are presented on a long-slit optical spectroscopy measurements of the prototype bipolar planetary nebula M2-9 and the M1-91 bipolar nebula, performed in order to determine the nature of the morphology of the wings of these two nebulae. It is concluded that the overall bipolar morphologies of these nebulae might be due to the orbital motions of binaries, with the orbital angular momentum vector defining the axis of the nebula. Secondary symmetries in the nebulae, such as the point-symmetric knots in M1-91, could be due to other symmetries, such as the rotation axis of one of the individual stars or the polar axis of the accretion disk. 39 refs
26 CFR 31.3121(b)(19)-1 - Services of certain nonresident aliens.
2010-04-01
... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services of certain nonresident aliens. 31.3121... 1954) General Provisions § 31.3121(b)(19)-1 Services of certain nonresident aliens. (a) (1) Services performed after 1961 by a nonresident alien individual who is temporarily present in the United States as a...
Superdeformation studies in {sup 191}Hg
Energy Technology Data Exchange (ETDEWEB)
Carpenter, M.P.; Janssens, R.V.F.; Crowell, B. [and others
1995-08-01
Superdeformation in the A {approximately} 190 region was first observed in {sup 191}Hg from an experiment performed at ATLAS using the Argonne Notre Dame {gamma}-ray facility. We recently revisited the study of superdeformation in this nucleus using Gammasphere and the {sup 160}Gd({sup 36}S,5n) and {sup 174}Yb({sup 22}Ne,5n) reactions at 172 and 120 MeV in order to populate and measure states in the second well. The goal of the experiment was to identify new bands in the data, and thus allow us to gain understanding on the relative placement of single particle orbitals near the N = 112 SD shell gap. From an analysis of the data, the three previously identified SD bands were extended, and their feeding into the yrast states delineated. Two new SD bands were observed and preliminary evidence for a third new band was obtained as well.
Novel genetic variants in miR-191 gene and familial ovarian cancer
International Nuclear Information System (INIS)
Shen, Jie; DiCioccio, Richard; Odunsi, Kunle; Lele, Shashikant B; Zhao, Hua
2010-01-01
Half of the familial aggregation of ovarian cancer can't be explained by any known risk genes, suggesting the existence of other genetic risk factors. Some of these unknown factors may not be traditional protein encoding genes. MicroRNA (miRNA) plays a critical role in tumorigenesis, but it is still unknown if variants in miRNA genes lead to predisposition to cancer. Considering the fact that miRNA regulates a number of tumor suppressor genes (TSGs) and oncogenes, genetic variations in miRNA genes could affect the levels of expression of TSGs or oncogenes and, thereby, cancer risk. To test this hypothesis in familial ovarian cancer, we screened for genetic variants in thirty selected miRNA genes, which are predicted to regulate key ovarian cancer genes and are reported to be misexpressed in ovarian tumor tissues, in eighty-three patients with familial ovarian cancer. All of the patients are non-carriers of any known BRCA1/2 or mismatch repair (MMR) gene mutations. Seven novel genetic variants were observed in four primary or precursor miRNA genes. Among them, three rare variants were found in the precursor or primary precursor of the miR-191 gene. In functional assays, the one variant located in the precursor of miR-191 resulted in conformational changes in the predicted secondary structures, and consequently altered the expression of mature miR-191. In further analysis, we found that this particular variant exists in five family members who had ovarian cancer. Our findings suggest that there are novel genetic variants in miRNA genes, and those certain genetic variants in miRNA genes can affect the expression of mature miRNAs and, consequently, might alter the regulation of TSGs or oncogenes. Additionally, the variant might be potentially associated with the development of familial ovarian cancer
Clinical analysis and follow-up of 191 cases of lacrimal gland occupying lesions
Directory of Open Access Journals (Sweden)
Peng-Peng Wu
2017-02-01
Full Text Available AIM: To investigate the clinical characteristics and follow-up of 191 patients with lacrimal glandoccupying lesions. METHODS: We selected 191 patients(221 eyeswith lacrimal gland occupancy from January 2011 to August 2015. All patients underwent lacrimal gland tumor removal and were followed up for 1a. RESULTS: In the 191 patients(221 eyes, 44 were male(49 eyesand 147 were female(172 eyes. There were inflammatory lesions in 171 eyes, constituted by IgG4 sclerosing dacryocystitis 66 eyes, 27 eyes of chronic lacrimal gland, lacrimal gland prolapse with inflammatory enlargement 54 eyes, Grave's disease in 24 eyes; 16 eyes of lymphoid hyperplastic lesions, constituted by malignant lymphoma in 6 eyes, benign lymphoid hyperplasia in 10 eyes; epithelial lesions in 34 eyes, constituted by pleomorphic adenoma in 26 eyes, 2 eyes of pleomorphic adenocarcinoma, adenoid cystic carcinoma in 3 eyes, 3 eyes of adenocarcinoma. Lacrimal glandoccupying lesions with IgG4 sclerosing dacryocystitis, lacrimal gland prolapse associated with inflammatory enlargement were the most common, of which 159 eyes of Han, Uighur 36 eyes, Kazak 16 eyes, 10 eyes of Mongolian. After surgery, mainly symptoms were dry eye, crying with no tears, with bilateral lacrimal gland removed significantly, but the local use of artificial tears can ease those symptoms with no serious adverse reactions. CONCLUSION: History and imaging characteristics of lacrimal gland-occupying lesions give a great help to the diagnosis and differential diagnosis. In Xinjiang region, lacrimal gland, with non-epithelial lesions is the most common, followed by epithelial lesions, occurred in the Han, Uighur patients, and rare occurred in other ethnic. Dry eye after surgery and crying with no tears are the main symptoms. Patients with short course of disease and dry eye tend to delay the removal of patients.
Urreizti, Roser; Asteggiano, Carla; Bermudez, Marta; Córdoba, Alfonso; Szlago, Marina; Szlago, Mariana; Grosso, Carola; de Kremer, Raquel Dodelson; Vilarinho, Laura; D'Almeida, Vania; Martínez-Pardo, Mercedes; Peña-Quintana, Luís; Dalmau, Jaime; Bernal, Jaime; Briceño, Ignacio; Couce, María Luz; Rodés, Marga; Vilaseca, Maria Antonia; Balcells, Susana; Grinberg, Daniel
2006-01-01
Classical homocystinuria is due to cystathionine beta-synthase (CBS) deficiency. More than 130 mutations, which differ in prevalence and severity, have been described at the CBS gene. Mutation p.I278T is very prevalent, has been found in all European countries where it has been looked for with the exception of the Iberian peninsula, and is known to respond to vitamin B6. On the other hand, mutation p.T191M is prevalent in Spain and Portugal and does not respond to B6. We analysed 30 pedigrees from Spain, Portugal, Colombia and Argentina, segregating for homocystinuria. The p.T191M mutation was detected in patients from all four countries and was particularly prevalent in Colombia. The number of p.T191M alleles described in this study, together with those previously published, is 71. The prevalence of p.T191M among CBS mutant alleles in the different countries was: 0.75 in Colombia, 0.52 in Spain, 0.33 in Portugal, 0.25 in Venezuela, 0.20 in Argentina and 0.14 in Brazil. Haplotype analyses suggested a double origin for this mutation. No genotype-phenotype correlation other than the B6-nonresponsiveness could be established for the p.T191M mutation. Additionally, three new mutations, p.M173V, p.I429del and c.69_70+8del10, were found. The p.M173V was associated with a mild, B6-responsive, phenotype.
Study of (n,2n reaction on 191,193Ir isotopes and isomeric cross section ratios
Directory of Open Access Journals (Sweden)
Vlastou R.
2017-01-01
Full Text Available The cross section of 191Ir(n,2n190Irg+m1 and 191Ir(n,2n190Irm2 reactions has been measured at 17.1 and 20.9 MeV neutron energies at the 5.5 MV tandem T11/25 Accelerator Laboratory of NCSR “Demokritos”, using the activation method. The neutron beams were produced by means of the 3H(d,n4He reaction at a flux of the order of 2 × 105 n/cm2s. The neutron flux has been deduced implementing the 27Al(n,α reaction, while the flux variation of the neutron beam was monitored by using a BF3 detector. The 193Ir(n,2n192Ir reaction cross section has also been determined, taking into account the contribution from the contaminant 191Ir(n,γ192Ir reaction. The correction method is based on the existing data in ENDF for the contaminant reaction, convoluted with the neutron spectra which have been extensively studied by means of simulations using the NeusDesc and MCNP codes. Statistical model calculations using the code EMPIRE 3.2.2 and taking into account pre-equilibrium emission, have been performed on the data measured in this work as well as on data reported in literature.
Identification of the unfavored N=7 superdeformed band in 191Hg
International Nuclear Information System (INIS)
Carpenter, M.P.; Janssens, R.V.F.; Cederwall, B.; Crowell, B.; Ahmad, I.; Becker, J.A.; Brinkman, M.J.; Deleplanque, M.A.; Diamond, R.M.; Fallon, P.; Farris, L.P.; Garg, U.; Gassmann, D.; Henry, E.A.; Henry, R.G.; Hughes, J.R.; Khoo, T.L.; Lauritsen, T.; Lee, I.Y.; Machiavelli, A.O.; Moore, E.F.; Nisius, D.; Stephens, F.S.
1995-01-01
A new superdeformed band has been identified in 191 Hg bringing the total number of bands observed in this nucleus to four. The new band has properties similar to those of a superdeformed band reported recently in 193 Hg. Both bands are believed to be built on the unfavored signature of the j 15/2 intruder configuration. Comparisons between the data and cranked Woods-Saxon calculations highlight the strengths and weaknesses of theory in describing high-N orbitals at large deformation
Wang, Li; Zhang, Ren; Chen, Jian; Wu, Qihui; Kuang, Zaoyuan
2017-04-01
Tumor necrosis factor-alpha (TNF-α) plays an important role in the developing process of inflammatory bowel disease. Tight junction protein zonula occludens-1 (ZO-1), one of epithelial junctional proteins, maintains the permeability of intestinal barrier. The objective of this study was to investigate the mechanism of the protective effect of baicalin on TNF-α-induced injury and ZO-1 expression in intestinal epithelial cells (IECs). We found that baicalin pretreatment significantly improved cell viability and cell migration following TNF-α stimulation. miR-191a inhibitor increased the protective effect of baicalin on cell motility injured by TNF-α. In addition, miR-191a down-regulated the mRNA and protein level of its target gene ZO-1. TNF-α stimulation increased miR-191a expression, leading to the decline of ZO-1 mRNA and protein. Moreover, pretreatment with baicalin reversed TNF-α induced decrease of ZO-1 and increase of miR-191a, miR-191a inhibitor significantly enhanced ZO-1 protein expression restored by baicalin. These results indicate that baicalin exerts a protective effect on IEC-6 (rat small intestinal epithelial cells) cells against TNF-α-induced injury, which is at least partly via inhibiting the expression of miR-191a, thus increasing ZO-1 mRNA and protein levels.
International Nuclear Information System (INIS)
Bertram-Howery, S.G.; Marietta, M.G.; Rechard, R.P.; Anderson, D.R.; Swift, P.N.; Baker, B.L.; Bean, J.E. Jr.; McCurley, R.D.; Rudeen, D.K.; Beyeler, W.; Brinster, K.F.; Guzowski, R.V.; Schreiber, J.D.; Helton, J.C.; Vaughn, P.
1990-12-01
The Waste Isolation Pilot Plant (WIPP) is planned as the first mined geologic repository for transuranic (TRU) wastes generated by defense programs of the United States Department of Energy (DOE). Before disposing of waste at the WIPP, the DOE must evaluate compliance with the United states Environmental Protection Agency's (EPA) Standard, Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR Part 191, US EPA, 1985). Sandia National Laboratories (SNL) is evaluating long-term performance against criteria in Subpart B of the Standard. ''Performance assessment'' as used in this report includes analyses for the Containment Requirements (section 191.13(a)) and the Individual Protection Requirements (section 191.15). Because proving predictions about future human actions or natural events is not possible, the EPA expects compliance to be determined on the basis of specified quantitative analyses and informed, qualitative judgment. The goal of the WIPP performance-assessment team at SNL is to provide as detailed and thorough a basis as practical for the quantitative aspects of that decision. This report summarizes SNL's late-1990 understanding of the WIPP Project's ability to evaluate compliance with Subpart B. 245 refs., 88 figs., 23 tabs
Energy Technology Data Exchange (ETDEWEB)
Bertram-Howery, S.G.; Marietta, M.G.; Rechard, R.P.; Anderson, D.R. (Sandia National Labs., Albuquerque, NM (USA)); Swift, P.N. (Tech. Reps., Inc., Albuquerque, NM (USA)); Baker, B.L. (Technadyne Engineering Consultants, Inc., Albuquerque, NM (USA)); Bean, J.E. Jr.; McCurley, R.D.; Rudeen, D.K. (New Mexico Engineering Research Inst., Albuquerque, NM (USA)); Beyeler, W.; Brinster, K.F.; Guzowski, R.V.; Sch
1990-12-01
The Waste Isolation Pilot Plant (WIPP) is planned as the first mined geologic repository for transuranic (TRU) wastes generated by defense programs of the United States Department of Energy (DOE). Before disposing of waste at the WIPP, the DOE must evaluate compliance with the United states Environmental Protection Agency's (EPA) Standard, Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR Part 191, US EPA, 1985). Sandia National Laboratories (SNL) is evaluating long-term performance against criteria in Subpart B of the Standard. Performance assessment'' as used in this report includes analyses for the Containment Requirements ({section} 191.13(a)) and the Individual Protection Requirements ({section} 191.15). Because proving predictions about future human actions or natural events is not possible, the EPA expects compliance to be determined on the basis of specified quantitative analyses and informed, qualitative judgment. The goal of the WIPP performance-assessment team at SNL is to provide as detailed and thorough a basis as practical for the quantitative aspects of that decision. This report summarizes SNL's late-1990 understanding of the WIPP Project's ability to evaluate compliance with Subpart B. 245 refs., 88 figs., 23 tabs.
International Nuclear Information System (INIS)
1993-06-01
In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency's (EPA's) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE's report addressed compliance with the Assurance Requirements found in 40 CFR section 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources. This report documents that the site selection process for the WIPP facility did indeed comply with the natural resource disincentive requirement in 40 CFR section 191,14(e) at the time selected and therefore complies with the standard at this time. Thus, it shall be shown that it is reasonably certain that the WIPP site provides better overall protection than practical alternatives that were available when the site was selected. It is important to point out here, and it will be discussed later in the report, that the resource disincentive requirement is a preliminary siting criterion that requires further evaluation of sites that have resources (i.e, hydrocarbons, minerals and groundwater) in the vicinity or on the site. This further evaluation requires that for sites that do have resources, a qualitative determination must be made that the site will provide better overall protection than practical alternatives. The purpose of this report is not to provide a quantitative evaluation for selection of the WIPP site. A further discussion on the difference between the qualitative analysis required under 40 CFR section 191.14(e) and the quantitative analysis under other sections of 40 CFR 191 is provided in section 2.1 of this report
MO-A-BRB-00: TG191: Clinical Use of Luminescent Dosimeters
Energy Technology Data Exchange (ETDEWEB)
NONE
2016-06-15
This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.
MO-A-BRB-01: TG191: Clinical Use of Luminescent Dosimeters
Energy Technology Data Exchange (ETDEWEB)
Kry, S. [UT MD Anderson Cancer Center (United States)
2016-06-15
This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.
MO-A-BRB-01: TG191: Clinical Use of Luminescent Dosimeters
International Nuclear Information System (INIS)
Kry, S.
2016-01-01
This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.
MO-A-BRB-00: TG191: Clinical Use of Luminescent Dosimeters
International Nuclear Information System (INIS)
2016-01-01
This presentation will highlight the upcoming TG-191 report: Clinical Use of Luminescent Dosimeters. Luminescent dosimetry based on TLD and OSLD is a practical, accurate, and precise technique for point dosimetry in medical physics applications. The charges of Task Group 191 were to detail the methodologies for practical and optimal luminescent dosimetry in a clinical setting. This includes (1) To review the variety of TLD/OSL materials available, including features and limitations of each. (2) To outline the optimal steps to achieve accurate and precise dosimetry with luminescent detectors and to evaluate the uncertainty induced when less rigorous procedures are used. (3) To develop consensus guidelines on the optimal use of luminescent dosimeters for clinical practice. (4) To develop guidelines for special medically relevant uses of TLDs/OSLs (e.g., mixed field i.e. photon/neutron dosimetry, particle beam dosimetry, skin dosimetry). While this report provides general guidelines for arbitrary TLD and OSLD processes, the report, and therefore this presentation, provide specific guidance for TLD-100 (LiF:Ti,Mg) and nanoDot (Al2O3:C) dosimeters because of their prevalence in clinical practice. Learning Objectives: Understand the available dosimetry systems, and basic theory of their operation Understand the range of dose determination methodologies and the uncertainties associated with them Become familiar with special considerations for TLD/OSLD relevant for special clinical situations Learn recommended commissioning and QA procedures for these dosimetry systems.
2012-09-18
... DEPARTMENT OF LABOR Employment and Training Administration Comment Request for Information Collection for the ETA 191, Statement of Expenditures and Financial Adjustments of Federal Funds for Unemployment Compensation for Federal Employees and Ex- Servicemembers Report, Extension Without Revisions...
Status of Waste Isolation Pilot Plant compliance with 40 CFR 191B, December 1992
International Nuclear Information System (INIS)
Marietta, M.G.; Anderson, D.R.
1993-10-01
Before disposing of transuranic radioactive waste at the Waste Isolation Pilot Plant (WIPP), the US Department of Energy (DOE) must evaluate compliance with long-term regulations of the US Environmental Protection Agency (EPA). Sandia National Laboratories (SNL) is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This paper describes the 1992 preliminary comparison with Subpart B of the Environmental Standards for the Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191), which regulates long-term releases of radioactive waste. Results of the 1992 PA are preliminary, and cannot be used to determine compliance or noncompliance with EPA regulations because portions of the modeling system and data base are incomplete. Results are consistent, however, with those of previous iterations of PA, and the SNL WIPP PA Department has high confidence that compliance with 40 CFR 191B can be demonstrated. Comparison of predicted radiation doses from the disposal system also gives high confidence that the disposal system is safe for long-term isolation
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
International Nuclear Information System (INIS)
G J Shott; V Yucel; L Desotell
2008-01-01
In 1986, 21 m 3 of transuranic (TRU) waste was inadvertently buried in a shallow land burial trench at the Area 5 Radioactive Waste Management Site on the Nevada Test Site (NTS). The U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office is considered five options for management of the buried TRU waste. One option is to leave the waste in-place if the disposal can meet the requirements of Title 40 Code of Federal Regulations (CFR) Part 191, 'Environmental Radiation Protection Standard for Management and Disposal of Spent Nuclear Fuel, High-Level, and Transuranic Radioactive Wastes'. This paper describes analyses that assess the likelihood that TRU waste in shallow land burial can meet the 40 CFR 191 standards for a geologic repository. The simulated probability of the cumulative release exceeding 1 and 10 times the 40 CFR 191.13 containment requirements is estimated to be 0.009 and less than 0.0001, respectively. The cumulative release is most sensitive to the number of groundwater withdrawal wells drilled through the disposal trench. The mean total effective dose equivalent for a member of the public is estimated to reach a maximum of 0.014 milliSievert (mSv) at 10,000 years, or approximately 10 percent of the 0.15 mSv 40 CFR 191.15 individual protection requirement. The dose is predominantly from inhalation of short-lived Rn-222 progeny in air produced by low-level waste disposed in the same trench. The transuranic radionuclide released in greatest amounts, Pu-239, contributes only 0.4 percent of the dose. The member of public dose is most sensitive to the U-234 inventory and the radon emanation coefficient. Reasonable assurance of compliance with the Subpart C groundwater protection standard is provided by site characterization data and hydrologic processes modeling which support a conclusion of no groundwater pathway within 10,000 years. Limited quantities of transuranic waste in a shallow land burial trench at the NTS can meet
Energy Technology Data Exchange (ETDEWEB)
Fleming, K.N., E-mail: KarlFleming@comcast.net [KNF Consulting LLC, Spokane, WA (United States); Lydell, B.O.Y. [SIGMA-PHASE INC., Vail, AZ (United States)
2016-08-15
Highlights: • Role of operating experience in loss-of-coolant-accident (LOCA) frequency assessment. • Plant-to-plant variability in calculated LOCA frequency. • Frequency of double-ended-guillotine-break (DEGB). • Uncertainties in LOCA frequencies. • Risk management insights. - Abstract: As a tribute to the published work by S.H. Bush, S. Beliczey and H. Schulz, this paper assesses the progress with methods and techniques for quantifying the reliability of piping systems in commercial nuclear power plants on the basis of failure rate estimates derived from field experience data in combination with insights and results from probabilistic fracture mechanics analyses and expert elicitation exercises. This status assessment is made from a technical perspective obtained through development of location-specific loss-of-coolant-accident (LOCA) frequencies for input to risk-informed resolution of the generic safety issue (GSI) 191. The methods and techniques on which these GSI-191 applications are based build on a body of work developed by the authors during a period spanning more than two decades. The insights that are presented and discussed in this paper cover today’s knowledge base concerning how to utilize a risk-informed approach to the assessment of piping reliability in the context of probabilistic risk assessment (PRA) in general and the resolution of GSI-191 in particular. Specifically the paper addresses the extent to which LOCA frequencies vary from location to location within a reactor coolant system pressure boundary (RCPB) for a given plant as well as vary from plant to plant, and the reasons for these variabilities. Furthermore, the paper provides the authors’ perspectives on interpretations and applications of information extracted from an expert elicitation process to obtain LOCA frequencies as documented in NUREG-1829 and how to apply this information to GSI-191. Finally, this paper documents technical insights relative to mitigation of
International Nuclear Information System (INIS)
Fleming, K.N.; Lydell, B.O.Y.
2016-01-01
Highlights: • Role of operating experience in loss-of-coolant-accident (LOCA) frequency assessment. • Plant-to-plant variability in calculated LOCA frequency. • Frequency of double-ended-guillotine-break (DEGB). • Uncertainties in LOCA frequencies. • Risk management insights. - Abstract: As a tribute to the published work by S.H. Bush, S. Beliczey and H. Schulz, this paper assesses the progress with methods and techniques for quantifying the reliability of piping systems in commercial nuclear power plants on the basis of failure rate estimates derived from field experience data in combination with insights and results from probabilistic fracture mechanics analyses and expert elicitation exercises. This status assessment is made from a technical perspective obtained through development of location-specific loss-of-coolant-accident (LOCA) frequencies for input to risk-informed resolution of the generic safety issue (GSI) 191. The methods and techniques on which these GSI-191 applications are based build on a body of work developed by the authors during a period spanning more than two decades. The insights that are presented and discussed in this paper cover today’s knowledge base concerning how to utilize a risk-informed approach to the assessment of piping reliability in the context of probabilistic risk assessment (PRA) in general and the resolution of GSI-191 in particular. Specifically the paper addresses the extent to which LOCA frequencies vary from location to location within a reactor coolant system pressure boundary (RCPB) for a given plant as well as vary from plant to plant, and the reasons for these variabilities. Furthermore, the paper provides the authors’ perspectives on interpretations and applications of information extracted from an expert elicitation process to obtain LOCA frequencies as documented in NUREG-1829 and how to apply this information to GSI-191. Finally, this paper documents technical insights relative to mitigation of
Accelerated fatigue testing of LM 19.1 blades
DEFF Research Database (Denmark)
Kristensen, Ole Jesper Dahl; Jørgensen, E.
2003-01-01
A series of 19.1 metre wind turbine blades manufactured by LM Glasfiber A/S of Lunderskov, Denmark were subjected to a series of flapwise fatigue tests. The object of these fatigue tests is to evaluate the impact of an increased load on the blade in afatigue test and to give information...... if it is possible to increase the load in fatigue test to shorten test time. The tests were carried out as a part of a project financed by the Danish Energy Agency. During the fatigue tests the blades have beensurveyed with thermal imaging equipment to determine how an increase in fatigue load affects the blade...... material. In addition to the thermal imaging surveillance the blades were instrumented with strain gauges. This report presents the temperature duringtest, calibration test results, moment range measurements, strain statistics, thermal imaging registrations and a determination of the size and cause...
Tomasic, Nikica Ljubas; Piterkova, Lucie; Huff, Chad; Bilic, Ernest; Yoon, Donghoon; Miasnikova, Galina Y; Sergueeva, Adelina I; Niu, Xiaomei; Nekhai, Sergei; Gordeuk, Victor; Prchal, Josef T
2013-04-01
Mutations of VHL (a negative regulator of hypoxia-inducible factors) have position-dependent distinct cancer phenotypes. Only two known inherited homozygous VHL mutations exist and they cause polycythemia: Chuvash R200W and Croatian H191D. We report a second polycythemic Croatian H191D homozygote distantly related to the first propositus. Three generations of both families were genotyped for analysis of shared ancestry. Biochemical and molecular tests were performed to better define their phenotypes, with an emphasis on a comparison with Chuvash polycythemia. The VHL H191D mutation did not segregate in the family defined by the known common ancestors of the two subjects, suggesting a high prevalence in Croatians, but haplotype analysis indicated an undocumented common ancestor ∼six generations ago as the founder of this mutation. We show that erythropoietin levels in homozygous VHL H191D individuals are higher than in VHL R200W patients of similar ages, and their native erythroid progenitors, unlike Chuvash R200W, are not hypersensitive to erythropoietin. This observation contrasts with a report suggesting that polycythemia in VHL R200W and H191D homozygotes is due to the loss of JAK2 regulation from VHL R200W and H191D binding to SOCS1. In conclusion, our studies further define the hematologic phenotype of VHL H191D and provide additional evidence for phenotypic heterogeneity associated with the positional effects of VHL mutations.
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick; Kristiansson, Kati; Mattsson, Hannele; Nõukas, Margit; Sapkota, Yadav; Schick, Ursula; Porcu, Eleonora; Rüeger, Sina; McDaid, Aaron F; Porteous, David; Winkler, Thomas W; Salvi, Erika; Shrine, Nick; Liu, Xueping; Ang, Wei Q; Zhang, Weihua; Feitosa, Mary F; Venturini, Cristina; van der Most, Peter J; Rosengren, Anders; Wood, Andrew R; Beaumont, Robin N; Jones, Samuel E; Ruth, Katherine S; Yaghootkar, Hanieh; Tyrrell, Jessica; Havulinna, Aki S; Boers, Harmen; Mägi, Reedik; Kriebel, Jennifer; Müller-Nurasyid, Martina; Perola, Markus; Nieminen, Markku; Lokki, Marja-Liisa; Kähönen, Mika; Viikari, Jorma S; Geller, Frank; Lahti, Jari; Palotie, Aarno; Koponen, Päivikki; Lundqvist, Annamari; Rissanen, Harri; Bottinger, Erwin P; Afaq, Saima; Wojczynski, Mary K; Lenzini, Petra; Nolte, Ilja M; Sparsø, Thomas; Schupf, Nicole; Christensen, Kaare; Perls, Thomas T; Newman, Anne B; Werge, Thomas; Snieder, Harold; Spector, Timothy D; Chambers, John C; Koskinen, Seppo; Melbye, Mads; Raitakari, Olli T; Lehtimäki, Terho; Tobin, Martin D; Wain, Louise V; Sinisalo, Juha; Peters, Annette; Meitinger, Thomas; Martin, Nicholas G; Wray, Naomi R; Montgomery, Grant W; Medland, Sarah E; Swertz, Morris A; Vartiainen, Erkki; Borodulin, Katja; Männistö, Satu; Murray, Anna; Bochud, Murielle; Jacquemont, Sébastien; Rivadeneira, Fernando; Hansen, Thomas F; Oldehinkel, Albertine J; Mangino, Massimo; Province, Michael A; Deloukas, Panos; Kooner, Jaspal S; Freathy, Rachel M; Pennell, Craig; Feenstra, Bjarke; Strachan, David P; Lettre, Guillaume; Hirschhorn, Joel; Cusi, Daniele; Heid, Iris M; Hayward, Caroline; Männik, Katrin; Beckmann, Jacques S; Loos, Ruth J F; Nyholt, Dale R; Metspalu, Andres; Eriksson, Johan G; Weedon, Michael N; Salomaa, Veikko; Franke, Lude; Reymond, Alexandre; Frayling, Timothy M; Kutalik, Zoltán
2017-01-01
There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations at
Energy Technology Data Exchange (ETDEWEB)
1993-06-01
In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency`s (EPA`s) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE`s report addressed compliance with the Assurance Requirements found in 40 CFR {section} 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources. This report documents that the site selection process for the WIPP facility did indeed comply with the natural resource disincentive requirement in 40 CFR {section} 191,14(e) at the time selected and therefore complies with the standard at this time. Thus, it shall be shown that it is reasonably certain that the WIPP site provides better overall protection than practical alternatives that were available when the site was selected. It is important to point out here, and it will be discussed later in the report, that the resource disincentive requirement is a preliminary siting criterion that requires further evaluation of sites that have resources (i.e, hydrocarbons, minerals and groundwater) in the vicinity or on the site. This further evaluation requires that for sites that do have resources, a qualitative determination must be made that the site will provide better overall protection than practical alternatives. The purpose of this report is not to provide a quantitative evaluation for selection of the WIPP site. A further discussion on the difference between the qualitative analysis required under 40 CFR {section} 191.14(e) and the quantitative analysis under other sections of 40 CFR 191 is provided in {section}2.1 of this report.
Pharmocokinetics of the antitumor drug oxoplatinum labelled with 191Pt
International Nuclear Information System (INIS)
Lobanova, E.A.
1985-01-01
A pharmacokinetic study of the antitumor drug oxoplatinum labeled with 191 Pt when agministered to control mice and mice with B-16 melanoma have shown that distribution of the drug in organs and tissues in both groups of animals is nonuniform. The drug is more tropic to the kidneys, liver, spleen, adrenals, thymus, skin and tumor. Correlation was established between the values of the coefficient ratios of differential accumulation (CDA) of the organ/blood in the f;.nal and initial periods of observation and the period of the drug half-life in the organs. The higher the CDA of the organ/blood the longer the period of the drug half-life. The excretion of the drug from the blood and most other organs is described by a bioexponential curve
RDM Lifetime measurements in ^191Hg using the Gammasphere Plunger
Jin, H.; Kharraja, B.; Garg, U.; Ghugre, S. S.; Carpenter, M. P.; Fischer, S.; Janssens, R. V. F.; Khoo, T. L.; Lauritsen, T.; Nisius, D.; Kaczarowski, R.; Govil, I. M.; Kruecken, R.; Machiavelli, A.; MacLeod, R.
1998-10-01
Recoil Distance Lifetime Measurements have been performed for the nucleus ^191Hg at Gammasphere with a view to further investigate the prolate non-collective structure (ɛ2 = 0.1 - 0.15, γ ~= - 120^circ) reported several years ago by D. Ye et al. (D. Ye et al.,) Phys. Lett. B236, 7 (1990) The ^174Yb(^22Ne, 5n) reaction was employed at a beam energy of 120 MeV. In this experiment the new Gammasphere Plunger was used for the first time. Data were collected at 7 distances ranging from 50 μm to 1070 μm. The extracted lifetimes for the level sequence of interest are in the range of ~ 7 ps to 120 ps, leading to transition probabilities that indeed correspond to a non-collective nature.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Use of natural gas or petroleum for certain unanticipated... Natural Gas or Petroleum for Emergency and Unanticipated Equipment Outage Purposes § 501.191 Use of natural gas or petroleum for certain unanticipated equipment outages and emergencies defined in section...
Estrabismo sensorial: estudo de 191 casos Sensorial strabismus: a study of 191 cases
Directory of Open Access Journals (Sweden)
Bráulio Folco Telles de Oliveira
2006-02-01
Full Text Available OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro de 1990 a julho de 2002. RESULTADOS: Foram avaliados 84 pacientes masculinos e 107 femininos; o diagnóstico mais freqüente para baixa visual foi coriorretinite atrófica em 49 casos. Oitenta e sete pacientes tinham exotropia e 97 tinham esotropia. Oitenta e dois pacientes tiveram cirurgia indicada, e 50 foram operados. Em 42 deles, foi constatado sucesso cirúrgico de 90,5% (desvio longe e perto menor ou igual a 15 dioptrias prismáticas. CONCLUSÕES: O bom resultado cirúrgico observado neste e em outros estudos reforça a necessidade da correção cirúrgica nesses casos.PURPOSE: To evaluate the charts of patients with sensorial strabismus regarding range of different aspects, such as etiology, the type and the amount of deviation, relationship between the type of deviation and the patient's age when the disease occurred and the surgical outcome. METHODS: A retrospective analysis of data charts of 191 patients seen at the section of Ophthalmology at the University of São Paulo, from September 1990 to July 2002. RESULTS: There were 84 male and 107 female patients. The most frequent diagnosis responsible for low vision in the squinted eye was atrophic chorioretinitis in 49 patients. Eighty-seven were exotropes and 97 were esotropes. Fifty patients were operated on, but 8 of them were lost to follow-up. In 90.5% the surgical outcome was successful: less than 15 prismatic diopters of hyper or undercorrection after surgery. CONCLUSIONS: The
Tenorio, Emanuel Junio Ramos; Braga, Andre Felipe Farias; Tirapelli, Daniela Pretti Da Cunha; Ribeiro, Mauricio Serra; Piccinato, Carlos Eli; Joviliano, Edwaldo Edner
2018-03-05
The purpose of this study was to quantify and evaluate the expression response of miRNA-191 and miRNA-455-3p endovascular repair of abdominal aortic aneurysm (AAA) based in whole blood samples. This report describes a prospective study of a single center of 30 patients with AAA who underwent endovascular repair. Blood samples were collected preoperatively and 6 months postoperatively. The differential expression of the miRNAs was performed by the real-time polymerase chain reaction method, after extraction of the RNA from the blood samples at the 2 moments. In addition, bioinformatic tools were used to determine pathophysiological pathways related to AAA. The miR-191 and miR-455-3p were overexpressed preoperatively. After 6 months postoperatively, miR-191 (median 0.98, IQR 0.5-2.1, P AAA showed no significant differences in the expression of miR-191 and miR-455-3p. Exclusion of the aneurysmal sac after endovascular treatment induces a decrease in the expression of the studied miRNAs in whole blood samples, which suggests a possible use of them as biomarkers of therapeutic success. Copyright © 2018 Elsevier Inc. All rights reserved.
Multifrequency VLA observations of PKS 0745-191: the archetypal 'cooling flow' radio source?
International Nuclear Information System (INIS)
Baum, S.A.; O'Dea, C.P.
1991-01-01
We present 90-, 20-, 6- and 2-cm VLA observations of the high radio luminosity, cooling flow radio source PKS 0745-191. We find that the radio source has a core with a very steep spectrum and diffuse emission with an even steeper spectrum without clear indications of the jets, hotspots or double lobes found in other radio sources of comparable luminosity. The appearance of the source is highly dependent on frequency and resolution. This dependence reflects both the diffuse nature of the extended emission and the steep, but position-dependent, spectrum of the radio emission. (author)
Directory of Open Access Journals (Sweden)
Santosh Kumar Patnaik
Full Text Available BACKGROUND: MicroRNAs (miRNAs are small, noncoding RNAs (ribonucleic acids that regulate translation. Several miRNAs have been shown to be altered in whole cancer tissue compared to normal tissue when quantified by microarray. Based on previous such evidence of differential expression, we chose to study the functional significance of miRNAs miR-30a and -191 alterations in human lung cancer. METHODOLOGY/PRINCIPAL FINDINGS: The functional significance of miRNAs miR-30a and -191 was studied by creating stable transfectants of the lung adenocarcinoma cell line A549 and the immortalized bronchial epithelial cell line BEAS-2B with modest overexpression of miR-30a or -191 using a lentiviral system. When compared to the corresponding controls, both cell lines overexpressing miR-30a or -191 do not demonstrate any significant changes in cell cycle distribution, cell proliferation, adherent colony formation, soft agar colony formation, xenograft formation in a subcutaneous SCID mouse model, and drug sensitivity to doxorubicin and cisplatin. There is a modest increase in cell migration in cell lines overexpressing miR-30a compared to their controls. CONCLUSIONS/SIGNIFICANCE: Overexpression of miR-30a or -191 does not lead to an alteration in cell cycle, proliferation, xenograft formation, and chemosensitivity of A549 and BEAS-2B cell lines. Using microarray data from whole tumors to select specific miRNAs for functional study may be a suboptimal strategy.
International Nuclear Information System (INIS)
1991-08-01
In 1986, the US Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Project Office (WPO) (DOE-WPO) prepared a strategy for complying with the Environmental Protection Agency's (EPA's) Standards for the management of transuranic (TRU) waste. Section 3.2.2.2 of the DOE's report addressed compliance with the Assurance Requirements found in 40 CFR Part 191.14. One of the Assurance Requirements addresses the selection of repository sites that contain recoverable natural resources and is referred to as the Resource Disincentive Requirement: This document addresses 40 CFR 191, Subpart B, Section 14 (e). The approach is to first summarize the development of the resource requirement to provide a proper perspective for evaluation of WIPP compliance. In addition, a summary of the discussions regarding resources at the WIPP is provided to demonstrate the extent to which the topic has been discussed between the DOE and various oversight groups. Finally, the information on resources at the WIPP site is presented, along with a summary of activities to mitigate negative impacts associated with the denial of resources. 77 refs., 3 figs., 3 tabs
2012-05-22
...). The Office of New Reactors and Office of Nuclear Reactor Regulation are revising SRP Section 19.1... of the Code of Federal Regulations (10 CFR), 50.71(h)(1), (h)(2), and (h)(3) for new reactors, (2... searching on http://www.regulations.gov under Docket ID NRC-2012-0113. You may submit comments by the...
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
Conversion of the 42 keV transition in the decay of 191Os
International Nuclear Information System (INIS)
Bhuloka Reddy, S.; Narasimham, K.L.; Thirumala Rao, B.V.; Lakshminarayana, V.
1986-01-01
The total as well as the L-conversion coefficient of the 42 KeV transition in the decay of 191 Os are determined from intensity balance considerations and XPG technique, respectively, using a 3 mm Si(Li) detector system. The resultant values are αsub(T) = 13709 (1900), αsub(L) = 11700 (2100). The present total conversion coefficients shows good agreement within the uncertainty limits, with the value αsub(T) = 13.500→ 5200 +21100 reported by Lange, whereas the L-conversion coefficient is reported for the first time. Our present values are also compared with the theoretical values interpolated from the tables of Hager and Seltzer and of Rosel et al
Energy Technology Data Exchange (ETDEWEB)
1993-08-01
Before disposing of transuranic radioactive waste in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for a final compliance evaluation. This volume of the 1992 PA contains results of uncertainty and sensitivity analyses with respect to the EPA`s Environmental Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Additional information about the 1992 PA is provided in other volumes. Results of the 1992 uncertainty and sensitivity analyses indicate that, conditional on the modeling assumptions, the choice of parameters selected for sampling, and the assigned parameter-value distributions, the most important parameters for which uncertainty has the potential to affect compliance with 40 CFR 191B are: drilling intensity, intrusion borehole permeability, halite and anhydrite permeabilities, radionuclide solubilities and distribution coefficients, fracture spacing in the Culebra Dolomite Member of the Rustler Formation, porosity of the Culebra, and spatial variability of Culebra transmissivity. Performance with respect to 40 CFR 191B is insensitive to uncertainty in other parameters; however, additional data are needed to confirm that reality lies within the assigned distributions.
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
A review and evaluation of the Draft EPA standard (40 CFR 191)
International Nuclear Information System (INIS)
Ortiz, N.R.; Chu, M.S.Y.; Siegel, M.D.; Wahi, K.K.
1984-01-01
The Environmental Protection Agency's proposed rule for the management and disposal of high-level waste (Draft Standard, 40 CFR 191), was reviewed and analyzed using the risk assessment methodology developed at Sandia National Laboratories. The methodology was exercised on hypothetical repository systems in basalt, bedded salt, and tuff. Among the issues addressed were achievability, release limits, uncertainty, and compliance. The proposed release limits were also analyzed in terms of their relationship to the health effects. The uncertainty in the input parameters of the deterministic models was taken into account in calculating releases to the accessible environment. Extentions to an existing compliance-assessment methodolog are suggested that would allow one to incorporate the uncertainty associated with the frequency of occurrence of scenarios. The results indicate that, in general, the standards are achievable and the release limits are sufficiently conservative
Energy Technology Data Exchange (ETDEWEB)
NONE
1992-12-15
Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Detailed information about the technical basis for the preliminary comparison is contained in Volume 2. The reference data base and values for input parameters used in the modeling system are contained in Volume 3. Uncertainty and sensitivity analyses related to 40 CFR 191B are contained in Volume 4. Volume 5 contains uncertainty and sensitivity analyses of gas and brine migration for undisturbed performance. Finally, guidance derived from the entire 1992 performance assessment is presented in Volume 6. Results of the 1992 performance assessment are preliminary, and are not suitable for final comparison with 40 CFR 191, Subpart B. Portions of the modeling system and the data base remain incomplete, and the level of confidence in the performance estimates is not sufficient for a defensible compliance evaluation. Results are, however, suitable for providing guidance to the WIPP Project. All results are conditional on the models and data used, and are presented for preliminary comparison to the Containment Requirements of 40 CFR 191, Subpart B as mean complementary cumulative distribution functions (CCDFs) displaying estimated probabilistic releases of radionuclides to the accessible environment. Results compare three conceptual models for
International Nuclear Information System (INIS)
1992-12-01
Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Detailed information about the technical basis for the preliminary comparison is contained in Volume 2. The reference data base and values for input parameters used in the modeling system are contained in Volume 3. Uncertainty and sensitivity analyses related to 40 CFR 191B are contained in Volume 4. Volume 5 contains uncertainty and sensitivity analyses of gas and brine migration for undisturbed performance. Finally, guidance derived from the entire 1992 performance assessment is presented in Volume 6. Results of the 1992 performance assessment are preliminary, and are not suitable for final comparison with 40 CFR 191, Subpart B. Portions of the modeling system and the data base remain incomplete, and the level of confidence in the performance estimates is not sufficient for a defensible compliance evaluation. Results are, however, suitable for providing guidance to the WIPP Project. All results are conditional on the models and data used, and are presented for preliminary comparison to the Containment Requirements of 40 CFR 191, Subpart B as mean complementary cumulative distribution functions (CCDFs) displaying estimated probabilistic releases of radionuclides to the accessible environment. Results compare three conceptual models for
Towards a Standardized Line List for G 191-B2B and other DA Type Objects
Preval, S. P.; Barstow, M. A.; Holberg, J. B.; Dickinson, N. J.
2013-01-01
We present a comprehensive analysis of the far UV spectrum of G 191-B2B over the range of 900-1700Å using co-added data from the FUSE and STIS archives. While previous identifications made by Holberg et al. (2003) are reaffirmed in this work, it is found that many previously unidentified lines can now be attributed to Fe, Ni, and a few lighter metals. Future work includes extending this detailed analysis to a wider range of DA objects, in the expectation that a more complete analysis of their atmospheres can be realised.
α-decay properties of 190Po and the identification of 191Po
International Nuclear Information System (INIS)
Batchelder, J.C.; Batchelder, J.C.; Zganjar, E.F.; Toth, K.S.; Bingham, C.R.; Bingham, C.R.; Wauters, J.; Brown, L.T.; Davids, C.N.; Seweryniak, D.; Brown, L.T.; Conticchio, L.F.; Seweryniak, D.; Conticchio, L.F.; Wood, J.L.
1997-01-01
The α-decay properties of 190 Po were investigated through the use of a fragment mass analyzer in conjunction with a double-sided Si strip detector. The isotope was produced via the 96 Mo( 96 Mo,2n) reaction, and its α-decay energy and T 1/2 were measured as 7529(10) keV and 2.4 -0.3 +0.4 ms, respectively. The resulting reduced width is nearly identical to that of the 192,194 Po isotopes. This is believed to result from significant mixing between the ground state π(2p) and the low-lying 0 + π(4p-2h) intruder state in the Po parent. The result provides further evidence for shape coexistence in the light Po isotopes. In addition, 191 Po was unambiguously identified, and the 186 Pb α-decay branch was determined experimentally for the first time. copyright 1997 The American Physical Society
VizieR Online Data Catalog: NLTE spectral analysis of white dwarf G191-B2B (Rauch+, 2013)
Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.
2013-08-01
In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. (3 data files).
The importance of scenario development in meeting 40 CFR part 191
International Nuclear Information System (INIS)
Hunter, R.L.
1988-01-01
Scenario development and screening is a fundamental part of performance assessment, but its importance in satisfying 40 CFR Part 191 (the standard) is sometimes underestimated. The first step in scenario development in support of performance assessment for the standard's containment requirements is to identify a set of potentially disruptive events and processes. This set must be broad enough to allow the identification, as required by the standard, of those processes and events that might affect the disposal system; data can then be collected on the scenarios identified in this step. The standard also requires that releases be estimated for all significant processes and events; thus the final step in scenario development is systematically screening the scenarios, on the basis of their probabilities and consequences, to select those that are important enough to be modeled in detail. In general, a few hundred scenarios for the release of radionuclides from a nuclear-waste repository can be identified, but only a few of these can or should be modeled in detail
Compact self-Q-switched Tm:YLF laser at 1.91 μm
Zhang, B.; Li, L.; He, C. J.; Tian, F. J.; Yang, X. T.; Cui, J. H.; Zhang, J. Z.; Sun, W. M.
2018-03-01
We report self-Q-switching operation in a diode-pumped Tm:YLF bulk laser by exploiting saturable re-absorption under the quasi-three-level regime. Robust self-Q-switched pulse output at 1.91 μm in fundamental mode is demonstrated experimentally with 1.5 at.% doped Tm:YLF crystal. At maximum absorbed pump power of 4.5 W, the average output power and pulse energy are obtained as high as 610 mW and 29 μJ, respectively, with the corresponding slope efficiency of 22%. Pulse repetition rate is tunable in the range of 3-21 kHz with changing the pump power. The dynamics of self-Q-switching of Tm:YLF laser are discussed with the help of a rate equation model showing good agreement with the experiment. The compact self-Q-switched laser near 2 μm has potential application in laser radar systems for accurate wind velocity measurements.
Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV
Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.
2017-09-01
Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.
Population of yrast states in 191Os using deep-inelastic reactions
Jones, G. A.; Podolyák, Zs; Walker, P. M.; Regan, P. H.; de Angelis, G.; Axiotis, M.; Bazzacco, D.; Bizzeti, P. G.; Brandolini, F.; Broda, R.; Bucurescu, D.; Farnea, E.; Gelletly, W.; Gadea, A.; Ionescu-Bujor, M.; Iordachescu, A.; Kröll, Th; Langdown, S. D.; Lunardi, S.; Marginean, N.; Martinez, T.; Medina, N. H.; Quintana, B.; Rubio, B.; Ur, C. A.; Valiente-Dobón, J. J.; Williams, S. J.; Zhang, Y. H.
2005-10-01
Several nuclei in the A ~ 190 region have been studied following deep-inelastic reactions using a 460 MeV 82Se projectile impinging upon a thick 192Os target. The GASP array (at the Legnaro National Laboratory in Italy) was used to measure the resulting γ-decays. The previously reported near-yrast structure of 191Os is extended to a t\\frac{1{2}} = 61 ns isomer, at an energy of 2640 keV. Branching ratios for ΔI = 1 and ΔI = 2 transitions in the Kπ =\\frac{11}{2}+ band have been measured, giving |(gK - gR)/Q0| = 0.022(3) and 0.024(7) for transitions from the \\frac{17}{2}+ and \\big(\\frac{19}{2}^+\\big) states respectively. These are consistent with the theoretical calculation for the proposed ν11/2+[615] configuration of the band. Nilsson plus BCS calculations reveal that the isomer is likely to have a {ν11/2+[615] π11/2-[505] π9/2-[514]} configuration with Jπ =Kπ =\\frac{31}{2}+ . This yields an implied reduced hindrance of fν= 1.9, in accordance with empirical systematics of K isomers in the A ~ 180-190 region.
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
The discovery of Ni V in the photospheres of the hot DA white dwarfs RE 2214-492 and G191-B2B
Holberg, J. B.; Hubeny, I.; Barstow, M. A.; Lanz, T.; Sion, E. M.; Tweedy, R. W.
1994-01-01
We have co-added six recently obtained International Ultraviolet Explorer (IUE) echelle spectra of the hot DA white dwarf RE 2214-492 and 10 existing archive spectra of the well-known hot DA, G191-B2B. We find that both stars contain numerous weak features due to Ni V. Nickel is thus the second iron-group element to be found in the spectra of the very hottest DA white dwarfs. In addition to Ni V, we also observe Al III in both stars and present evidence for the possible presence of Ni IV and Fe IV in RE 2214-492. The presence of Ni and Al, together with previously reported elements, will contribute significantly to both the EUV opacity and to the apparent complexity of the UV spectra of these stars. Using Non-Local Thermodynamic Equilibrium (NLTE) model atmospheres we estimate the Ni abundances in RE 2214-492 the G191-B2B to be log(Ni/H) = -5.5 +/- 0.3 and -6.0 +/- 0.3, respectively.
ROSAT EUV and soft X-ray studies of atmospheric composition and structure in G191-B2B
Barstow, M. A.; Fleming, T. A.; Finley, D. S.; Koester, D.; Diamond, C. J.
1993-01-01
Previous studies of the hot DA white dwarf GI91-B2B have been unable to determine whether the observed soft X-ray and EUV opacity arises from a stratified hydrogen and helium atmosphere or from the presence of trace metals in the photosphere. New EUV and soft X-ray photometry of this star, made with the ROSAT observatory, when analyzed in conjunction with the earlier data, shows that the stratified models cannot account for the observed fluxes. Consequently, we conclude that trace metals must be a substantial source of opacity in the photosphere of G191-B2B.
Crystal Structure of Bacteriophage SPP1 Distal Tail Protein (gp19.1)
Veesler, David; Robin, Gautier; Lichière, Julie; Auzat, Isabelle; Tavares, Paulo; Bron, Patrick; Campanacci, Valérie; Cambillau, Christian
2010-01-01
Siphophage SPP1 infects the Gram-positive bacterium Bacillus subtilis using its long non-contractile tail and tail-tip. Electron microscopy (EM) previously allowed a low resolution assignment of most orf products belonging to these regions. We report here the structure of the SPP1 distal tail protein (Dit, gp19.1). The combination of x-ray crystallography, EM, and light scattering established that Dit is a back-to-back dimer of hexamers. However, Dit fitting in the virion EM maps was only possible with a hexamer located between the tail-tube and the tail-tip. Structure comparison revealed high similarity between Dit and a central component of lactophage baseplates. Sequence similarity search expanded its relatedness to several phage proteins, suggesting that Dit is a docking platform for the tail adsorption apparatus in Siphoviridae infecting Gram-positive bacteria and that its architecture is a paradigm for these hub proteins. Dit structural similarity extends also to non-contractile and contractile phage tail proteins (gpVN and XkdM) as well as to components of the bacterial type 6 secretion system, supporting an evolutionary connection between all these devices. PMID:20843802
Energy Technology Data Exchange (ETDEWEB)
Bertram-Howery, S.G.; Marietta, M.G.; Anderson, D.R.; Gomez, L.S.; Rechard, R.P. (Sandia National Labs., Albuquerque, NM (USA)); Brinster, K.F.; Guzowski, R.V. (Science Applications International Corp., Albuquerque, NM (USA))
1989-12-01
The United States Department of Energy is planning to dispose of transuranic wastes, which have been generated by defense programs, at the Waste Isolation Pilot Plant. The WIPP Project will assess compliance with the requirements of the United States Environmental Protection Agency. This report forecasts the planned 1992 document, Comparison to 40 CFR, Part 191, Subpart B, for the Waste Isolation Pilot Plant (WIPP). 130 refs., 36 figs., 11 tabs.
Non-accidental injuries found in necropsies of domestic cats: a review of 191 cases.
de Siqueira, Adriana; Cassiano, Fabiana Cecília; de Albuquerque Landi, Marina Frota; Marlet, Elza Fernandes; Maiorka, Paulo César
2012-10-01
Animal cruelty is defined as a deliberate action that causes pain and suffering to an animal. In Brazil, legislation known as the Environmental Crimes Law states that cruelty toward all animal species is criminal in nature. From 644 domestic cats necropsied between January 1998 and December 2009, 191 (29.66%) presented lesions highly suggestive of animal cruelty. The main necroscopic finding was exogenous carbamate poisoning (75.39%) followed by blunt-force trauma (21.99%). Cats from 7 months to 2 years of age were the most affected (50.79%). In Brazil, violence is a public health problem and there is a high prevalence of domestic violence. Therefore, even if laws provide for animal welfare and protection, animals are common targets for violent acts. Within a context of social violence, cruelty toward animals is an important parameter to be considered, and the non-accidental lesions that were found are evidence of malicious actions.
Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.
2014-04-01
Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. In a recent analysis of the ultraviolet (UV) spectrum of the DA-type white dwarf G191-B2B, 21 Zn iv lines were newly identified. Because of the lack of Zn iv data, transition probabilities of the isoelectronic Ge vi were adapted for a first, coarse determination of the photospheric Zn abundance. Aims: Reliable Zn iv and Zn v oscillator strengths are used to improve the Zn abundance determination and to identify more Zn lines in the spectra of G191-B2B and the DO-type white dwarf RE 0503-289. Methods: We performed new calculations of Zn iv and Zn v oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of the Zn iv - v spectrum exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: In the UV spectrum of G191-B2B, we identify 31 Zn iv and 16 Zn v lines. Most of these are identified for the first time in any star. We can reproduce well almost all of them at log Zn = -5.52 ± 0.2 (mass fraction, about 1.7 times solar). In particular, the Zn iv / Zn v ionization equilibrium, which is a very sensitive Teff indicator, is well reproduced with the previously determined and log g = 7.60 ± 0.05. In the spectrum of RE 0503-289, we identified 128 Zn v lines for the first time and determined log Zn = -3.57 ± 0.2 (155 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Zn iv and Zn v line profiles in two white dwarf (G191-B2B and RE 0503-289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed us to
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
Iron abundance in the hot DA white dwarfs Feige 24 and G191 B2B
Vennes, Stephane; Chayer, Pierre; Thorstensen, John R.; Bowyer, Stuart; Shipman, Harry L.
1992-01-01
Attention is given to model calculations of the far- and extreme-UV line spectra of highly ionized Fe species (Fe IV, Fe V, and Fe VI) for hot high-gravity H-rich stars. A spectral analysis of 31 hr of exposure of the DA white dwarf Feige 24 with IUE in the echelle mode reveals the presence of Fe with an abundance relative to H by number of (5-10) x 10 exp -6 with an uncertainty dominated by the determination of stellar parameters. An analysis of IUE data from the white dwarf G191 B2B results in a similar Fe abundance if this star shares similar atmospheric parameters (Teff, g) with Feige 24. Fe is thus the second most abundant photospheric element in hot DA white dwarfs.
Passively mode-locked diode-pumped Tm3+:YLF laser emitting at 1.91 µm using a GaAs-based SESAM
Tyazhev, A.; Soulard, R.; Godin, T.; Paris, M.; Brasse, G.; Doualan, J.-L.; Braud, A.; Moncorgé, R.; Laroche, M.; Camy, P.; Hideur, A.
2018-04-01
We report on a diode-pumped Tm:YLF laser passively mode-locked with an InGaAs saturable absorber. The laser emits a train of 31 ps pulses at a wavelength of 1.91 µm with a repetition rate of 94 MHz and a maximum average power of 95 mW. A sustained and robust mode-locking with a signal-to-noise ratio of ~70 dB is obtained even at high relative air humidity, making this system attractive for applications requiring ultra-short pulses in the spectral window just below 2 µm.
The extreme ultraviolet spectrum of G191 - B2B and the ionization of the local interstellar medium
Green, James; Jelinsky, Patrick; Bowyer, Stuart
1990-01-01
The measurement of the extreme ultraviolet spectrum of the nearby hot white dwarf G191 - B2B is reported. The results are used to derive interstellar neutral column densities of 1.6 + or - 0.2 x 10 to the 18th/sq cm and 9.8 + 2.8 or - 2.6 x 10 to the 16th/sq cm for H I and He I, respectively. This ratio of neutral hydrogen to neutral helium indicates that the ionization of hydrogen along the line of sight is less than about 30 percent unless significant helium ionization is present. The scenario in which the hydrogen is highly ionized and the helium is neutral is ruled out by this observation.
Rauch, T.; Werner, K.; Quinet, P.; Kruk, Jeffrey Walter
2014-01-01
Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims. Reliable Ba 5-7 oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods. We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results. For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g=7.5. The Ba abundance is 3.5 +/- 0.5 × 10(exp-4) (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 +/- 0.5 × 10(exp-6) (about 265 times solar). Conclusions. Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely.
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
Lemoine, M.; Vidal-Madjar, A.; Hebrard, G.; Desert, J.-M.; Ferlet, R.; LecavelierdesEtangs, A.; Howk, J. C.; Andre, M.; Blair, W. P.; Friedman, S. D.;
2002-01-01
High-resolution spectra of the hot white dwarf G191-B2B covering the wavelength region 905-1187A were obtained with the Far Ultraviolet Spectroscopic Explorer (FUSE). This data was used in conjunction with existing high-resolution Hubble Space Telescope STIS observations to evaluate the total H(sub I), D(sub I), O(sub I) and N(sub I) column densities along the line of sight. Previous determinations of N(D(sub I)) based upon GHRS (Goddard High Resolution Spectrograph) and STIS (Space Telescope Imaging Spectrograph) observations were controversial due to the saturated strength of the D(sub I) Lyman alpha line. In the present analysis the column density of D(sub I) has been measured using only the unsaturated Lyman beta and Lyman gamma lines observed by FUSE. A careful inspection of possible systematic uncertainties tied to the modeling of the stellar continuum or to the uncertainties in the FUSE instrumental character series has been performed. The column densities derived are: log N(D(sub I)) = 13.40+/-0.07, log N(O(sub I)) = 14.86+/-0.07, and log N(N(sub I)) = 13.87+/-0.07 quoted with 2sigma, uncertainties. The measurement of the H(sub I) column density by profile fitting of the Lyman alpha line has been found to be unsecure. If additional weak hot interstellar components are added to the three detected clouds along the line of sight, the H(sub I)) column density can be reduced quite significantly, even though the signal-to-noise ratio and spectral resolution at Lyman alpha are excellent. The new estimate of N(H(sub I)) toward G191-B2B reads: logN(H (sub I)) = 18.18+/-0.18 (2sigma uncertainty), so that the average (D/H) ratio on the line of sight is: (D/H)= 1.66(+0.9/-0.6) x 10(exp -5) (2sigma uncertainty).
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
Directory of Open Access Journals (Sweden)
César M. Escobedo-Bonilla
2015-04-01
Full Text Available White spot syndrome virus (WSSV is a major pathogen in shrimp aquaculture. RNA interference (RNAi is a promising tool against viral infections. Previous works with RNAi showed different antiviral efficacies depending on the silenced gene. This work evaluated the antiviral efficacy of double-stranded (ds RNA against two non-structural (orf89, wsv191 WSSV genes compared to structural (vp26, vp28 genes to inhibit an experimental WSSV infection. Gene orf89 encodes a putative regulatory protein and gene white spot virus (wsv191 encodes a nonspecific nuclease; whereas genes vp26 and vp28 encode envelope proteins, respectively. Molecules of dsRNA against each of the WSSV genes were intramuscularly injected (4 μg per shrimp into a group of shrimp 48 h before a WSSV challenge. The highest antiviral activity occurred with dsRNA against orf89, vp28 and vp26 (cumulative mortalities 10%, 10% and 21%, respectively. In contrast, the least effective treatment was wsv191 dsRNA (cumulative mortality 83%. All dead animals were WSSV-positive by one-step PCR, whereas reverse-transcription PCR of all surviving shrimp confirmed inhibition of virus replication. This study showed that dsRNA against WSSV genes orf89, vp28 and vp26 were highly effective to inhibit virus replication and suggest an essential role in WSSV infection. Non-structural WSSV genes such as orf89 can be used as novel targets to design therapeutic RNAi molecules against WSSV infection.
DEFF Research Database (Denmark)
Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick
2017-01-01
There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations......-scale genome-wide meta-analysis of structural variation and find rare CNVs associated with height, weight and BMI with large effect sizes.......)). Burden analysis shows a 0.41 cm decrease in height, a 0.003 increase in waist-to-hip ratio and increase in BMI by 0.14 kg/m(2) for each Mb of total deletion burden (P = 2.5 × 10(-10), 6.0 × 10(-5), and 2.9 × 10(-3)). Our study provides evidence that the same genes (e.g., MC4R, FIBIN, and FMO5) harbor...
The extreme ultraviolet spectrum of G191 - B2B and the ionization of the local interstellar medium
International Nuclear Information System (INIS)
Green, J.; Jelinsky, P.; Bowyer, S.
1990-01-01
The measurement of the extreme ultraviolet spectrum of the nearby hot white dwarf G191 - B2B is reported. The results are used to derive interstellar neutral column densities of 1.6 + or - 0.2 x 10 to the 18th/sq cm and 9.8 + 2.8 or - 2.6 x 10 to the 16th/sq cm for H I and He I, respectively. This ratio of neutral hydrogen to neutral helium indicates that the ionization of hydrogen along the line of sight is less than about 30 percent unless significant helium ionization is present. The scenario in which the hydrogen is highly ionized and the helium is neutral is ruled out by this observation. 54 refs
Ferimentos cervicais: análise retrospectiva de 191 casos
Directory of Open Access Journals (Sweden)
Luiz Carlos Von Bahten
Full Text Available OBJETIVOS: Analisar a epidemiologia e a conduta nos ferimentos cervicais. MÉTODO: Foram analisados 487.128 prontuários de pacientes que ingressaram no Serviço de Emergência do Hospital Universitário Cajuru no período de 01/1996 a 06/2001. Destes, selecionaram-se 378 pacientes com ferimentos cervicais. Foram excluídos 153 que apresentavam lesões associadas e 14 por óbito no atendimento inicial. O estudo foi feito , assim, em 191 pacientes com lesões cervicais exclusivas. Avaliou-se a localização da ferida, o mecanismo de trauma, o comprometimento do platisma, sinais e sintomas, a hora de admissão e a conduta empregada. RESULTADOS: Cento e sessenta e quatro (86% pacientes eram masculinos. A média de idade foi de 28 anos (10-72. Noventa (47% ferimentos foram por arma de fogo (FAF e 88 (46% por arma branca (FAB. O principal horário de admissão foi entre 20 e 04 horas. Quanto à localização, 53% das lesões foram à esquerda, 45% à direita e 2% medianos; 36% em zona I, 55% em zona II e 9% em zona III. Em 101 o ferimento penetrou o platisma: cinqüenta e um (50% apresentaram sinais e sintomas clínicos e receberam conduta operatória. As lesões vasculares foram as mais encontradas (20. Houve 24 (47% cervicotomias não-terapêuticas. O tratamento conservador foi empregado em 41 (45% casos de acordo com os exames físico e complementares. CONCLUSÕES: Homens jovens são mais acometidos quanto aos ferimentos cervicais. Estes ocorrem mais freqüentemente na zona II, e a incidência dos FAF e FAB foi equivalente. É adequado um manejo mais seletivo em relação aos ferimentos cervicais, devendo o manejo da zona II adequar-se à disposição de recursos dos serviços de trauma.
Energy Technology Data Exchange (ETDEWEB)
1992-12-01
Before disposing of transuranic radioactive wastes in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This volume contains an overview of WIPP performance assessment and a preliminary comparison with the long-term requirements of the Environmental Radiation Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B).
Energy Technology Data Exchange (ETDEWEB)
Lauritsen, T; Soramel, F; Khoo, T L; Janssens, R V.F.; Ahmad, I; Carpenter, M P; Liang, Y [Argonne National Lab., IL (United States); Fornal, B; Bearden, I; Benet, Ph; Daley, P; Grabowski, Z W; Maier, R [Purdue Univ., Lafayette, IN (United States); Ye, D; Garg, U; Reviol, W [Notre Dame Univ., IN (United States); Drigert, M W [Idaho National Engineering Lab., Idaho Falls, ID (United States)
1992-08-01
The population of the superdeformed bands in {sup 191} Hg has been measured for two reactions with different mass asymmetry. No entrance channel effect was observed, in contrast to similar measurements in the A=150 region. To further elucidate this problem, the entry distribution for the superdeformed band in {sup 192}Hg was measured and a monte Carlo model for the feeding was developed. The simulations suggest that the decision on trapping in the superdeformed well is made at the barrier between the normal and superdeformed wells rather than at the entry point. (author). 9 refs., 3 figs.
Odd and even partial waves of ηπ− and η′π− in π−p→η(′)π−p at 191 GeV/c
Adolph, C.; Akhunzyanov, R.; Alexeev, M. G.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Buechele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M. L.; Curiel, Q.; Torre, S. Dalla; Dasgupta, S. S.; Dasgupta, S.; Denisov, O. Yu; Donskov, S. V.; Doshita, N.; Duic, V.; Duennweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P. D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Filin, A.; Finger, M.; jr, M. Finger; Fischer, H.; Franco, C.; Hohenesche, N. du Fresne von; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmueller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; Harrach, D. von; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, F.; Hinterberger, F.; Hoeppner, Ch; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Joerg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu A.; Kisselev, Yu; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Koenigsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Kraemer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G. K.; Marchand, C.; Martin, A.; Marzec, J.; Matousek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V. I.; Novy, J.; Nowak, W. -D.; Nunes, A. S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V. A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D. I.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlueter, T.; Schmidt, K.; Schmieden, H.; Schoenning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, A.; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Wolbeek, J. ter; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.
2015-01-01
Exclusive production of ηπ− and η′π− has been studied with a 191 GeV/cπ− beam impinging on a hydrogen target at COMPASS (CERN). Partial-wave analyses reveal different odd/even angular momentum (L ) characteristics in the inspected invariant mass range up to 3 GeV/c2. A striking similarity between
Derivation of airfoil characteristics for the LM 19.1 blade based on 3D CFD rotor calculations
Energy Technology Data Exchange (ETDEWEB)
Bak, C; Soerensen, N N; Madsen, H A [Risoe National Lab., Roskilde (Denmark)
1999-03-01
Airfoil characteristics for the LM 19.1 blade are derived from 3D CFD computations on a full-scale 41-m rotor. Based on 3D CFD the force distributions on the blades are determined, from which airfoil characteristics are derived using the momentum theory. The final airfoil characteristics are constructed using both wind tunnel measurements and 3D CFD. Compared to 2D wind tunnel measurements they show a low lift in stall for the airfoil sections at the tip. At the airfoil sections at the inner part of the blade, they show a high lift in stall. At about 60% radius the lift agrees well to 2D wind tunnel measurements. Aero-elastic calculations using the final airfoil characteristics show good agreement to measured power and flap moments. Furthermore, a fatigue load analysis shows a reduction of up to 15% of the load compared to commonly used data. (au)
A Compact Size 4–19.1 GHz Heart Shape UWB Antenna with Triangular Patches
Directory of Open Access Journals (Sweden)
Gokmen Isik
2013-01-01
Full Text Available An ultrawideband antenna is designed, simulated, and realized. To overcome the narrow bandwidth characteristics of basic patch antennas, the structure of the radiation pattern is optimized by the aid of elliptical and rectangular patches. Also triangular patches are applied to the antenna edge in order to enhance the VSWR and gain properties. A typical VSWR of 1.5 (less than 2 in the whole frequency range and a typical gain of 2 dBi (mainly above 1 dBi in the whole frequency range are observed. The simulations present that the designed antenna has a bandwidth ratio of ~5 : 1 within the frequency range of 4–19.1 GHz with compact dimensions of 25 × 26 mm2. It is fabricated on a 0.5 mm thick, RO3035 substrate. The input impedance, gain, and radiation characteristics of the antenna are also presented. With these properties, it is verified that, with its novel shape, the proposed antenna can be used for various UWB applications.
International Nuclear Information System (INIS)
Ortiz, N.R.; Wahi, K.K.
1983-04-01
The Environmental Protection Agency (EPA) has prepared a draft Standard (40CFR191, Draft 19) which, when finalized, will provide the overall system requirements for the geologic disposal of radioactive waste. This document (Vol. 1) provides an Executive Summary of the work performed at Sandia National Laboratories, Albuquerque, NM, under contract to the US Nuclear Regulatory Commission to analyze certain aspects of the draft Standard. The issues of radionuclide release limits, interpretation, uncertainty, achievability, and assessment of compliance with respect to the requirements of the draft Standard are addressed based on the detailed analyses presented in five companion volumes to this report
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.
2014-06-01
Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: Reliable Ba v-vii oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods: We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g = 7.5. The Ba abundance is 3.5 ± 0.5 × 10-4 (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 ± 0.5 × 10-6 (about 265 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for
International Nuclear Information System (INIS)
1995-01-01
The Waste Isolation Pilot Plant (WIPP) is a research and development facility for the demonstration of the permanent isolation of transuranic radioactive wastes in a geologic formation. The facility was constructed in southeastern New Mexico in a manner intended to meet criteria established by the scientific and regulatory community for the safe, long-term disposal of transuranic wastes. The US Department of Energy (DOE) is preparing an application to demonstrate compliance with the requirements outlined in Title 40, Part 191 of the Code of Federal Regulations (CFR) for the permanent disposal of transuranic wastes. As mandated by the Waste Isolation Pilot Plant (WIPP) Land Withdrawal Act of 1992, the US Environmental Protection Agency (EPA) must evaluate this compliance application and provide a determination regarding compliance with the requirements within one year of receiving a complete application. Because the WIPP is a very complex program, the DOE has planned to submit the application as a draft in two parts. This strategy will allow for the DOE and the EPA to begin technical discussions on critical WIPP issues before the one-year compliance determination period begins. This report is the first of these two draft submittals
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-03-31
The Waste Isolation Pilot Plant (WIPP) is a research and development facility for the demonstration of the permanent isolation of transuranic radioactive wastes in a geologic formation. The facility was constructed in southeastern New Mexico in a manner intended to meet criteria established by the scientific and regulatory community for the safe, long-term disposal of transuranic wastes. The US Department of Energy (DOE) is preparing an application to demonstrate compliance with the requirements outlined in Title 40, Part 191 of the Code of Federal Regulations (CFR) for the permanent disposal of transuranic wastes. As mandated by the Waste Isolation Pilot Plant (WIPP) Land Withdrawal Act of 1992, the US Environmental Protection Agency (EPA) must evaluate this compliance application and provide a determination regarding compliance with the requirements within one year of receiving a complete application. Because the WIPP is a very complex program, the DOE has planned to submit the application as a draft in two parts. This strategy will allow for the DOE and the EPA to begin technical discussions on critical WIPP issues before the one-year compliance determination period begins. This report is the first of these two draft submittals.
Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.
2015-05-01
Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, advanced non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These atmospheres are strongly dependent on the reliability of the atomic data that are used to calculate them. Aims: Reliable Ga iv-vi oscillator strengths are used to identify Ga lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ga abundances. Methods: We newly calculated Ga iv-vi oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for analyzing of Ga lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: We unambiguously detected 20 isolated and 6 blended (with lines of other species) Ga v lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The identification of Ga iv and Ga vi lines is uncertain because they are weak and partly blended by other lines. The determined Ga abundance is 3.5 ± 0.5 × 10-5 (mass fraction, about 625 times the solar value). The Ga iv/Ga v ionization equilibrium, which is a very sensitive indicator for the effective temperature, is well reproduced in RE 0503-289. We identified the strongest Ga iv lines (at 1258.801, 1338.129 Å) in the HST/STIS spectrum of G191-B2B and measured a Ga abundance of 2.0 ± 0.5 × 10-6 (about 22 times solar). Conclusions: Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. The observed Ga iv-v line profiles in two white dwarf (G191-B2B and RE 0503-289) ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed us to determine the photospheric Ga abundance in white dwarfs. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space
Detection of 191 Taxifolin Metabolites and Their Distribution in Rats Using HPLC-ESI-IT-TOF-MSn
Directory of Open Access Journals (Sweden)
Ping Yang
2016-09-01
Full Text Available Taxifolin is a ubiquitous bioactive constituent of foods and herbs. To thoroughly explore its metabolism in vivo, an HPLC-ESI-IT-TOF-MSn method combined with specific metabolite detection strategy was used to detect and identify the metabolites of taxifolin in rats. Of the 191 metabolites tentatively identified, 154 were new metabolites, 69 were new compounds and 32 were dimers. This is the first report of the in vivo biotransformation of a single compound into more than 100 metabolites. Furthermore, acetylamination and pyroglutamic acid conjugation were identified as new metabolic reactions. Seventeen metabolites were found to have various taxifolin-related bioactivities. The potential targets of taxifolin and 63 metabolites were predicted using PharmMapper, with results showing that more than 60 metabolites have the same five targets. Metabolites with the same fragment pattern may have the same pharmacophore. Thus these metabolites may exert the same pharmacological effects as taxifolin through an additive effect on the same drug targets. This observation indicates that taxifolin is bioactive not only in the parent form, but also through its metabolites. These findings enhance understanding of the metabolism and effective forms of taxifolin and may provide further insight of the beneficial effects of taxifolin and its derivatives.
Spectrum of {gamma} rays from the decay of SD to normal states in {sup 191}Hg
Energy Technology Data Exchange (ETDEWEB)
Gassmann, D.; Khoo, T.L.; Lauritsen, T. [and others
1995-08-01
In B.a.7. we propose that the statistical spectrum emitted from a sharp single excited state serves as a probe of pairing in excited states. A specific test of this proposal is the comparison of the spectra from even-even and odd-even nuclei. Whereas a pair gap exists in an even-even nucleus, it gets filled in an odd-even nucleus. Consequently, low-energy transitions can arise in the latter case, whereas they are calculated to be absent in the former case because very few levels exist in the cold gap region. In addition, transitions between 1.4 - 2.2 MeV, which {open_quotes}jump{close_quotes} across the gap, are predicted to have lower yield in the odd-even nuclei. Serendipitously, decay from a superdeformed state serves as a good initial excited sharp state. We extracted the spectrum pairwise-coincident with SD lines in {sup 191}Hg from Gammasphere data and compared it with the equivalent spectra from the even-even nuclei {sup 192,194}Hg. The differences that are predicted to occur are indeed observed. Thus, the data support our proposal that the reduction of pairing with thermal excitation energy can be probed with statistical decay spectra.
Günther, Ute; Moos, Verena; Offenmüller, Gabriel; Oelkers, Gerrit; Heise, Walther; Moter, Annette; Loddenkemper, Christoph; Schneider, Thomas
2015-01-01
Abstract Classic Whipple disease (CWD) is a systemic infection caused by Tropheryma whipplei. Different diagnostic tools have been developed over the last decades: periodic acid-Schiff (PAS) staining, T whipplei-specific polymerase chain reaction (PCR), and T whipplei-specific immunohistochemistry (IHC). Despite all these advances, CWD is still difficult to diagnose because of a variety of clinical symptoms and possibly a long time span between first unspecific symptoms and the full-blown clinical picture of the disease. Herein, we report an observational cohort study summarizing epidemiologic data, clinical manifestations, and diagnostic parameters of 191 patients with CWD collected at our institution. Gastrointestinal manifestations are the most characteristic symptoms of CWD affecting 76% of the cohort. Although the small bowel was macroscopically conspicuous in only 27% of cases, 173 (91%) patients presented with characteristic histological changes in small bowel biopsies (in 2 patients, these changes were only seen within the ileum). However, 18 patients displayed normal small bowel histology without typical PAS staining. In 9 of these patients, alternative test were positive from their duodenal specimens (ie, T whipplei-specific PCR and/or IHC). Thus, in 182 patients (95%) a diagnostic hint toward CWD was obtained from small bowel biopsies. Only 9 patients (5%) were diagnosed solely based on positive T whipplei-specific PCR and/or IHC of extraintestinal fluids (eg, cerebrospinal fluid, synovial fluid) or extraintestinal tissue (eg, lymph node, synovial tissue), respectively. Thus, despite efforts to diagnose CWD from alternative specimens, gastroscopy with duodenal biopsy and subsequent histological and molecular–biological examination is the most reliable diagnostic tool for CWD. PMID:25881849
Hu, Zhonghua; Yu, Danni; Gu, Qin-Hua; Yang, Yanqin; Tu, Kang; Zhu, Jun; Li, Zheng
2014-02-01
Activity-dependent modification of dendritic spines, subcellular compartments accommodating postsynaptic specializations in the brain, is an important cellular mechanism for brain development, cognition and synaptic pathology of brain disorders. NMDA receptor-dependent long-term depression (NMDAR-LTD), a prototypic form of synaptic plasticity, is accompanied by prolonged remodelling of spines. The mechanisms underlying long-lasting spine remodelling in NMDAR-LTD, however, are largely unclear. Here we show that LTD induction causes global changes in miRNA transcriptomes affecting many cellular activities. Specifically, we show that expression changes of miR-191 and miR-135 are required for maintenance but not induction of spine restructuring. Moreover, we find that actin depolymerization and AMPA receptor exocytosis are regulated for extended periods of time by miRNAs to support long-lasting spine plasticity. These findings reveal a miRNA-mediated mechanism and a role for AMPA receptor exocytosis in long-lasting spine plasticity, and identify a number of candidate miRNAs involved in LTD.
Energy Technology Data Exchange (ETDEWEB)
Macklin, R.L.; Drake, D.M.; Malanify, J.J.
1977-11-01
Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu, and the /sup 6/Li(n,..cap alpha..)/sup 3/H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV.
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
Heymann, Jody; Cassola, Adèle; Raub, Amy; Mishra, Lipi
2013-07-01
United Nations (UN) member states have universally recognised the right to health in international agreements, but protection of this right at the national level remains incomplete. This article examines the level and scope of constitutional protection of specific rights to public health and medical care, as well as the broad right to health. We analysed health rights in the constitutions of 191 UN countries in 2007 and 2011. We examined how rights protections varied across the year of constitutional adoption; national income group and region; and for vulnerable groups within each country. A minority of the countries guaranteed the rights to public health (14%), medical care (38%) and overall health (36%) in their constitutions in 2011. Free medical care was constitutionally protected in 9% of the countries. Thirteen per cent of the constitutions guaranteed children's right to health or medical care, 6% did so for persons with disabilities and 5% for each of the elderly and the socio-economically disadvantaged. Valuable next steps include regular monitoring of the national protection of health rights recognised in international agreements, analyses of the impact of health rights on health outcomes and longitudinal multi-level studies to assess whether specific formulations of the rights have greater impact.
Energy Technology Data Exchange (ETDEWEB)
Fondeur, F.; Taylor-Pashow, K.
2013-10-31
Savannah River National Laboratory (SRNL) analyzed solvent samples from Modular Caustic-Side Solvent Extraction Unit (MCU) in support of continuing operations. A quarterly analysis of the solvent is required to maintain solvent composition within specifications. Analytical results of the analyses of Solvent Hold Tank (SHT) samples MCU-13-189, MCU-13-190, and MCU-13-191 received on September 4, 2013 are reported. The results show that the solvent (remaining heel in the SHT tank) at MCU contains excess Isopar L and a deficit concentration of modifier and trioctylamine when compared to the standard MCU solvent. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar L trimming at this time. Since MCU is switching to NGS, there is no need to add TOA nor modifier. SRNL also analyzed the SHT sample for {{sup 137}Cs content and determined the measured value is within tolerance and the value has returned to levels observed in 2011.
International Nuclear Information System (INIS)
Anderson, D.R.; Marietta, M.G.; Higgins, P.J. Jr.
1993-10-01
Before disposing of transuranic radioactive waste at the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with long-term regulations of the United States Environmental Protection Agency (EPA), specifically the Environmental Standards for the Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191), and the Land Disposal Restrictions (40 CFR 268) of the Hazardous and Solid Waste Amendments to the Resource Conservation and Recovery Act (RCRA). Sandia National Laboratories (SNL) is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This paper provides background information on the regulations, describes the SNL WIPP PA Departments approach to developing a defensible technical basis for consistent compliance evaluations, and summarizes the major observations and conclusions drawn from the 1991 and 1992 PAs
Rauch, T.; Gamrath, S.; Quinet, P.; Löbling, L.; Hoyer, D.; Werner, K.; Kruk, J. W.; Demleitner, M.
2017-03-01
Context. For the spectral analysis of high-resolution and high-signal-to-noise spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To search for zirconium and xenon lines in the ultraviolet (UV) spectra of G191-B2B and RE 0503-289, new Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths were calculated. This allows, for the first time, determination of the Zr abundance in white dwarf (WD) stars and improvement of the Xe abundance determinations. Methods: We calculated Zr iv-vii, Xe iv-v, and Xe vii oscillator strengths to consider radiative and collisional bound-bound transitions of Zr and Xe in our NLTE stellar-atmosphere models for the analysis of their lines exhibited in UV observations of the hot WDs G191-B2B and RE 0503-289. Results: We identified one new Zr iv, 14 new Zr v, and ten new Zr vi lines in the spectrum of RE 0503-289. Zr was detected for the first time in a WD. We measured a Zr abundance of -3.5 ± 0.2 (logarithmic mass fraction, approx. 11 500 times solar). We identified five new Xe vi lines and determined a Xe abundance of -3.9 ± 0.2 (approx. 7500 times solar). We determined a preliminary photospheric Al abundance of -4.3 ± 0.2 (solar) in RE 0503-289. In the spectra of G191-B2B, no Zr line was identified. The strongest Zr iv line (1598.948 Å) in our model gave an upper limit of -5.6 ± 0.3 (approx. 100 times solar). No Xe line was identified in the UV spectrum of G191-B2B and we confirmed the previously determined upper limit of -6.8 ± 0.3 (ten times solar). Conclusions: Precise measurements and calculations of atomic data are a prerequisite for advanced NLTE stellar-atmosphere modeling. Observed Zr iv-vi and Xe vi-vii line profiles in the UV spectrum of RE 0503-289 were simultaneously well reproduced with our newly calculated oscillator strengths. Based on observations
International Nuclear Information System (INIS)
Bruhweiler, F.C.; Kondo, Y.
1981-01-01
High-resolution spectra of the neargy (48 pc) white dwarf G191-B2B obtained with the International Ultraviolet Explorer (IUE) reveal sharp resonance lines of N V, C IV, and Si IV. The origin of these features is most likely linked to the white dwarf, possibly being formed in an expanding halo around the star. Interstellar lines of C II, N I, Mg II, Si II, Fe II are also seen in the spectrum. Analysis of these features indicates an average neutral hydrogen number density, n/sub Htsi/ = 6.4 x 10 -3 , for this line of sight. In combination with the recent EUV and soft X-ray results, we interpret this to mean that the interstellar medium in the most immediate solar vicinity is of the ''normal'' density (nroughly-equal0.1 cm -3 ) of lower ionization, while just beyond it, at least in some directions, is a hot, lower density plasma. These results are apparently in conflict with the model of the interstellar medium by McKee and Ostriker in its present form
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
Bruhweiler, F. C.; Kondo, Y.
1981-01-01
High-resolution spectra of the nearby (48 pc) white dwarf G191-B2B, obtained with the International Ultraviolet Explorer, reveal sharp resonance lines of N V, C IV, and Si IV. The origin of these features is most likely linked to the white dwarf, possibly being formed in an expanding halo around the star. Interstellar lines of C II, N I, Mg II, Si II, and Fe II are also seen in the spectrum. Analysis of these features indicates an average neutral hydrogen number density of 0.064 for this line of sight. In combination with the recent EUV and soft X-ray results, this is interpreted to mean that the interstellar medium in the most immediate solar vicinity is of the normal density n approximately equal to 0.1/cu cm of lower ionization, while just beyond it, at least in some directions, is a hot lower density plasma. These results are apparently in conflict with the model of the interstellar medium by McKee and Ostriker (1977) in its present form.
DEFF Research Database (Denmark)
Sarno, S; Vaglio, P; Marin, O
1997-01-01
by the beta-subunit many fold more than that of alpha wild type, while extrastimulation by beta mutant D55L56E57A, observable with alpha wild type, is abolished with these mutants. These data support the conclusion that down regulation by the acidic residues clustered in the N-terminal moiety of beta...... is mediated by basic residues in the 74-83 and in the 191-198 sequences of the alpha-subunit. These are also implicated in substrate recognition consistent with the concept that the N-terminal acidic region of the beta subunit operates as a pseudosubstrate. In contrast, another CK2alpha mutant, V66A, is more...
Rauch, T.; Quinet, T.; Hoyer, D.; Werner, K.; Demleitner, M.; Kruk, J. W.
2016-01-01
For the spectral analysis of high-resolution and high signal-to-noise (SN) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To identify molybdenum lines in the ultraviolet (UV) spectra of the DA-type white dwarf G191B2B and the DO-type white dwarf RE 0503289 and, to determine their photospheric Mo abundances, reliable Mo iv-vii oscillator strengths are used. Methods: We newly calculated Mo iv-vii oscillator strengths to consider their radiative and collisional bound-bound transitions indetail in our NLTE stellar-atmosphere models for the analysis of Mo lines exhibited in high-resolution and high SN UV observations of RE 0503289.Results. We identified 12 Mo v and nine Mo vi lines in the UV spectrum of RE 0503289 and measured a photospheric Mo abundance of 1.2 3.0 104(mass fraction, 22 500 56 400 times the solar abundance). In addition, from the As v and Sn iv resonance lines,we measured mass fractions of arsenic (0.51.3 105, about 300 1200 times solar) and tin (1.33.2 104, about 14 300 35 200 times solar). For G191B2B, upper limits were determined for the abundances of Mo (5.3 107, 100 times solar) and, in addition, for Kr (1.1106, 10 times solar) and Xe (1.7107, 10 times solar). The arsenic abundance was determined (2.35.9 107, about 21 53 times solar). A new, registered German Astrophysical Virtual Observatory (GAVO) service, TOSS, has been constructed to provide weighted oscillator strengths and transition probabilities.Conclusions. Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. Observed Mo v-vi line profiles in the UV spectrum of the white dwarf RE 0503289 were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed the photospheric Mo abundance in a white dwarf to be determined.
Safety profile of snake antivenom (use) in Hong Kong - a review of 191 cases from 2008 to 2015.
Mong, Rupeng; Ng, Vember C H; Tse, Man Li
2017-12-01
The mainstay of treatment for significant envenoming from snakebites is antivenom. However, there is insufficient data regarding the safety of antivenom used in Hong Kong. We describe the incidence of hypersensitivity reactions from antivenom use and review the frequency and reasons for intensive care unit (ICU) admission. The Hong Kong Poisons Information Centre database was reviewed. All patients given snake antivenom between 2008 and 2015 were included. Patient demographics, species of snake involved, details of antivenom used, treatment location, use of pre-treatment, reasons for ICU admission (where applicable) and details of early and late antivenom reactions were extracted. There were 191 patients who received snake antivenom. Most (93%) were treated with either the green pit viper antivenom from Thailand or the Agkistrodon halys antivenom from China. The incidences of early hypersensitivity reactions to green pit viper antivenom and Agkistrodon Halys antivenom were 4.7% and 1.4%, respectively. Most patients (69%) were managed in the ED observation ward or general ward. There were 59 patients managed in ICU, most (90%) of whom were admitted for close monitoring during antivenom administration. There were no cases of significant morbidity from antivenom administration. Eight patients (5.6%) had features suggestive of mild serum sickness. The incidence of immediate hypersensitivity reaction to antivenom commonly used in Hong Kong is low. Majority of patients were managed safely in the emergency department observation ward or general ward. Serum sickness appears to be uncommon and possible cases presented with mild features.
Adolph, C.; Alexeev, M.G.; Alexeev, G.D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E.R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlak, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Buchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Crespo, M.L.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S.S.; Dasgupta, S.; Denisov, O.Yu.; Donskov, S.V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; M. Finger jr; Fischer, H.; Franco, C.; von Hohenesche, N. du Fresne; Friedrich, J.M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O.P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmuller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F.H.; Herrmann, F.; Hinterberger, F.; Hoppner, Ch.; Horikawa, N.; d'Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jary, V.; Jasinski, P.; Jorg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G.V.; Khokhlov, Yu. A.; Kisselev, Yu.; Klein, F.; Klimaszewski, K.; Koivuniemi, J.H.; Kolosov, V.N.; Kondo, K.; Konigsmann, K.; Konorov, I.; Konstantinov, V.F.; Kotzinian, A.M.; Kouznetsov, O.; Kramer, M.; Kroumchtein, Z.V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R.P.; Lednev, A.A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.K.; Marchand, C.; Martin, A.; Marzec, J.; Matousek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Novy, J.; Nowak, W.D.; Nunes, A.S.; Olshevsky, A.G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peshekhonov, D.V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N.S.; Ryabchikov, D.I.; Rychter, A.; Samoylenko, V.D.; Sandacz, A.; Sarkar, S.; Savin, I.A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schluter, T.; Schmidt, K.; Schmieden, H.; Schonning, K.; Schopferer, S.; Schott, M.; Shevchenko, O.Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, A.; Steiger, L.; Stolarski, M.; Sulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Wolbeek, J. ter; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.
2015-01-01
Exclusive production of $\\eta\\pi^-$ and $\\eta'\\pi^-$ has been studied with a $191\\,\\textrm{GeV}/c$ $\\pi^-$ beam impinging on a hydrogen target at COMPASS (CERN). Partial-wave analyses reveal different odd/even angular momentum ($L$) characteristics in the inspected invariant mass range up to $3\\,\\textrm{GeV}/c^2$. A striking similarity between the two systems is observed for the $L=2,4,6$ intensities (scaled by kinematical factors) and the relative phases. The known resonances $a_2(1320)$ and $a_4(2040)$ are in line with this similarity. In contrast, a strong enhancement of $\\eta'\\pi^-$ over $\\eta\\pi^-$ is found for the $L=1,3,5$ waves, which carry non-$q\\bar q$ quantum numbers. The $L=1$ intensity peaks at $1.7\\,\\textrm{GeV}/c^2$ in $\\eta'\\pi^-$ and at $1.4\\,\\textrm{GeV}/c^2$ in $\\eta\\pi^-$, the corresponding phase motions with respect to $L=2$ are different.
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.
2013-01-01
Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims. We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods. In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results. TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at Teff =60 000 +/- 2000K and log g=7.60 +/- 0.05.We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions. The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare.
A comprehensive near- and far-ultraviolet spectroscopic study of the hot DA white dwarf G191-B2B
Preval, S. P.; Barstow, M. A.; Holberg, J. B.; Dickinson, N. J.
2013-11-01
We present a detailed spectroscopic analysis of the hot DA white dwarf G191-B2B, using the best signal-to-noise ratio, high-resolution near- and far-UV spectrum obtained to date. This is constructed from co-added Hubble Space Telescope (HST) Space Telescope Imaging Spectrometer (STIS) E140H, E230H and FUSE observations, covering the spectral ranges of 1150-3145 Å and 910-1185 Å, respectively. With the aid of recently published atomic data, we have been able to identify previously undetected absorption features down to equivalent widths of only a few mÅ. In total, 976 absorption features have been detected to 3σ confidence or greater, with 947 of these lines now possessing an identification, the majority of which are attributed to Fe and Ni transitions. In our survey, we have also potentially identified an additional source of circumstellar material originating from Si III. While we confirm the presence of Ge detected by Vennes et al., we do not detect any other species. Furthermore, we have calculated updated abundances for C, N, O, Si, P, S, Fe and Ni, while also calculating, for the first time, a non-local thermodynamic equilibrium abundance for Al, deriving Al III/H=1.60_{-0.08}^{+0.07}× {10}^{-7}. Our analysis constitutes what is the most complete spectroscopic survey of any white dwarf. All observed absorption features in the FUSE spectrum have now been identified, and relatively few remain elusive in the STIS spectrum.
Barstow, M. A.; Cruddace, R. G.; Kowalski, M. P.; Bannister, N. P.; Yentis, D.; Lapington, J. S.; Tandy, J. A.; Hubeny, I.; Schuh, S.; Dreizler, S.; Barbee, T. W.
2005-10-01
We have continued our detailed analysis of the high-resolution (R= 4000) spectroscopic observation of the DA white dwarf G191-B2B, obtained by the Joint Astrophysical Plasmadynamic Experiment (J-PEX) normal incidence sounding rocket-borne telescope, comparing the observed data with theoretical predictions for both homogeneous and stratified atmosphere structures. We find that the former models give the best agreement over the narrow waveband covered by J-PEX, in conflict with what is expected from previous studies of the lower resolution but broader wavelength coverage Extreme Ultraviolet Explorer spectra. We discuss the possible limitations of the atomic data and our understanding of the stellar atmospheres that might give rise to this inconsistency. In our earlier study, we obtained an unusually high ionization fraction for the ionized HeII present along the line of sight to the star. In the present paper, we obtain a better fit when we assume, as suggested by Space Telescope Imaging Spectrograph results, that this HeII resides in two separate components. When one of these is assigned to the local interstellar cloud, the implied He ionization fraction is consistent with measurements along other lines of sight. However, the resolving power and signal-to-noise available from the instrument configuration used in this first successful J-PEX flight are not sufficient to clearly identify and prove the existence of the two components.
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
International Nuclear Information System (INIS)
Szomoru, Daniel; Franx, Marijn; Bouwens, Rychard J.; Van Dokkum, Pieter G.; Trenti, Michele; Illingworth, Garth D.; Labbe, Ivo; Oesch, Pascal A.; Carollo, C. Marcella
2010-01-01
We present very deep Wide Field Camera 3 (WFC3) photometry of a massive, compact galaxy located in the Hubble Ultra Deep Field. This quiescent galaxy has a spectroscopic redshift z = 1.91 and has been identified as an extremely compact galaxy by Daddi et al. We use new H F160W imaging data obtained with Hubble Space Telescope/WFC3 to measure the deconvolved surface brightness profile to H ∼ 28 mag arcsec -2 . We find that the surface brightness profile is well approximated by an n = 3.7 Sersic profile. Our deconvolved profile is constructed by a new technique which corrects the best-fit Sersic profile with the residual of the fit to the observed image. This allows for galaxy profiles which deviate from a Sersic profile. We determine the effective radius of this galaxy: r e = 0.42 ± 0.14 kpc in the observed H F160W band. We show that this result is robust to deviations from the Sersic model used in the fit. We test the sensitivity of our analysis to faint 'wings' in the profile using simulated galaxy images consisting of a bright compact component and a faint extended component. We find that due to the combination of the WFC3 imaging depth and our method's sensitivity to extended faint emission we can accurately trace the intrinsic surface brightness profile, and that we can therefore confidently rule out the existence of a faint extended envelope around the observed galaxy down to our surface brightness limit. These results confirm that the galaxy lies a factor ∼10 off from the local mass-size relation.
Energy Technology Data Exchange (ETDEWEB)
Hilgers, K.
2005-12-15
New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq
Kroese, Leonard F; Kleinrensink, Gert-Jan; Lange, Johan F; Gillion, Jean-Francois
2018-03-01
Incisional hernia is a frequent complication after midline laparotomy. Surgical hernia repair is associated with complications, but no clear predictive risk factors have been identified. The European Hernia Society (EHS) classification offers a structured framework to describe hernias and to analyze postoperative complications. Because of its structured nature, it might prove to be useful for preoperative patient or treatment classification. The objective of this study was to investigate the EHS classification as a predictor for postoperative complications after incisional hernia surgery. An analysis was performed using a registry-based, large-scale, prospective cohort study, including all patients undergoing incisional hernia surgery between September 1, 2011 and February 29, 2016. Univariate analyses and multivariable logistic regression analysis were performed to identify risk factors for postoperative complications. A total of 2,191 patients were included, of whom 323 (15%) had 1 or more complications. Factors associated with complications in univariate analyses (p < 0.20) and clinically relevant factors were included in the multivariable analysis. In the multivariable analysis, EHS width class, incarceration, open surgery, duration of surgery, Altemeier wound class, and therapeutic antibiotic treatment were independent risk factors for postoperative complications. Third recurrence and emergency surgery were associated with fewer complications. Incisional hernia repair is associated with a 15% complication rate. The EHS width classification is associated with postoperative complications. To identify patients at risk for complications, the EHS classification is useful. Copyright © 2017. Published by Elsevier Inc.
Energy Technology Data Exchange (ETDEWEB)
Wagstaffe, P J; Griepink, B; Muntau, H; Schramel, P
1987-01-01
The report describes the preparation and certification of a wholemeal flour (CRM 189) and a lyophilised brown breas (CRM 191) for their contents (mass fractions) of elements of toxicological and nutritional importance: Cd, Pb, Se, Cu, Zn, Fe and Mn. Indicative values are also given for As, Ca, Cl, Cr, Hg, Mg, Na, Ni, P and K. Details are given of a preliminary intercomparison of methods for these elements in a wholemeal flour sample, homogeneity and stability studies on the two reference materials and the results and evaluation of the certification exercise which involved 21 European Laboratories. Summaries of the certification methods are also presented. The report concludes with a discussion of the most common sources of error in determining the elements of interest and the steps to be taken to control them. With 7 figs., 28 tabs.
Rauch, T.; Quinet, P.; Hoyer, D.; Werner, K.; Demleitner, M.; Kruk, J. W.
2016-03-01
Context. For the spectral analysis of high-resolution and high signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: To identify molybdenum lines in the ultraviolet (UV) spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and, to determine their photospheric Mo abundances, reliable Mo iv-vii oscillator strengths are used. Methods: We newly calculated Mo iv-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Mo lines exhibited in high-resolution and high S/N UV observations of RE 0503-289. Results: We identified 12 Mo v and 9 Mo vi lines in the UV spectrum of RE 0503-289 and measured a photospheric Mo abundance of 1.2-3.0 × 10-4 (mass fraction, 22 500-56 400 times the solar abundance). In addition, from the As v and Sn iv resonance lines, we measured mass fractions of arsenic (0.5-1.3 × 10-5, about 300-1200 times solar) and tin (1.3-3.2 × 10-4, about 14 300-35 200 times solar). For G191-B2B, upper limits were determined for the abundances of Mo (5.3 × 10-7, 100 times solar) and, in addition, for Kr (1.1 × 10-6, 10 times solar) and Xe (1.7 × 10-7, 10 times solar). The arsenic abundance was determined (2.3-5.9 × 10-7, about 21-53 times solar). A new, registered German Astrophysical Virtual Observatory (GAVO) service, TOSS, has been constructed to provide weighted oscillator strengths and transition probabilities. Conclusions: Reliable measurements and calculations of atomic data are a prerequisite for stellar-atmosphere modeling. Observed Mo v-vi line profiles in the UV spectrum of the white dwarf RE 0503-289 were well reproduced with our newly calculated oscillator strengths. For the first time, this allowed the photospheric Mo
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
Rauch, T.; Werner, K.; Bohlin, R.; Kruk, J. W.
2013-12-01
Context. Hydrogen-rich, DA-type white dwarfs are particularly suited as primary standard stars for flux calibration. State-of-the-art NLTE models consider opacities of species up to trans-iron elements and provide reliable synthetic stellar-atmosphere spectra to compare with observations. Aims: We will establish a database of theoretical spectra of stellar flux standards that are easily accessible via a web interface. Methods: In the framework of the Virtual Observatory, the German Astrophysical Virtual Observatory developed the registered service TheoSSA. It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In case of the DA white dwarf G191-B2B, we demonstrate that the model reproduces not only its overall continuum shape but also the numerous metal lines exhibited in its ultraviolet spectrum. Results: TheoSSA is in operation and contains presently a variety of SEDs for DA-type white dwarfs. It will be extended in the near future and can host SEDs of all primary and secondary flux standards. The spectral analysis of G191-B2B has shown that our hydrostatic models reproduce the observations best at and log g = 7.60 ± 0.05. We newly identified Fe vi, Ni vi, and Zn iv lines. For the first time, we determined the photospheric zinc abundance with a logarithmic mass fraction of -4.89 (7.5 × solar). The abundances of He (upper limit), C, N, O, Al, Si, O, P, S, Fe, Ni, Ge, and Sn were precisely determined. Upper abundance limits of about 10% solar were derived for Ti, Cr, Mn, and Co. Conclusions: The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of all astronomical data and cross-calibration between different instruments can be based on the same models and SEDs calculated with different model-atmosphere codes and are easy to compare. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
2010-01-01
... Sanctuary regulations. State Archaeologist means the State Archaeologist, Michigan Historical Center... decisions related to the Treaty. Underwater cultural resource means: (1) Any sunken watercraft, including a... underwater cultural resource by the Director pursuant to § 922.198. Underwater cultural resource also means...
2010-01-01
... the District of Columbia. (c) Accountant means any individual who is duly qualified to practice as a certified public accountant or a public accountant in any state, possession, territory, commonwealth of the..., opinion or other paper or document by an attorney, accountant, or other licensed professional which is...
2010-04-01
... number and e-mail address of a contact person, and the location of the merchandise. (e) Decision to waive... transported in-bond to the port of exportation or destruction. (g) Extent of examination. The appropriate... evidence of exportation (see subpart G of this part). The claimant may establish exportation by mail as set...
2010-07-01
... product. Research and development facility means laboratory and pilot plant operations whose primary... part. Bench-scale batch process means a batch process (other than a research and development facility... source begins production. Initial start-up does not include operation solely for testing equipment. For...
2010-07-01
...: (a) Financial institution means any office of a bank, savings bank, card issuer as defined in section 103 of the Consumer Credit Protection Act (15 U.S.C. 1602(n)), industrial loan company, trust company, savings and loan, building and loan, or homestead association (including cooperative banks), credit union...
2010-07-01
.... (7) Develop procedures for and implement a program to eliminate sexual harassment in Component work places, consistent with DoD Policy on Sexual Harassment memorandums, and to ensure compliance with the...
2010-01-01
... suitable title. (b) The order or proclamation shall contain a citation of the authority under which it is issued. (c) Punctuation, capitalization, spelling, and other matters of style shall, in general, conform to the most recent edition of the U.S. Government Printing Office Style Manual. (d) The spelling of...
2010-07-01
..., walking, seeing, hearing, speaking, breathing, learning, and working. (c) Has a record of such impairment... conduct interferes with an individual's performance or creates an intimidating, hostile, or offensive... group, women, or people with disabilities. Standard-setting agencies. Non-DoD Federal Agencies...
2010-07-01
.... Aquifer means an underground geological formation, group of formations, or part of a formation that is... chemical characteristics that significantly decrease the mobility of radionuclides, or a material placed... disposal system. Performance assessment means an analysis that: (1) Identifies the processes and events...
32 CFR 191.5 - Responsibilities.
2010-07-01
...-Federal organizations concerned with EEO programs, and coordinate DoD support of such organizations... prevention of sexual harassment) for civilian and military personnel who supervise civilian employees. (12) Establish EEO Awards Programs to recognize individuals and organizational units for outstanding achievement...
2010-04-01
.... CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED... merchandise while it is in the agent's custody; and (vi) The period that the contract is in effect. (2... of manufacturing or production operations performed by the agent; (iv) Total quantity and description...
Directory of Open Access Journals (Sweden)
Omar Ramos-Lopez
2016-02-01
Full Text Available Some high-carbohydrate diets may lead to obesity and multiple metabolic disorders, including hypertriglyceridemia (HTG. This lipid abnormality is considered an important risk factor for cardiovascular disease and type 2 diabetes. The sweet taste receptor TAS1R2 polymorphism (Ile191Val has been reported to be associated with carbohydrate intake. The aim of this study was to analyze the association of the TAS1R2 gene polymorphism with carbohydrate intake and HTG among the population of West Mexico. In a cross-sectional study, 441 unrelated subjects were analyzed for TAS1R2 genotypes (Ile/Ile, Ile/Val and Val/Val by an allelic discrimination assay. Biochemical tests and a three-day food record were assessed. The Val/Val genotype carriers had a higher intake of total carbohydrates, fiber and servings of cereals and vegetables than the other genotype carriers. The Val/Val genotype conferred a higher risk for HTG than the Ile/Val and Ile/Ile genotypes (OR = 3.26, 95%CI 1.35–7.86, p = 0.006 and OR = 2.61, 95%CI 1.12–6.07, p = 0.02, respectively. Furthermore, the Val/Val genotype was associated with approximately 30% higher triglycerides compared with Ile/Val and Ile/Ile genotypes (β = 44.09, 95%CI 9.94–78.25, p = 0.01 and β = 45.7, 95%CI 10.85–80.54, p = 0.01, respectively. In conclusion, the Val/Val genotype of TAS1R2 was associated with a higher carbohydrate intake and HTG.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
Tillmann, Frank-Peter; Hermsen, Derik; Hemmrich, Katrin; Woznowski, Magdalena; Rump, Lars Christian; Quack, Ivo
2015-12-08
Reduced renal function in patients with chronic kidney disease is linked to insulin resistance; and impairments in glucose homeostasis, as measured by HbA1c levels, are related to cardiovascular events. Recently, aging has been reported to affect HbA1c levels over time in non-diabetic individuals. The objective of this study was to investigate the association between renal function and aging in non-diabetic deceased-donor renal transplant recipients. A total of 191 patients were analyzed (mean age 50.6±12.2 years, dialysis vintage 6.5±3.1 years, 53.4% male patients). HbA1-c levels were measured on the day of transplantation and on follow-up. The mean follow-up time was 4.9±3.1 years. Renal transplantation resulted in an increase in eGFR of 38.6±18.9 mL/min/1.73 m2 as compared to baseline levels on dialysis and the mean eGFR on follow-up was 45.5±18.9 mL/min/1.73 m2. HbA1c levels increased significantly from the day of transplantation to the last follow-up (5.3±0.4% to 5.6±0.4%, page and renal transplant function. In conclusion, we observed a significant increase in HbA1c levels over a 5-year post-transplant follow-up period in non-diabetic deceased-donor renal transplant recipients. In contrast to the non-diabetic general population, the increase in HbA1c observed in this cohort was greater but not associated with aging.
EST Table: FS731731 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS731731 E_FL_bmmt_24I23_F_0 10/09/28 44 %/191 aa ref|XP_001869607.1| monocarboxyla...10/09/03 39 %/191 aa FBpp0160203|DmojGI10986-PA 10/08/28 low homology 10/09/10 44 %/191 aa AGAP002587-PA Pro
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
21 CFR 155.191 - Tomato concentrates.
2010-04-01
... Tomato concentrates. (a) Identity—(1) Definition. Tomato concentrates are the class of foods each of... greater in length. (c) Blemishes, such as dark brown or black particles (specks)—not more than four exceed...; place a U.S. No. 12 screen (1.68 millimeters (0.066 inch) openings) over the sink drain; transfer the...
Estrabismo sensorial: estudo de 191 casos
Oliveira,Bráulio Folco Telles de; Bigolin,Silvane; Souza,Murilo Barreto; Polati,Mariza
2006-01-01
OBJETIVO: Avaliar os prontuários dos pacientes com estrabismo sensorial em aspectos variados, como etiologia, tipo e medida do desvio, correlação do tipo do desvio com a idade de aparecimento da doença de base, e resultado cirúrgico dos casos operados. MÉTODOS: Avaliação dos prontuários médicos dos pacientes com estrabismo sensorial atendidos no Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo - USP - no setor de Motilidade Ocular Extrínseca, no período de setembro ...
19 CFR 191.22 - Substitution drawback.
2010-04-01
... the date of succession as the basis for drawback on articles manufactured or produced by the successor after the date of succession. (2) Drawback successor. A “drawback successor” is a manufacturer or... liabilities of the predecessor; or (ii) The assets and other business interests of a division, plant, or other...
19 CFR 191.32 - Substitution drawback.
2010-04-01
... succession: (i) Imported merchandise which the predecessor, before the date of succession, imported; or (ii... which the predecessor received, before the date of succession, a certificate of delivery from the person..., and liabilities of the predecessor; or (ii) The assets and other business interests of a division...
14 CFR 21.191 - Experimental certificates.
2010-01-01
... techniques, or new uses for aircraft. (b) Showing compliance with regulations. Conducting flight tests and..., sales demonstrations, and customer crew training only as provided in § 21.195. (g) Operating amateur...
49 CFR 572.191 - General description.
2010-10-01
... Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY... the SID-IIsD Side Impact Crash Test Dummy, July 1, 2008,” and, (5) Sign convention for signal outputs reference document SAE J1733 Information Report, titled “Sign Convention for Vehicle Crash Testing,” dated...
40 CFR 191.14 - Assurance requirements.
2010-07-01
... barriers to isolate the wastes from the accessible environment. Both engineered and natural barriers shall... covered by this part unless the favorable char-acter-is-tics of such places com-pen-sate for their greater...
19 CFR 191.92 - Accelerated payment.
2010-04-01
... contain: (i) Company name and address; (ii) Internal Revenue Service (IRS) number (with suffix); (iii... may itself be appealed to CBP Headquarters, Office of International Trade, Trade Policy and Programs... to CBP Headquarters may be extended for good cause, upon written request by the applicant or holder...
Publications | Page 191 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Journal articles. Papers ... Centre for Regional Studies, School of Social Sciences, Hyderabad Central University ... Poor communities rarely benefit from global emissions trading schemes, because of the high transaction costs of participation.
Bitoh, S; Fujimoto, S; Yamamoto, H
1990-03-15
Immunization of BALB/c mice with MOPC104E myeloma protein induces antiidiotypic B lymphocytes that have Id-specific enhancing activity on antibody production. The B-B cell interaction was restricted to both Igh and class II MHC. However, anti-Thy-1 and C-treated splenic B cells were maintained for more than 1 y in a mixture of Con A-stimulated splenocyte culture supernatant and synthetic medium. In applying the long term culture method, we have established a cloned B cell line named B19-1d, B19-1d cells are specific to MOPC104E or J558 cross-reactive Id and they express surface mu, lambda but no Ly-1. B19-1d do not spontaneously secrete Ig but produce them upon stimulation with bacterial LPS. The effect of B19-1d cell line on idiotypic antibody production was tested. Addition of only 10 to 100 B19-1d cells into dextran-immune B cell culture greatly enhanced the Id+ antidextran antibody responses. On the contrary, the antidextran antibody production was suppressed by the higher doses of B19-1d cells. The effective cooperation between dextran-immune B cells and B19-1d cloned B cells was restricted to class II MHC. The role of idiotypic- and antiidiotypic B-B cell interaction in immune regulation and repertoire generation was suggested.
Energy Technology Data Exchange (ETDEWEB)
Andersen, Tassie K.; Wang, Shuqiu; Castell, Martin R.; Fong, Dillon D.; Marks, Laurence D.
2018-09-01
The atomic structures of two reconstructions, (√7 × √7)R19.1° and (√13 × √13)R13.9°, on the SrTiO3 (111) surface were determined using a combination of density functional theory and scanning tunneling microscopy data and simulations. The combination of these methods allows for potential surface structures to be generated and verified in the absence of diffraction data, providing another tool for solving surface reconstructions. These reconstructions belong to the same stoichiometric, nSrTiO3 • mTiO2, structural family made up of an interconnected, single layer of edge-sharing TiO6 and TiO5[] octahedra. This family is found to include the previously-solved (2 × 2)a reconstruction as its smallest unit-cell sized member and serves as a tool for better understanding and predicting the structure of other reconstructions of arbitrary surface unit-cell size on SrTiO3 (111). This reconstruction family and the calculations of surface energies for different hypothesis structures also shed light on the structure of Schottky defects observed on these reconstructed SrTO3 (111) surfaces.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Vines, Tim; Faunce, Thomas
2011-09-01
A recent decision of the Federal Court of Australia illustrates how patent-holding pharmaceutical companies are attempting to use Australia's Freedom of Information Act 1982 (Cth) to force Australian safety, quality and efficacy regulators to disclose whether generic competitors are attempting to enter the market. In Secretary, Department of Health and Ageing v iNova Pharmaceuticals (Australia) Pty Ltd (2010) 191 FCR 573; [2010] FCA 1442 a single judge of the Federal Court overturned a decision of the Administrative Appeals Tribunal (AAT) that would have compelled the Australian Therapeutic Goods Administration (TGA) to reveal whether they were in possession of an application to register generic versions of two iNova products: imiquimod and phentermine. In its justification to the AAT for refusing to confirm or deny the existence of any application, the TGA argued that to reveal the existence of such a document would prejudice the proper administration of the National Health Act 1953 (Cth) as it could compromise the listing of a generic on the Pharmaceutical Benefits Scheme. The AAT failed to appreciate the extent to which this revelation to a competitor would have undercut 2004 amendments to the Therapeutic Goods Act 1989 (Cth) that provided penalties for evergreening tactics involving TGA notifications to drug patent-holders and 2006 amendments to the Patents Act 1990 (Cth) which protected the right of generic manufacturers to "springboard". The decision of the Federal Court is one of the first to explore the use of freedom of information legislation by patent-holders as a potential "evergreening" technique to prolong royalties by marginalising generic competition. Because of the significant amounts of money involved in ensuring rapid market entry of low-cost generic products, the issue has considerable public health significance.
1953-12-01
75. Aeronautics In 1950. Engineer 191,67 and 100. Critical review of gas turbine progress in 1950. Engineer 191, 50. Gas turbines in 1950. Engineer 191...1952) ; Trans. ASME 75,121. A critical review of gas turbine progress, 1952. Engineer 195, 124. Aeronautics in 1952. Engineer 195, 24, 55 and 91...Physical fundamentals of jet propulsion. Forsch. Gebiete Ingenieurw. B19, Forschungaheft 437, p 5. 0. Santangelo, Metodo di calcolo delle
Ruminal bacterial community changes during adaptation of goats to fresh alfalfa forage
Czech Academy of Sciences Publication Activity Database
Grilli, D. J.; Mrázek, Jakub; Fliegerová, Kateřina; Kopečný, Jan; Lama, S. P.; Cucchi, M. E. C.; Sosa, M. A.; Arenas, G. N.
2016-01-01
Roč. 191, č. 2 (2016), s. 191-195 ISSN 1871-1413 Institutional support: RVO:67985904 Keywords : bacteria * creole goats * QPCR Subject RIV: EE - Microbiology, Virology Impact factor: 1.377, year: 2016
NCBI nr-aa BLAST: CBRC-TTRU-01-1329 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-1329 ref|YP_001876264.1| cell cycle protein [Elusimicrobium minutum Pe...i191] gb|ACC98927.1| cell cycle protein [Elusimicrobium minutum Pei191] YP_001876264.1 0.004 25% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-1038 ref|YP_001876264.1| cell cycle protein [Elusimicrobium minutum Pe...i191] gb|ACC98927.1| cell cycle protein [Elusimicrobium minutum Pei191] YP_001876264.1 0.009 22% ...
19 CFR 191.166 - Destruction of merchandise.
2010-04-01
... THE TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not... drawback claimant who proposes to destroy rather than export the distilled spirits, wine, or beer shall state that fact on Customs Form 7551. (b) Action by Customs. Distilled spirits, wine, or beer returned...
44 CFR 206.191 - Duplication of benefits.
2010-10-01
... to section 408 of the Stafford Act. (iii) Small Business Administration and Farmers Home Administration disaster loans; (iv) Other Needs assistance, pursuant to section 408 of the Stafford Act or its... resources it must consider before it does so. (4) If following the delivery sequence concept would adversely...
Indian Academy of Sciences (India)
Dr.Rekha
_computing_data_reduction 'CrysAlisPro (Oxford Diffraction,2010)'. _computing_structure_solution 'SHELXS-97 (Sheldrick, 2008)'. _computing_structure_refinement 'SHELXL-97 (Sheldrick, 2008)'. _computing_molecular_graphics 'ORTEP3 (Farrugia, 1997)'. _computing_publication_material 'PLATON(Spek,2009)'.
Gender | Page 191 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
As more women participate in the workplace, inequality may be increasing, rather ... and that the lines between the private and public spheres — home and work ... comparative performance against a number of indicators and focusing on the ...
22 CFR 191.12 - Description of benefits.
2010-04-01
... taking advantage of the Act. (k) Further relief. Section 700 (50 U.S.C. App. 590) provides that a person... occupied for dwelling, business, or agricultural purpose, executed by persons who subsequently become... assignee of a life insurance policy assigned as security, other than the insurer in connection with a...
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
Lifescience Database Archive (English)
Full Text Available daptive immunity. Re F, Strominger JL. Immunobiology. 2004;209(1-2):191-8. (.png) (.svg) (.html) (.csml) Sho...toadaptive immunity. Authors Re F, Strominger JL. Publication Immunobiology. 2004;209(1-2):191-8. Pathway -
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
Lam, Jennifer; Chan, Samuel S; Conway, Flaxen D L; Stone, David
2018-03-01
OBJECTIVE To document the environmental stewardship practices (decisions and actions regarding use and disposal) of pet and human pharmaceuticals and personal care products (PPCPs) among pet-owning veterinary-care professionals (practicing veterinarians, veterinary students, and veterinary technicians and trainees) and environmental educators. DESIGN Internet-based cross-sectional survey. SAMPLE 191 pet owners (103 veterinary-care professionals and 88 environmental educators). PROCEDURES Study participants were recruited by means of a 2-part internet survey distributed to veterinary-care professional and environmental educator networks of individuals residing in Washington state, Oregon, and southern California. Survey questions addressed motivators for environmental stewardship practices (ie, decisions and actions regarding use and disposal of pet and human PPCPs). RESULTS Data were collected from 191 respondents; the response rate for individuals who self-selected to opt in was 78% (191/246). Of the 191 respondents, 42 (22%) stored pet pharmaceuticals indefinitely. The most common disposal method was the garbage (88/191 [46%]). Veterinary-care professionals counseled clients infrequently regarding environmental stewardship practices for PPCPs. Fifty-five percent (105/191) of all respondents preferred more environmentally friendly and clinically effective PPCPs. CONCLUSIONS AND CLINICAL RELEVANCE Results of the present survey emphasized the urgent need for improved educational resources to minimize environmental contamination from improper disposal of PPCPs. Environmental and economic motivations among pet owners in the veterinary-care and education professions indicate further opportunities for outreach and institutional support.
NCBI nr-aa BLAST: CBRC-MLUC-01-0516 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-0516 ref|YP_001875573.1| hypothetical protein Emin_0681 [Elusimicrobium... minutum Pei191] gb|ACC98236.1| hypothetical protein Emin_0681 [Elusimicrobium minutum Pei191] YP_001875573.1 1e-08 21% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0516 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-0516 ref|YP_001875427.1| hypothetical protein Emin_0535 [Elusimicrobium... minutum Pei191] gb|ACC98090.1| hypothetical protein Emin_0535 [Elusimicrobium minutum Pei191] YP_001875427.1 6e-07 22% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0516 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-0516 ref|YP_001875823.1| hypothetical protein Emin_0933 [Elusimicrobium... minutum Pei191] gb|ACC98486.1| hypothetical protein Emin_0933 [Elusimicrobium minutum Pei191] YP_001875823.1 5e-11 24% ...
Nucleotide binding to Na+/K+-ATPase
Czech Academy of Sciences Publication Activity Database
Kubala, Martin; Lánský, Zdeněk; Ettrich, R.; Plášek, J.; Teisinger, Jan; Amler, Evžen
2005-01-01
Roč. 272, č. S1 (2005), s. 191-191 E-ISSN 1742-4658. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Keywords : Na+/K+- ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics
Quartz and feldspar distribution in continental shelf sediments of east coast of India
Digital Repository Service at National Institute of Oceanography (India)
Rao, V.P.; VijayKumar, B
stream_size 5 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_191.pdf.txt stream_source_info Indian_J_Mar_Sci_19_191.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Functional identification of the non-specific nuclease from white spot syndrome virus
International Nuclear Information System (INIS)
Li Li; Lin Shumei; Yanga Feng
2005-01-01
The product encoded by the wsv191 gene from shrimp white spot syndrome virus (WSSV) is homologous with non-specific nucleases (NSN) of other organisms. To functionally identify the protein, the wsv191 gene was expressed in Escherichia coli as a glutathione S-transferase (GST) fusion protein with 6His-tag at C-terminal. The fusion protein (termed as rWSSV-NSN) was purified using Ni-NTA affinity chromatography under denatured conditions, renatured and characterized by three methods. The results showed that rWSSV-NSN could hydrolyze both DNA and RNA. 5'-RACE result revealed that the transcription initiation site of the wsv191 gene was located at nucleotide residue G of the predicted ATG triplet. Therefore, we concluded that the next ATG should be the genuine translation initiation codon of the wsv191 gene. Western blot analysis revealed that the molecular mass of natural WSSV-NSN was 37 kDa
Integrated Detection of Pathogens and Host Biomarkers for Wounds
2012-04-01
None None TN631B Enterococcus faecium None ZB191B Enterobacter cloacae Acinetobacter baumannii Enterobacter cloacae plasmid pEC01 These initial...Streptomyces roseosporus HERV K113 ZB191B Enterobacter cloacae Enterobacter cloacae plasmid pEC01 Escherichia coli plasmid pIGRW12 Plasmid
76 FR 72124 - Internet-Based Telecommunications Relay Service Numbering
2011-11-22
... Docket No. 10-191; FCC 11-123] Internet-Based Telecommunications Relay Service Numbering AGENCY: Federal..., the information collection associated with the Commission's Internet- Based Telecommunications Relay... Telecommunications Relay Service Numbering, CG Docket No. 03-123; WC Docket No. 05-196; WC Docket No. 10-191; FCC 11...
7 CFR 247.29 - Reports and recordkeeping.
2010-01-01
.... All records must be available during normal business hours for use in management reviews, audits... obligated, and the amount remaining unobligated. (3) FNS-191, Racial/Ethnic Group Participation. Local agencies must submit a report of racial/ethnic participation each year, using the FNS-191. (c) Is there any...
Predicting superdeformed rotational band-head spin in A ∼ 190 ...
Indian Academy of Sciences (India)
Table1 Shi2 ab3. Becker4 CBM5 SAM6 Zeng7. 191Au(b1). 187. 184.6. 1.5. 0.1185. 9.5. 9.5. 7.5. 7.5. –. 7.5. 7.5. 7.5. 191Au(b2). 398. 398.7. 8.4. 0.0928. 17.5. 17.5 17.5. 17.5. –. 17.5. 17.5 17.5. 191Au(b3). 383. 383.3. 7.4. 0.0916. 16.5. 16.5 17.5. 17.5. –. 16.5. 16.5 16.5. 190Hg(b1). 317. 316.8. 6.8. 0.0834. 12. 12. 13. 13. 12.
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
19 CFR 191.164 - Return to Customs custody.
2010-04-01
... TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform... return to Customs custody of distilled spirits, wine, or beer subject to refund of taxes under the...
29 CFR 4.191 - Complaints and compliance assistance.
2010-07-01
... part 70) and the “Privacy Act of 1974” (5 U.S.C. 552a). (b) A report of breach or violation relating... identity of its confidential sources and to prevent an unwarranted invasion of personal privacy...) Any other report of breach or violation may be in writing and addressed to the Assistant Regional...
19 CFR 191.8 - Specific manufacturing drawback ruling.
2010-04-01
...; (3) Description of the type of business in which engaged; (4) Description of the manufacturing or... that is to be exported or destroyed; (5) In the case of a business entity, the names of persons listed... drawback ruling of the manufacturer or producer; (B) The succession of a sole proprietorship, partnership...
The UV attenuation in JWST target VV 191
Holwerda, Benne
2017-08-01
We aim to map the UV-near-IR attenuation curve along many sightlines within nearby disk galaxies to resolve a large fundamental uncertainty in galaxy evolution studies: the variance in the attenuation curve within an indivual galaxy disk on linear scales relatively blue elliptical beautifully backlights the outer disk of a foreground face-on spiral galaxy.Dither strategy:We opt for a 2-point dither in the case of the F336W observations (1 orbit) and a 3pt dither strategy for the F225W observations. The 9 orbits for the F225W observations are broken into three groupings of 3 orbits in the 3 dither pattern. This is to ensure correction of cosmics and detector artifacts. Our secondary aim is an HST/JWST image with good public outreach potential and our aim is to maximize image quality for this reason as well.
47 CFR 0.191 - Functions of the Bureau.
2010-10-01
... related activities, including public safety communications (including 911, enhanced 911, and other...) Conducts studies of public safety, homeland security, national security, emergency management and... during non-business hours when the other Offices and Bureaus of the Commission are closed. Such actions...
Lifescience Database Archive (English)
Full Text Available avgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgn...qavgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkg...lyviavkgikgrlnrlpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtiv*in
191-IJBCS-Article-Dr A D V Ayansina
African Journals Online (AJOL)
RHUMSIKI
Effect of organic amendments on microbial biomass of a tropical soil treated with some ... A.D.V. AYANSINA and B.A. OSO / Int. J. Biol. Chem. Sci. 2(4): 417-424, 2008. 418 cultivation ... microorganisms and transformed to humic ... al., 1987). The application of organic manure (e.g. ..... J. Agric. Food Chem., 34: 746-749.
191-IJBCS-Article-Dr A D V Ayansina
African Journals Online (AJOL)
RHUMSIKI
Effect of organic amendments on microbial biomass of a tropical soil treated ... soils resulted in significant (P<0.05) increases in microbial biomass and ..... and Fauna Interactions in Natural and ... conventional agricultural management on soil ...
Lifescience Database Archive (English)
Full Text Available strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.063 ...sert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.063 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19....ion targeting and chromosome engineering clone MHPP142o16. 50 0.063 1 dna update 2006. 2.10 Homology vs Prot...1 CR023465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine
South Asia | Page 191 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Although economic growth has reduced poverty in much of Asia, rural and ... These pressures strain the infrastructure and fray human relations, ultimately hampering development. ... Our regional office for Asia is located in New Delhi, India.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 22, Issue 3. March 2017, pages 191-333. pp 191-192 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 193-197 Article-in-a-Box. Lise Meitner (1878–1968): A Physicist ...
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
Seven years of radionuclide laboratory at IMC – important achievements
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Kučka, Jan; Pánek, Jiří; Štěpánek, Petr
2016-01-01
Roč. 65, Suppl. 2 (2016), S191-S201 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : radionuclide * radiopharmaceutical * polymer Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S191.pdf
Nové atomizátory těkavých specií založené na dielektrickém bariérovém výboji pro AAS a AFS
Czech Academy of Sciences Publication Activity Database
Svoboda, Milan; Šindelářová, V.; Kratzer, Jan; Michels, A.; Franzke, J.; Hraníček, J.; Dědina, Jiří
2016-01-01
Roč. 14, č. 5 (2016), s. 191-191 ISSN 2336-7202. [Sjezd chemických společností /68./. 04.09.2016-07.09.2016, Praha] R&D Projects: GA ČR GA14-23532S Institutional support: RVO:68081715 Keywords : dielectric barrier discharge * atomic spectrometry * hydride generation Subject RIV: CB - Analytical Chemistry, Separation
The enigmatic wind of 55 Cygni
Czech Academy of Sciences Publication Activity Database
Haucke, M.; Kraus, Michaela; Venero, R.O.J.; Cidale, L.S.; Nickeler, Dieter Horst; Tomić, S.; Curé, M.
2013-01-01
Roč. 56, č. 1 (2013), s. 191-194 E-ISSN 1669-9521 R&D Projects: GA ČR(CZ) GAP209/11/1198 Institutional support: RVO:67985815 Keywords : line profiles * stellar wind * spectroscopic observin Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://www. astronomia argentina.org.ar/b56/2013baaa...56...191H.pdf
Broadbelt, Kevin G; Barger, Melissa A; Paterson, David S; Holm, Ingrid A; Haas, Elisabeth A; Krous, Henry F; Kinney, Hannah C; Markianos, Kyriacos; Beggs, Alan H
2009-12-01
An important subset of the sudden infant death syndrome (SIDS) is associated with multiple serotonergic (5-HT) abnormalities in regions of the medulla oblongata. The mouse ortholog of the fifth Ewing variant gene (FEV) is critical for 5-HT neuronal development. A putatively rare intronic variant [IVS2-191_190insA, here referred to as c.128-(191_192)dupA] has been reported as a SIDS-associated mutation in an African-American population. We tested this association in an independent dataset: 137 autopsied cases (78 SIDS, 59 controls) and an additional 296 control DNA samples from Coriell Cell Repositories. In addition to the c.128-(191_192)dupA variant, we observed an associated single-base deletion [c.128-(301-306)delG] in a subset of the samples. Neither of the two FEV variants showed significant association with SIDS in either the African-American subgroup or the overall cohort. Although we found a significant association of c.128-(191_192)dupA with SIDS when San Diego Hispanic SIDS cases were compared with San Diego Hispanic controls plus Mexican controls (p = 0.04), this became nonsignificant after multiple testing correction. Among Coriell controls, 33 of 99 (33%) African-American and 0 of 197 (0%) of the remaining controls carry the polymorphism (c.128-(191_192)dupA). The polymorphism seems to be a common, likely nonpathogenic, variant in the African-American population.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC409 (Link to dictyBase) - - - Contig-U14931-1 SLC409Z (Link... to Original site) - - SLC409Z 483 - - - - Show SLC409 Library SL (Link to library) Clone ID SLC409 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC409Q.Seq.d/ Representative seq. ID SLC40...9Z (Link to Original site) Representative DNA sequence >SLC409 (SLC409Q) /CSM/SL/SLC4-A/SLC409Q.Seq.d/ XXXXX... SLH501 (SLH501Q) /CSM/SL/SLH5-A/SLH501Q.Seq.d/ 858 0.0 SLF191 (SLF191Q) /CSM/SL/SLF1-D/SLF191Q.Seq.d/ 858 0.0 SLC409 (SLC4
Directory of Open Access Journals (Sweden)
Hans-Bernd Zöllner
2009-04-01
Full Text Available Review of the monograph: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ Copenhagen: NIAS Press, 2008, ISBN 978 87 7694 017 1, 191 pages Besprechung der Monographie: Donald Seekins: Burma and Japan since 1940. From ‘Co-Prosperity’ to ‘Quiet Dialogue’ Kopenhagen: NIAS Press, 2008, ISBN 978 87 7694 017 1, 191 Seiten
Czech Academy of Sciences Publication Activity Database
Čársky, Petr
2015-01-01
Roč. 191, č. 2015 (2015), s. 191-192 ISSN 1551-7616 R&D Projects: GA MŠk OC09079; GA MŠk(CZ) OC10046; GA ČR GA202/08/0631 Grant - others:COST(XE) CM0805; COST(XE) CM0601 Institutional support: RVO:61388955 Keywords : electron-scattering * calculation of cross sections * second-order perturbation theory Subject RIV: CF - Physical ; Theoretical Chemistry
Nuclear medicine technology progress report for quarter ending December 31, 1980
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
1981-05-01
A method was developed for the synthesis of terminal haloalkyl (X-R)-substituted selenium (Se)- and tellurium (Te)-long-chain fatty acids. Several iodinated Se- and Te-fatty acids have now been prepared including the iodinated analog of methyl-9-THDA, methyl-17-iodo-9-telluraheptadecanoic acid [I-(CH 2 ) 8 -Te-(CH 2 ) 7 -COOCH 3 ]. A principal goal is the preparation and biological evaluation of the 123 I-labeled fatty acids. Osmium-191 was produced for the first time in the High Flux Isotope Reactor (HFIR) and supplied to collaborators for patient studies with the /sup 191m/Ir daughter obtained from the 191 Os → /sup 191m/Ir generator system. The /sup 191m/Ir is an excellent isotope for first-pass radionuclide angiographic evaluation of ventricular ejection fraction, intracardiac shunts, and a variety of other clinical applications. The factors affecting 191 Os production are being investigated and improvements in the generator are in progress. In a new cooperative program, /sup 117m/Sn has been produced in the HFIR and supplied to investigators to investigate the mechanism of labeling of red blood cells (rbc) with /sup 117m/SnCl 2 for performing rbc volume measurements, and gated blood pool imaging studies. Labeling is efficient (70%), and the /sup 117m/Sn is strongly bound to the cells. The attractive emission properties and moderate physical half-life of /sup 117m/Sn suggest that /sup 117m/Sn-labeled rbc ejection fraction measurements could be very useful if high specific activity /sup 117m/Sn can be produced. Five production runs of 11 C-labeled amino acids were made in conjunction with the Oak Ridge Associated Universities (ORAU). These agents were evaluated for tumor localization, pancreas imaging, and brain scanning in patients and included 11 C-DL-valine, 11 C-DL-tryptophan, and 11 C-l-aminocyclobutanecarboxylic acid ( 11 C-ACBC)
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Oral pyogenic granuloma: a epidemiologic study of 191 cases
Directory of Open Access Journals (Sweden)
Thiago de Santana SANTOS
2008-01-01
Full Text Available Objectives: To evaluate the prevalence of pyogenic granuloma and compare the data obtained with those of other reports in the worldliterature. Methods: The study material was surveyed from the records of patients with diagnosis of oral pyogenic granuloma, at the Oral Pathology Laboratory of the School of Dentistry of the University of Pernambuco, in the period from January 1992 to March 2007 (15 years. The following indicators were analyzed: gender, age group, race, anatomic location, diameter of lesions and presence of symptomatology.Results: Among the 5007 records in the laboratory, 3.81% corresponded to lesions diagnosed as oral pyogenic granuloma, in which 19.9% of the patients were in the second decade of life, 40.1% were white, the gingiva was the most affected location (77.9% and lesion of smaller diameter (0.1 to 2 cm were those most observed at the initial diagnosis. Conclusion: The clinical-pathological characteristics of oral pyogenic granuloma in the studied population are similar to those of other studies in the literature
National Aeronautics and Space Administration — A Group for HIgh Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) from the Advanced Very High Resolution Radiometer (AVHRR) on...
All projects related to | Page 191 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... PRIVATE SECTOR, Economic and social development, POLICY MAKING ... RIMISP: Core Support for Rural Development Research Phase 2 ... MAKING, AFRICA SOUTH OF SAHARA, SOCIAL INEQUALITY, ASIA, Poverty alleviation.
24 CFR 200.191 - Placement of 203(k) consultant.
2010-04-01
... HUD has developed such an exam. (c) Delayed effective date of examination requirement for consultants... date to pass the comprehensive exam. Failure to pass the examination by the deadline date constitutes...
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
Investigation of level energies and B(E2) values for rotation-aligned bands in Hg isotopes
International Nuclear Information System (INIS)
Mertin, D.; Tischler, R.; Kleinrahm, A.; Kroth, R.; Huebel, H.; Guenther, C.
1978-01-01
High spin states in 191 192 193 195 197 199 Hg were investigated by observing γ-rays and conversion electrons in the compound reactions 192 194 198 Pt(α,xn) and 192 Pt ( 3 He,4n). In 197 Hg the decoupled band built on the 13/2 + state and the semi-decoupled negative-parity band are observed up to Isup(π)=41/2 + and 33/2 - , respectively. A careful investigation of 199 Hg revealed no new high spin states above the previously known levels with Isup(π)=25/2 + and 31/2 - . Half-lives were determined for the 10 + , 7 - , 8 - and 16 - states in 192 Hg, the 33/2 states in 191 193 Hg and the 25/2 - states in 191 193 195 197 Hg. The systematics of the level energies and B(E2) values for the positive parity ground and 13/2 + bands and the negative-parity semi-decoupled bands in 190-200 Hg is discussed. (Auth.)
International Nuclear Information System (INIS)
Ono, Kenshiro; Yasuda, Yuki; Sekizawa, Koshi; Takeuchi, Norimitsu; Yoshida, Toshihiko; Sudoh, Masao
2013-01-01
Potential cycling tests using 42.2 wt% and 19.1 wt% Pt/C catalysts were conducted by the RRDE technique to evaluate the changes in the electrochemical surface area (ECSA) and H 2 O 2 formation ability of the catalysts. As the typical operating conditions of a proton exchange membrane fuel cell (PEMFC), square wave potential cycling (0.7–0.9 V) was applied to the catalysts for 150,000 cycles in an O 2 -saturated 0.1 M HClO 4 electrolyte. During the potential cycling test, electrochemical measurements were carried out to characterize the ECSA, oxygen reduction reaction (ORR) activity and H 2 O 2 formation. After 150,000 potential cyclings, while the ECSA of the 42.2 wt% Pt/C dropped by 35%, the ECSA loss for the 19.1 wt% Pt/C was 55%. This result implies that the Pt content in the cathode catalyst affects the ECSA loss during the long-term PEMFC operation. Additionally, the H 2 O 2 formation ratio obviously increased with the potential cycling only in the case of the 19.1 wt% Pt/C. In order to verify the H 2 O 2 formation dependence on the ECSA, four types of catalysts, which included different Pt loading amounts (42.2, 28.1, 19.1 and 9.5 wt% Pt/C), were evaluated, and these results explained the relationship between the ECSA decay and H 2 O 2 formation increase in the durability tests
3K3A-activated protein C stimulates postischemic neuronal repair by human neural stem cells in mice
DEFF Research Database (Denmark)
Wang, Yaoming; Zhao, Zhen; Rege, Sanket V
2016-01-01
-APC (Lys191-193Ala) mutant in which three Lys residues (KKK191-193) were replaced with alanine, and/or its other mutants with reduced (>90%) anticoagulant activity, engineered to reduce APC-associated bleeding risk while retaining normal cell-signaling activity, have shown benefits in preclinical models...... of ischemic stroke, brain trauma, multiple sclerosis, amyotrophic lateral sclerosis, sepsis, ischemic and reperfusion injury of heart, kidney and liver, pulmonary, kidney and gastrointestinal inflammation, diabetes and lethal body radiation. On the basis of proof-of-concept studies and an excellent safety...
Anticipating Viral Species Jumps: Bioinformatics and Data Needs
2011-06-01
of the Defense Threat Reduction Agency (DTRA) is to safeguard America and its allies from weapons of mass destruction (chemical, biological...and colleagues are currently adding SF for dengue , hepatitis C and pox viruses by manually searching the literature; in the future they will begin...House Pvt Ltd, New Delhi, p. 191. http://books.google.com/books?id=6x2UmpU6grsC&pg=PA191&dq=%22evolutionary+driver%22&hl= en &ei=NyzmTZj0LsTr0gHy9PD3Cg& sa
International Nuclear Information System (INIS)
Krane, K.S.
1990-01-01
This grant has as its overall goal the pursuit of on-line nuclear orientation experiments for the purpose of eliciting details of nuclear structure from the decays of neutron-deficient nuclei, such as those produced by the Holifield Heavy-Ion Research Facility at Oak Ridge and extracted by the UNISOR Isotope Separator. This paper discusses: refrigerator development; the decay of 184 Au; the decay of 191 Hg to 191 Au; the decay of 189 Pt to 189 Ir; the decays of 109,111 Pd; the decay of 172 Er; and solid angle corrections
Role of histone deacetylases HDA6 and HDA19 in ABA and abiotic stress response
Chen, Li-Ting; Wu, Keqiang
2010-01-01
Our recent study revealed the involvement of the Arabidopsis histone deacetylase HDA6 in modulating ABA and salt stress responses. In this report, we further investigated the role of HDA19 in ABA and salt stress responses. The Arabidopsis HDA19 T-DNA insertion mutant, hda19-1, displayed a phenotype that was hypersensitive to ABA and salt stress. Compared with wild-type plants, the expression of ABA responsive genes, ABI1, ABI2, KAT1, KAT2 and RD29B, was decreased in hda19-1 plants when treate...
Dicty_cDB: Contig-U03504-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Name: Full=Protoheme IX farnesyltransferase, mitocho... 60 8e-16 FM992692_191( FM992692 |pid:none) Candida dubliniensi...191( CT005262 |pid:none) Leishmania major strain Friedlin... 58 1e-13 CU633876_156( CU633876 |pid:none) Podospora ans... CP000934 |pid:none) Cellvibrio japonicus Ueda107, co... 45 1e-05 (Q15N01) RecName: Full=Protoheme IX farnesyltrans...ame: Full=Protoheme IX farnesyltransferase; ... 41 0.014 AP006725_1119( AP006725 |pid:none) Klebsiella pneumoni...sflstlssts*tiswcrl*nvisdsrkensgscfigscfiwysiafhl *lfl*fqrssnhshlygik*clfsitihh*nlsktfiyhilnif own upda
Patrice Loïez
2003-01-01
Photo 01: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (centre), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva and Dr Peter Jenni, ATLAS Spokesperson. Photo 02: Mr Ansar Shamsi, Member Finance, Pakistan Atomic Energy Commission (2nd form left), visiting the ATLAS Tile Calorimeter in building 191 with, from left to right, Mr Syed Shaukat Hussain, Pakistan Mission in Geneva; Dr Peter Jenni, ATLAS Spokesperson; Dr David Jacobs and Dr Philip Bryant, Joint Pakistan-CERN Committee.
Directory of Open Access Journals (Sweden)
Bhoomika
2016-09-01
Full Text Available Aim: To assess the prevalence of antimicrobial resistance producing extended-spectrum β-lactamases (ESBL (blaTEM, blaSHV, and blaCTX-M genes in Escherichia coli isolated from chicken meat, chevon meat, raw milk, and human urine and stool samples collected from tribal districts of Chhattisgarh, viz., Jagdalpur, Dantewada, Kondagaon, and Kanker. Materials and Methods: A total of 330 samples, comprising 98 chicken meat, 82 chevon meat, 90 raw milk, and 60 human urine and stool samples, were processed for isolation of E. coli. Isolates were confirmed biochemically and further tested against commonly used antibiotics to know their resistant pattern. The resistant isolates were tested for ESBL production by phenotypic method followed by characterization with molecular method using multiplex-polymerase chain reaction technique. Results: Overall 57.87% (191/330 samples were found positive for E. coli, which include 66.32% (65/98 chicken meat, 46.34% (38/82 chevon meat, 81.11% (73/90 raw milk, and 25% (15/60 human urine and stool samples. Isolates showed the highest resistance against cefotaxime (41.36% followed by oxytetracycline (34.03%, ampicillin (29.31%, cephalexin (24.60%, cefixime (16.75%, and ceftazidime (13.08%. Phenotypic method detected 10.99% (21/191 isolates as presumptive ESBL producers, however, molecular method detected 3.66% (7/191, 2.09% (4/191, and 0.00% (0/191 prevalence of blaTEM, blaCTX-M, and blaSHV, respectively. Conclusion: The present study indicates a high prevalence of E. coli in raw chicken meat, chevon meat, and milk due to poor hygienic practices. The antibiotic susceptibility test detected the presence of the resistance pattern against ESBL in E. coli isolated from raw chicken meat, chevon meat, milk, and also in human clinical samples is of great concern. The appearance of E. coli in the human food chain is alarming and requires adaptation of hygienic practices and stipulate use of antibiotics.
Active site of Zn2+-dependent sn-glycerol-1-phosphate dehydrogenase from Aeropyrum pernix K1
Directory of Open Access Journals (Sweden)
Jin-Suk Han
2005-01-01
Full Text Available The enzyme sn-glycerol-1-phosphate dehydrogenase (Gro1PDH, EC 1.1.1.261 is key to the formation of the enantiomeric configuration of the glycerophosphate backbone (sn-glycerol-1-phosphate of archaeal ether lipids. This enzyme catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate. To date, no information about the active site and catalytic mechanism of this enzyme has been reported. Using the sequence and structural information for glycerol dehydrogenase, we constructed six mutants (D144N, D144A, D191N, H271A, H287A and D191N/H271A of Gro1PDH from Aeropyrum pernix K1 and examined their characteristics to clarify the active site of this enzyme. The enzyme was found to be a zinc-dependent metalloenzyme, containing one zinc ion for every monomer protein that was essential for activity. Site-directed mutagenesis of D144 increased the activity of the enzyme. Mutants D144N and D144A exhibited low affinity for the substrates and higher activity than the wild type, but their affinity for the zinc ion was the same as that of the wild type. Mutants D191N, H271A and H287A had a low affinity for the zinc ion and a low activity compared with the wild type. The double mutation, D191N/ H271A, had no enzyme activity and bound no zinc. From these results, it was clarified that residues D191, H271 and H287 participate in the catalytic activity of the enzyme by binding the zinc ion, and that D144 has an effect on substrate binding. The structure of the active site of Gro1PDH from A. pernix K1 seems to be similar to that of glycerol dehydrogenase, despite the differences in substrate specificity and biological role.
People and things. CERN Courier, Mar 1979, v. 19(1)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1979-03-15
The article reports on various achievements of CERN staff members and gives news updates on upcoming or past events, for example the First Workshop on Ultra-Relativistic Nuclear Collisions, or the CERN 25th Anniversary Celebrations.
191 Weaning Practices and Nutritional Status of Infants in Isoko ...
African Journals Online (AJOL)
Nekky Umera
collection. The anthropometry used was the height and weight of the infants. ... Baby feeding practices are nutritional behaviours and actions by mothers and childcare ... breastfeeding, which is commonly referred to as weaning is a time of.
191 Students' Self-Concept and Their Achievement in Basic Science ...
African Journals Online (AJOL)
User
2011-07-21
Jul 21, 2011 ... Achievement Test in Basic showed Science (SATBS) were employed as .... Higher Studies; Teacher-Students opinion and found out that students .... Factors and Pupils Leaning Outcome in Bended Primary Science Project,.
Southern Forests: a Journal of Forest Science - Vol 191 (2001)
African Journals Online (AJOL)
Valuing South Africa's savannas: methodological issues · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Ballance, CM Shackleton, SE Shackleton, B Geach, D Crookes, M De Wit, J Evans, G Von Maltitz, C Willis, S Kelatwang, J Havemann, 43-52 ...
People and things. CERN Courier, Mar 1979, v. 19(1)
International Nuclear Information System (INIS)
Anon.
1979-01-01
The article reports on various achievements of CERN staff members and gives news updates on upcoming or past events, for example the First Workshop on Ultra-Relativistic Nuclear Collisions, or the CERN 25th Anniversary Celebrations
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
Monopole conversion hidden by penetration effect in magnetic dipole transitions
International Nuclear Information System (INIS)
Bikit, I.; Anichin, I.; Marinkov, L.
1977-01-01
The 191 keV 197 Au nad 340 keV 233 U transitions are investigated and the effect of penetration into the M1-component is accounted for. Theoretical internal conversion coefficients (ICC) and electron parameters to account for the penetration effect have been obtained by interpolating the data of the Hager and Zeltzer tables. The ICC values and ratios are analyzed under the assumption that the 191 keV 197 Au transition has multipolarities M1 + E2 and E 0 +M1. A common overlapping occurs when the nuclear penetration parameter lambda for magnetic dipole transition is lambda = 34.2+-2.2. For the 340 keV 233 U transition the ICC has been found to equal αk=0.69+-0.07, and the relative conversion-line intensities have been determined. It is concluded that the 191 keV 197 Au nad 340 keV 233 U transitions involve an electric monopole component concealed by the penetration effect in the M1-conversion. The matrix elements of the E0-transition have been evaluated
Directory of Open Access Journals (Sweden)
Maharajan Athisuyambulingam
2014-07-01
Full Text Available Copper is most toxic metal in marine organisms. Characterization of protein occurring in the metabolically active tissues of muscle (MU, hepatopancreas (HP and gills (GL of the spiny lobster, Panulirus homarus homarus on exposure to two sub-lethal doses (9.55 and 19.1 µg/l of copper were studied for 28 days of exposure (DoE. The electrophoretic pattern of muscle, hepatopancreas and gill proteins revealed 12, 8 and 8 slow moving bands (control. The number of bands decreased to 8 and 7, 6 and 5, 6 and 4 after 7 days of exposure to 9.55 µg/l and 19.1 µg/l concentrations of copper, respectively. After 28 days, the protein bands decreased to 7 and 6, 5 and 4, 4 and 4 at 9.55 µg/l and 19.1 µg/l concentrations of copper, respectively. Present study to indicate that to avoid the Cupro-Nickel coil in lobster holding centers in chiller plants used for cooling of water was found to be responsible for the mortality of lobsters during live transportation.
Nuclear-medicine progress report for quarter ending March 31, 1982
Energy Technology Data Exchange (ETDEWEB)
Knapp, F.F. Jr.; Ambrose, K.R.; Butler, T.A.; Goodman, M.M.; Hoeschele, J.D.; Srivastava, P.C.
1982-08-01
The synthesis of a radioiodinated vinyl barbituric acid analog as a potential cerebral perfusion agent is reported. The /sup 125/I-labeled barbiturate will be evaluated in rats. In order to evaluate the myocardial uptake and retention of methyl-branched fatty acids, racemic 14-(p-(/sup 125/I)iodophenyl)-2-(R,S)-methyl-tetradecanoic acid and 15-(p-(/sup 125/I)iodophenyl)-3-(R,S)-methyl-pentadecanoic acid were prepared by a new route in which methyl branching was introduced by a unique oxazoline intermediate. The branched fatty acids were evaluated in rats and showed good heart uptake, but blood levels were high. Future studies will be directed at resolution of the isomers and evaluation of the R- and S-agents in rats. Eight shipments of /sup 191/Os-potassium osmate were made to Medical Cooperative investigators for preparation of the /sup 191/Os-/sup 191m/Ir generator to carry out radionuclide angiography with /sup 191m/Ir, and several shipments of /sup 195m/Pt-labeled cis-dichlorodiammineplatinum-(II) (cis-DDP) were supplied to collaborators for evaluation of its antitumor and pharmacologic properties. A variety of structurally modified /sup 125/I- and /sup 123m/Te-labeled fatty acid analogs developed in the Nuclear Medicine program were supplied to the Massachusetts General Hospital for further evaluation, including imaging studies and measurement of the myocardial extraction properties in dogs, and tin-117m was supplied to collaborators for preparation of several agents for evaluation of its potential therapeutic use for bone disease. (ERB)
Description of identical superdeformed bands of the A ∝ 190 mass region
International Nuclear Information System (INIS)
Dadwal, Anshul; Mittal, H.M.
2017-01-01
The two-parameter formula/model viz. nuclear softness (NS) formula, semiclassical particle rotor model (PRM) and exponential model with pairing attenuation are used for the reliable phenomenological analysis of identical superdeformed bands. These formulae/models are employed to study the identical superdeformed bands of the A ∝ 190 mass region, {"1"9"1Hg(2), "1"9"3Hg(2)}, {"1"9"1Hg(3), "1"9"3Hg(3)}, {"1"9"3Tl(3), "1"9"3Tl(5)}, {"1"9"3Tl(1), "1"9"4Tl(3)}, {"1"9"3Tl(1), "1"9"4Tl(4)}, {"1"9"3Pb(3), "1"9"1Hg(2)}, {"1"9"3Pb(4), "1"9"1Hg(3)}, {"1"9"4Pb(1), "1"9"2Hg(1)}, {"1"9"4Pb(1), "1"9"4Hg(1)} and middle-point identical bands {"1"9"3Tl(1), "1"9"3Tl(2)}, {"1"9"3Tl(1), "1"9"5Tl(1)} and {"1"9"3Tl(2), "1"9"5Tl(2)}. Quantitatively, good results of γ-ray transitions energies and dynamic moment of inertia are obtained using the NS formula. The parameters, band-head moment of inertia (I_0), alignment (i) and effective pairing parameter (Δ_0) are calculated using the least-squares fitting of the γ-ray transitions energies in the NS formula, semiclassical PRM and exponential model with pairing attenuation, respectively. The calculated parameters are found to depend sensitively on the proposed band-head spin. (orig.)
Ning, Nian-Zhi; Liu, Xiong; Bao, Chun-Mei; Chen, Su-Ming; Cui, En-Bo; Zhang, Ju-Ling; Huang, Jie; Chen, Fang-Hong; Li, Tao; Qu, Fen; Wang, Hui
2017-01-05
Carbapenem-resistant Acinetobacter baumannii poses a significant threat to hospitalized patients, as few therapeutic options remain. Thus, we investigated the molecular epidemiology and mechanism of resistance of carbapenem-resistant A.baumannii isolates in Beijing, China. Carbapenem-resistant A.baumannii isolates (n = 101) obtained between June 2009 and November 2014 were used. Multilocus sequence typing (MLST) and PCR assays for class C and D β-lactamase were performed on all isolates. S1 nuclease pulsed-field gel electrophoresis (PFGE) and Southern blot hybridization were performed to identify the resistance gene location. All 101 A.baumannii isolates were highly resistant to frequently used antimicrobials, and were considered multidrug resistant. A total of 12 sequence types (STs) were identified, including 10 reported STs and 2 novel STs. Eighty-seven isolates were classified to clonal complex 92 (CC92), among which ST191 and ST195 were the most common STs. The bla OXA-23 gene was positive in most (n = 95) of the A.baumannii isolates. Using S1-nuclease digestion PFGE and Southern blot hybridization, 3 patterns of plasmids carrying bla OXA-23 were confirmed. ST191 and ST195 (both harboring bla OXA-23 ) caused outbreaks during the study period, and this is the first report of outbreaks caused by ST191 and ST195 in north China. bla OXA-23 -producing A.baumannii ST191 and ST 195 isolates can disseminate in a hospital and are potential nosocomial outbreak strains. Surveillance of imipenem-resistant A.baumannii and antimicrobial stewardship should be strengthened.
Affinity for a malignant tumor and organs at the elements in group VIII of the periodic table
International Nuclear Information System (INIS)
Ando, Atsushi; Hisada, Kinichi; Ando, Itsuko.
1975-01-01
In order to investigate the tumor affinity of the radioisotopes, iron(Fe-59), cobalt(Co-58), ruthenium(Ru-103), palladium(Pd-103), osmium(Os-185+191) and iridium(Ir-192), the elements of group VIII in the periodic table were examined, using rats which were subcutaneously transplanted with Yoshida sarcoma. Six preparations, 59 Fe-chloride, 58 Co-chloride, 103 Ru-chloride, 103 Pd-chloride, 185+191 Os-hexachlorosmic acid and 192 Ir-hexachloriridic acid were injected intravenously in to each group of tumor bearing rats. These rats were sacrificed at various periods after injection of each preparation: 3 hours, 24 hours and 48 hours in all preparations, except 59 Fe-chloride with 30 minutes, 3 hours, 24 hours and 48 hours. The radioactivities of the tumor, blood muscle, liver, kidney and spleen were measured by a well-type scintillation counter, and retention values (in every tissue including the tumor were calculated in percent of administered dose per g-tissue weight). 185+191 Os-hexachlorosmic acid had a considerably strong affinity for the malignant tumor. 59 Fe-chloride, 58 Co-chloride, 103 Ru-chloride, 103 Pd-chloride and 192 Ir-hexachloriridic acid did not have any affinity for the malignant tumor. However 59 Fe-chloride had a very strong affinity for blood corpuscles. 103 Pd-chloride had a fairly strong affinity for the kidney and liver, 58 Co-chloride had a fairly affinity for the liver, 103 Ru-chloride, 185+191 Os-hexachlorosmic acid and 192 Ir-hexachloriridic acid had a fairly strong affinity for the kidney. (Evans, J.)
Description of identical superdeformed bands of the A ∝ 190 mass region
Energy Technology Data Exchange (ETDEWEB)
Dadwal, Anshul; Mittal, H.M. [Dr. B.R. Ambedkar National Institute of Technology, Jalandhar (India)
2017-06-15
The two-parameter formula/model viz. nuclear softness (NS) formula, semiclassical particle rotor model (PRM) and exponential model with pairing attenuation are used for the reliable phenomenological analysis of identical superdeformed bands. These formulae/models are employed to study the identical superdeformed bands of the A ∝ 190 mass region, {"1"9"1Hg(2), "1"9"3Hg(2)}, {"1"9"1Hg(3), "1"9"3Hg(3)}, {"1"9"3Tl(3), "1"9"3Tl(5)}, {"1"9"3Tl(1), "1"9"4Tl(3)}, {"1"9"3Tl(1), "1"9"4Tl(4)}, {"1"9"3Pb(3), "1"9"1Hg(2)}, {"1"9"3Pb(4), "1"9"1Hg(3)}, {"1"9"4Pb(1), "1"9"2Hg(1)}, {"1"9"4Pb(1), "1"9"4Hg(1)} and middle-point identical bands {"1"9"3Tl(1), "1"9"3Tl(2)}, {"1"9"3Tl(1), "1"9"5Tl(1)} and {"1"9"3Tl(2), "1"9"5Tl(2)}. Quantitatively, good results of γ-ray transitions energies and dynamic moment of inertia are obtained using the NS formula. The parameters, band-head moment of inertia (I{sub 0}), alignment (i) and effective pairing parameter (Δ{sub 0}) are calculated using the least-squares fitting of the γ-ray transitions energies in the NS formula, semiclassical PRM and exponential model with pairing attenuation, respectively. The calculated parameters are found to depend sensitively on the proposed band-head spin. (orig.)
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bacteroides thetaiotaomicron VPI-5482] ... Length = 48 ... Query: 191 TSECIGCKRCEKSCPVGNITM...KERRPVWGKNCTACLACYHVCPQHAVQ 238 ... TSECIGCKRCEKSCPVGNITMKERRPVWGKNCTACLACYHVCPQHAVQ Sbjct: 1 ... TSECIGCKRCEKSCPVGNITMKERRPVWGKNCTACLACYHVCPQHAVQ 48
ORF Alignment: NC_005363 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bdellovibrio bacteriovorus HD100] ... Length = 112 ... Query: 191 SERAHVTXXXXXXXXGKNSEAETAYQSILAR...WPQSLAAYVGLGNIHYSRKQYSLAINNLQ 250 ... SERAHVT ... GKNSEAETAYQSILARWP...QSLAAYVGLGNIHYSRKQYSLAINNLQ Sbjct: 1 ... SERAHVTAAAALEALGKNSEAETAYQSILARWPQSLAAYVGLGNIHYSRKQYSLAINNLQ 60 ...
Five-year longitudinal assessment of the prognosis of apical microsurgery.
von Arx, Thomas; Jensen, Simon S; Hänni, Stefan; Friedman, Shimon
2012-05-01
Apical surgery is an important treatment option for teeth with post-treatment apical periodontitis. Knowledge of the long-term prognosis is necessary when weighing apical surgery against alternative treatments. This study assessed the 5-year outcome of apical surgery and its predictors in a cohort for which the 1-year outcome was previously reported. Apical microsurgery procedures were uniformly performed using SuperEBA (Staident International, Staines, UK) or mineral trioxide aggregate (MTA) (ProRoot MTA; Dentsply Tulsa Dental Specialties, Tulsa, OK) root-end fillings or alternatively Retroplast capping (Retroplast Trading, Rorvig, Denmark). Subjects examined at 1 year (n = 191) were invited for the 5-year clinical and radiographic examination. Based on blinded, independent assessment by 3 calibrated examiners, the dichotomous outcome (healed or nonhealed) was determined and associated with patient-, tooth-, and treatment-related variables using logistic regression. At the 5-year follow-up, 9 of 191 teeth were unavailable, 12 of 191 teeth were extracted, and 170 of 191 teeth were examined (87.6% recall rate). A total of 129 of 170 teeth were healed (75.9%) compared with 83.8% at 1 year, and 85.3% were asymptomatic. Two significant outcome predictors were identified: the mesial-distal bone level at ≤ 3 mm versus >3 mm from the cementoenamel junction (78.2% vs 52.9% healed, respectively; odds ratio = 5.10; confidence interval, 1.67-16.21; P apical microsurgery was 8% poorer than assessed at 1 year. It also suggested that the prognosis was significantly impacted by the interproximal bone levels at the treated tooth and by the type of root-end filling material used. Copyright © 2012 American Association of Endodontists. All rights reserved.
Nuclear medicine. Progress report for quarter ending June 30, 1982
Energy Technology Data Exchange (ETDEWEB)
Knapp, F.F. Jr.; Ambrose, K.R.; Butler, T.A.; Goodman, M.M.; Hoeschele, J.D.; Srivastava, P.C.
1982-09-01
The oxidation products of tellurium and selenium fatty acids were shown to differ and may relate to the unique prolonged retention of tellurium fatty acids in the heart. The studies suggest that the trapping of tellurium fatty acids in the heart may result from the formation of an insoluble oxidation product after entry into the cells of the heart muscle. Also described in this report is the synthesis of several barbituric acid analogues for evaluation as potential cerebral perfusion agents. The present studies indicate that the iodovinyl-alkyl barbiturates cross the intact blood-brain barrier but undergo in vivo deiodination as measured by a high uptake of radioiodine in the thyroid. During this period four /sup 191/Os-osmate shipments were made to Medical Cooperative investigators for evaluation of the ultrashort-lived /sup 191//sup m/Ir (T/sub 1/2/ = 4.9 sec) obtained from the /sup 191//sup m/Ir generator. Seven shipments of the /sup 195//sup m/Pt-labeled cis-dichlorodiammineplatinum(II) antitumor drug were made to collaborators and fice shipments of radiolabeled tellurium fatty acids were made to the Massachusetts General Hospital.
International Nuclear Information System (INIS)
Adams, R.; Mena, I.
1988-01-01
An algorithm and two fortrAN programs have been developed to evaluate the count rate performance of scintillation cameras from count rates reduced exponentially, either by a decaying source or by filtration. The first method is used with short-lived radionuclides such as 191 /sup m/Ir or 191 /sup m/Au. The second implements a National Electrical Manufacturers' Association (NEMA) protocol in which the count rate from a source of 191 /sup m/Tc is attenuated by a varying number of copper filters stacked over it. The count rate at each data point is corrected for deadtime loss after assigning an arbitrary deadtime (tau). A second-order polynomial equation is fitted to the logarithms of net count rate values: ln(R) = A+BT+CT 2 where R is the net corrected count rate (cps), and T is the elapsed time (or the filter thickness in the NEMA method). Depending on C, tau is incremented or decremented iteratively, and the count rate corrections and curve fittings are repeated until C approaches zero, indicating a correct value of the deadtime (tau). The program then plots the measured count rate versus the corrected count rate values
Rauch, T.; Quinet, P.; Knörzer, M.; Hoyer, D.; Werner, K.; Kruk, J. W.; Demleitner, M.
2017-10-01
Context. To analyze spectra of hot stars, advanced non-local thermodynamic equilibrium (NLTE) model-atmosphere techniques are mandatory. Reliable atomic data is crucial for the calculation of such model atmospheres. Aims: We aim to calculate new Sr iv-vii oscillator strengths to identify for the first time Sr spectral lines in hot white dwarf (WD) stars and to determine the photospheric Sr abundances. To measure the abundances of Se, Te, and I in hot WDs, we aim to compute new Se v, Te vi, and I vi oscillator strengths. Methods: To consider radiative and collisional bound-bound transitions of Se v, Sr iv - vii, Te vi, and I vi in our NLTE atmosphere models, we calculated oscillator strengths for these ions. Results: We newly identified four Se v, 23 Sr v, 1 Te vi, and three I vi lines in the ultraviolet (UV) spectrum of RE 0503-289. We measured a photospheric Sr abundance of 6.5+ 3.8-2.4× 10-4 (mass fraction, 9500-23 800 times solar). We determined the abundances of Se (1.6+ 0.9-0.6× 10-3, 8000-20 000), Te (2.5+ 1.5-0.9× 10-4, 11 000-28 000), and I (1.4+ 0.8-0.5× 10-5, 2700-6700). No Se, Sr, Te, and I line was found in the UV spectra of G191-B2B and we could determine only upper abundance limits of approximately 100 times solar. Conclusions: All identified Se v, Sr v, Te vi, and I vi lines in the UV spectrum of RE 0503-289 were simultaneously well reproduced with our newly calculated oscillator strengths. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26666. Based on observations made with the NASA-CNES-CSA Far Ultraviolet Spectroscopic Explorer. Full Tables A.15 to A.21 are only available via the German Astrophysical Virtual Observatory (GAVO) service TOSS (http://dc.g-vo.org/TOSS).
Directory of Open Access Journals (Sweden)
Nilson Giraldi
2001-01-01
Full Text Available Coproparasitological analyses were performed on 191 daycare children and 434 elementary school children from urban and rural areas in Rolândia, Parana State, Brazil. The overall prevalence of enteroparasites was 15.2 % for daycare children and 52.5% for elementary school children. Risk factors are discussed.Exames coproparasitológicos realizados em 191 crianças de creches e em 434 alunos da primeira à quarta série das áreas urbana e rural da rede municipal de Rolândia, PR, evidenciaram enteroparasitas em prevalência de 15,2% nas creches e de 52,5% entre os escolares. Fatores de risco são discutidos.
Three-Dimensional Material Properties of Composites with S2-Glass Fibers or Ductile Hybrid Fabric
2013-01-13
5 Figure ence of mat n PU Renca s of 2.81 cm s of 2.54 cm shows all n hat materia ar strength 0.8 0.9 1 1.1 1.2 N or m al iz ed St re ng th R es...and 1.91 .). ormalized l thickness d modulus for 3.81 c Value = 3.27 @ Value = 2.91 @ Materia m retrieved not a criti -of-plane st ied the out...h of Materia rocedure is gth (SC-15 ested at 21 strengths of results of M r to the resu terial 5, and tiffness resu low for an 1.91 cm y Sxy SCx
DEFF Research Database (Denmark)
Jensen, Ole Michael
Med denne rapport foreligger en evaluering af det såkaldte SEIH-projekt: Smart Energi i Hjemmet. Projektet er gennemført i samarbejde med 191 husejere i Middelfart Kommune med formål at afsøge mulighederne for at opnå energibesparelser i enfamiliehuse ved at bruge automatik til at sænke temperatu......Med denne rapport foreligger en evaluering af det såkaldte SEIH-projekt: Smart Energi i Hjemmet. Projektet er gennemført i samarbejde med 191 husejere i Middelfart Kommune med formål at afsøge mulighederne for at opnå energibesparelser i enfamiliehuse ved at bruge automatik til at sænke...
19 CFR Appendix A to Part 191 - General Manufacturing Drawback Rulings
2010-04-01
... The date of production is the date an article is completed. I. Inventory Procedures The inventory... 19 U.S.C. 1313(a) for Fur Skins or Fur Skin Articles (T.D. 83-77) VIII. General Manufacturing... operate; 6. Description of the merchandise and articles, unless specifically described in the general...
Asie du sud | Page 191 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Based on a survey of more than 400 women, this book exposes the ... recognize community property, the nature of productive work, and the right to recover dowries ... by IDRC, created an innovative research capacity-building program, SIRCA.
40 CFR Appendix A to Part 191 - Table for Subpart B
2010-07-01
... the definition of high-level waste in the NWPA); (d) Each 1,000,000 curies of other radionuclides (i.e... Commission as high-level radioactive waste in accordance with part B of the definition of high-level waste in... PROGRAMS ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR MANAGEMENT AND DISPOSAL OF SPENT NUCLEAR FUEL...
191 bacterial agents of otitis media and their sensitivity to some ...
African Journals Online (AJOL)
DR. AMINU
2010-06-01
Shamsuddeen, U., Usman A. D., Bukar, ... Key Words: Bacterial agents, otitis media, sensitivity, antibiotics, AKTH. INTRODUCTION. Otitis media is an .... Atlas R.M (1998) Microbiology Fundamentals and. Applications. Second edition ...
: tous les projets | Page 191 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
La pleuropneumonie contagieuse des bovins est une maladie d'origine bactérienne qui a de graves conséquences sur l'économie et le commerce en Afrique subsaharienne. Date de début : 1 mars 2012. End Date: 31 octobre 2014. Sujet: AFRICA SOUTH OF SAHARA, BIOTECHNOLOGY, AGRICULTURAL INNOVATIONS ...
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
Effect of atomic layer deposited Al2O3:ZnO alloys on thin-film silicon photovoltaic devices
Abdul Hadi, Sabina; Dushaq, Ghada; Nayfeh, Ammar
2017-12-01
In this work, we present the effects of the Al2O3:ZnO ratio on the optical and electrical properties of aluminum doped ZnO (AZO) layers deposited by atomic layer deposition, along with AZO application as the anti-reflective coating (ARC) layer and in heterojunction configurations. Here, we report complex refractive indices for AZO layers with different numbers of aluminum atomic cycles (ZnO:Al2O3 = 1:0, 39:1, 19:1, and 9:1) and we confirm their validity by fitting models to experimental data. Furthermore, the most conductive layer (ZnO:Al2O3 = 19:1, conductivity ˜4.6 mΩ cm) is used to fabricate AZO/n+/p-Si thin film solar cells and AZO/p-Si heterojunction devices. The impact of the AZO layer on the photovoltaic properties of these devices is studied by different characterization techniques, resulting in the extraction of recombination and energy band parameters related to the AZO layer. Our results confirm that AZO 19:1 can be used as a low cost and effective conductive ARC layer for solar cells. However, AZO/p-Si heterojunctions suffer from an insufficient depletion region width (˜100 nm) and recombination at the interface states, with an estimated potential barrier of ˜0.6-0.62 eV. The work function of AZO (ZnO:Al2O3 = 19:1) is estimated to be in the range between 4.36 and 4.57 eV. These material properties limit the use of AZO as an emitter in Si solar cells. However, the results imply that AZO based heterojunctions could have applications as low-cost photodetectors or photodiodes, operating under relatively low reverse bias.
Problems Related to Use of Some Terms in System Reliability Analysis
Directory of Open Access Journals (Sweden)
Nadezda Hanusova
2004-01-01
Full Text Available The paper deals with problems of using dependability terms, defined in actual standard STN IEC 50 (191: International electrotechnical dictionary, chap. 191: Dependability and quality of service (1993, in a technical systems dependability analysis. The goal of the paper is to find a relation between terms introduced in the mentioned standard and used in the technical systems dependability analysis and rules and practices used in a system analysis of the system theory. Description of a part of the system life cycle related to reliability is used as a starting point. The part of a system life cycle is described by the state diagram and reliability relevant therms are assigned.
The Hg region: Superdeformation and other shapes
International Nuclear Information System (INIS)
Janssens, R.V.F.; Carpenter, M.P.; Fernandez, P.B.; Moore, E.F.; Ahmad, I.; Khoo, T.L.; Wolfs, F.L.H.; Drigert, M.W.; Ye, D.; Beard, K.B.; Reviol, W.; Bearden, I.; Benet, P.; Daly, P.J.; Grabowski, Z.W.
1990-01-01
We shall first summarize the present experimental situation concerning 192 Hg, the nucleus regarded as the analog of 152 Dy 8 for this SD region in that shell gaps are calculated 5 to occur at large deformation for Z=80 and N=112. Proton and neutron excitations out of te 192 Hg core will then be reviewed with particular emphasis on 191 Hg and 193 Tl. The implications of the results for pairing at large deformations and the need to consider other degrees of freedom (such as octupole correlations) will be addressed. The presentation will conclude with a brief discussion on other shapes seen in this region, with a particular emphasis on 191 Hg
Diagnosis of gastroesophageal reflux in adult patients by radiology and isotope-imaging techniques
International Nuclear Information System (INIS)
Trigo, J.E.; Gutierrez Amares, M.T.; Bascuas, A.; Bueno Becerra, A.; Sousa, R.; Conde, M.A.; Bascuas, J.L.
1987-01-01
A comparative radiological and nuclear medicine in 191 adult patients, with a clinical diagnosis of gastroesophageal reflex, emphatizing the radiological role in diagnosis of gastroesophageal reflex. (author)
Zhang, Yanping; Wang, Ju; Li, Lina; Sun, Yurui; Feng, Bo
2010-07-01
The three most common GJB2 mutations found in the Chinese populations, c.235delC, c.299-300delAT, and c.176-191de1 (16) bp, cannot form gap junctons (GJs) in the plasma membrane. These mutant proteins were retained in the endoplasmic reticulum (ER), suggesting that ER stress (ERS) and subsequent ERS-induced cell death may be responsible for hearing loss caused by these GJB2 truncation mutations. The objective of this study was to investigate the subcellular location of the protein products of three GJB2 mutants (c.235de1C, c.299-300delAT, and c.176-191de1 (16) bp) and to explore the deafness mechanism caused by these GJB2 truncation mutations. Mutant-eGFP fusion protein vectors were constructed by PCR and TA cloning. HEK293 cells were transfected by a liposome-mediated method. Transfected cells were incubated with ER-Tracker and observed under a confocal microscope. Cells transfected with wild type gave characteristic punctuate patterns of GJs in the cell membrane. In contrast, c.235de1C, c.299-300delAT, and c.176-191de1 (16) bp mutant proteins were found to be trapped in the ER, and were therefore unable to form GJs in the plasma membrane.
Detoxification of Sap from Felled Oil Palm Trunks for the Efficient Production of Lactic Acid.
Kunasundari, Balakrishnan; Arai, Takamitsu; Sudesh, Kumar; Hashim, Rokiah; Sulaiman, Othman; Stalin, Natra Joseph; Kosugi, Akihiko
2017-09-01
The availability of fermentable sugars in high concentrations in the sap of felled oil palm trunks and the thermophilic nature of the recently isolated Bacillus coagulans strain 191 were exploited for lactic acid production under non-sterile conditions. Screening indicated that strain 191 was active toward most sugars including sucrose, which is a major component of sap. Strain 191 catalyzed a moderate conversion of sap sugars to lactic acid (53%) with a productivity of 1.56 g/L/h. Pretreatment of oil palm sap (OPS) using alkaline precipitation improved the sugar fermentability, providing a lactic acid yield of 92% and productivity of 2.64 g/L/h. To better characterize potential inhibitors in the sap, phenolic, organic, and mineral compounds were analyzed using non-treated sap and saps treated with activated charcoal and alkaline precipitation. Phthalic acid, 3,4-dimethoxybenzoic acid, aconitic acid, syringic acid, and ferulic acid were reduced in the sap after treatment. High concentrations of Mg, P, K, and Ca were also precipitated by the alkaline treatment. These results suggest that elimination of excess phenolic and mineral compounds in OPS can improve the fermentation yield. OPS, a non-food resource that is readily available in bulk quantities from plantation sites, is a promising source for lactic acid production.
Mutation analysis of GJB2 gene and prenatal diagnosis in a non-syndromic deafness family
Directory of Open Access Journals (Sweden)
Xiao-hua CHEN
2014-08-01
Full Text Available Objective To identify the pathogenic gene in a non-syndromic deafness family, provide an accurate genetic consultation and early intervention for deaf family to reduce the incidence of congenital deafness. Methods Mutation analysis was carried out by polymerase chain reaction followed by DNA sequencing of coding region of GJB2 gene. The fetal DNA was extracted from the amniotic fluid cells by amniocentesis at 20 weeks during pregnancy. The genotype of the fetus was characterized for predicting the status of hearing. Results Complex heterozygous mutations 235delC and 176-191del16bp were detected in the proband of the family, heterozygous mutation 176-191del16bp was detected in the father, and 235delC was detected in the mother. Fetus carried 235delC heterozygous mutation inherited from his mother. Conclusions The proband's hearing loss is resulted from the complex heterozygous mutations 235delC and 176-191del16bp in GJB2 gene. Fetus is a heterozygous mutation 235delC carrier. Prenatal diagnosis for deafness assisted by genetic test can provide efficient guidance about offspring's hearing condition, and prevent another deaf-mute member from birth. DOI: 10.11855/j.issn.0577-7402.2014.07.09
Doktoritöö eesti värvinimetustest / Lembit Vaba
Vaba, Lembit
2001-01-01
Rets.: Oja, Vilja. Linguistic studies of Estonian colour terminology. Tartu : Tartu University Press, 2001. 191, [1] lk. : ill. (Dissertationes philologiae estonicae Universitatis Tartuensis. 1406-1325 ; 9). ISBN 9985565827
75 FR 71079 - Site Renumbering Notice; Foreign-Trade Zone 29-Louisville, KY
2010-11-22
... Interstate 65, Shepherdsville, Bullitt County; Site 7 (191 acres)--Henderson County Riverport Authority... Park, 376 Zappos Blvd., Shepherdsville, Bullitt County [formerly part of Site 6]; and, Site 13 (6 acres...
Energy Technology Data Exchange (ETDEWEB)
Lee, Seung Chan; Park, Jong Woon; Lee, Guen Sung [KOREA HYDRO and NUCLEAR POWER Co., Daejeon (Korea, Republic of)
2007-10-15
As a part of USNRC GSI-191, evaluation of Kori Unit 1 ECCS recirculation sump performance has been carried out in 2006. The work is derived from the result of first PSR(Periodic Safety Review) of Kori Unit1. In this work, we have considered the replacement of spray additive in containment building to solve issues of GSI-191 and GL2004-02. We estimated the chemical effect of changing NaOH into TSP(Trisodium Phosphate) based on SRP(Standard Review Plan) 6.5.2. Rev.02. WCAP-16530 methodology is used to compare chemical effects of spray additive(or buffering agents). In the other side, chemical thermodynamic simulation can be utilized. Herein, the results using WCAP-16530 methodology and chemical simulation are presented.
COMPONENTES QUÍMICOS DEL DURAMEN DE Andira inermis (W. Wright DC. (Leguminosae
Directory of Open Access Journals (Sweden)
C. Téllez-Sánchez
2010-01-01
Full Text Available Se realizó un análisis químico del duramen de Andira inermis para determinar los principales componentes químicos. Los resultados encontrados fueron: pH de 5.9, 0.71 % de sustancias inorgánicas, 19.1 % de sustancias extraíbles, 34.2 % de lignina y 65.78 % de polisacáridos. En las cenizas se detectó la presencia de calcio, magnesio, azufre y silicio. Las sustancias fueron obtenidas mediante extracción sucesiva con ciclohexano, cloroformo, acetona y metanol en equipo Soxhlet y finalmente con agua caliente bajo reflujo. La solubilidad del duramen fue mayor en acetona (8.6 % y en metanol (5.3 %; el contenido total de sustancias extraíbles fue de 19.1 %.
Dolomitization in the diagenetic history of the Štramberg limestones
Czech Academy of Sciences Publication Activity Database
Lintnerová, O.; Knietl, M.; Reháková, D.; Skupien, P.; Vašíček, Zdeněk
2008-01-01
Roč. 34, 3/1 (2008), s. 191-192 ISSN 0138-0974 Institutional research plan: CEZ:AV0Z30860518 Keywords : Štramberk Limestone * dolomitization * dedolomitization Subject RIV: DB - Geology ; Mineralogy
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 1320 ... Home; Far East Asia .... TAX INCENTIVES ECONOMIES IN TRANSITION RESEARCH AND ... Towards effective policies for innovation financing in Asia : ... women entrepreneurship in MENA countries : across country ...
75 FR 80515 - National Boating Safety Advisory Council
2010-12-22
... Advisory Council (NBSAC) and its subcommittees will meet on January 14-16, 2011, in Orlando, Florida. NBSAC... Suites Orlando--Downtown, 191 East Pine Street, Orlando, FL 32801. Please send written material, comments...
National Research Council Canada - National Science Library
Conley, Verena Andermatt
1993-01-01
.... Katherine Hayles 11. The Leap and the Lapse: Hacking a Private Site in Cyberspace Alberto Moreiras 12. Telefigures and Cyberspace Patrick Clancy 173 191 207 Works Cited 233 Contributors 241 Index 24...
A Seismic Analysis for Reflective Metal Insulation
Energy Technology Data Exchange (ETDEWEB)
Kim, Kyuhyung; Kim, Taesoon [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
U.S. NRC (Nuclear Regulatory Commission) GSI- 191 (Generic Safety Issue-191) is concerned about the head-loss of emergency core cooling pumps caused by calcium silicate insulation debris accumulated on a sump screen when a loss of coolant accident (LOCA). In order to cope with the concern, many nuclear plants in U. S. have been replacing calcium silicate insulation in containment building with reflective metal insulation (RMI). In Korea, RMI has been used for only reactor vessels recently constructed, but the RMI was imported. Therefore, we have been developing the domestic design of RMI to supply to nuclear power plants under operation and construction in relation to the GSI-191. This paper covers that the structural integrity of the RMI assembly was evaluated under SSE (safety shutdown earthquake) load. An analysis model was built for the seismic test system of a reflective metal insulation assembly and pre-stress, modal, and spectrum analysis for the model were performed using a commercial structural analysis code, ANSYS. According to the results of the analyses, the buckles fastening the RMIs showed the structural integrity under the required response spectrum containing the safety shutdown earthquake loads applied to main components in containment building. Consequently, since the RMI isn't disassembled under the SSE load, the RMI is judged not to affect safety related components.
Thiam, Mahamadou; Ourèye SY, Mame
2013-01-01
Cowpea (Vigna unguiculata (L.) Walp.) is one of the most important grain legumes in sub-Saharian regions. It contributes to man food security by providing a protein-rich diet. However, its production is limited by abiotic stresses such as salinity. This study aims to evaluate the salt tolerance of 15 cowpea cultivars, at germination stage. The seed germination process consisted of sowing them in agarified water (8 g·L−1) supplemented with 6 different concentrations of NaCl (0, 10, 50, 100, 150, and 200 mM). Results highlighted that high salt concentrations drastically reduced germination and significantly delayed the process for all varieties. A cowpea varietal effect towards the salt tolerance was noticed. Genotypes Diongoma, 58-78, and 58-191 were more salt-tolerant cultivars while Mougne and Yacine were more salt-sensitive ones as confirmed in the three groups of the dendrogram. NaCl effects on the early vegetative growth of seedlings were assessed with a tolerant (58-191) and a susceptible (Yacine) cultivar. Morphological (length and dry biomass) and physiological (chlorophyll and proline contents) parameter measurements revealed a negative effect of high (NaCl). However, 58-191 was much more salt tolerant, and the chlorophyll and proline contents were higher than those of Yacine genotype at increasing salt concentrations. PMID:25937976
Directory of Open Access Journals (Sweden)
Nooshin Ghodsian
2016-01-01
Full Text Available Background. Atrial natriuretic peptide (ANP considerably influences blood pressure regulation through water and sodium homoeostasis. Several of the studies have utilized anonymous genetic polymorphic markers and made inconsequent claims about the ANP relevant disorders. Thus, we screened Insertion/Deletion (ID and G191A polymorphisms of ANP to discover sequence variations with potential functional significance and to specify the linkage disequilibrium pattern between polymorphisms. The relationships of detected polymorphisms with EH with or without Type 2 Diabetes Mellitus (T2DM status were tested subsequently. Method. ANP gene polymorphisms (I/D and A191G were specified utilizing mutagenically separated Polymerase Chain Reaction (PCR in 320 subjects including 163 EH case subjects and 157 controls. Result. This case-control study discovered a significant association between I/D polymorphisms of ANP gene in EH patient without T2DM. However, the study determined no association between G191A polymorphisms of ANP in EH with or without T2DM. In addition, sociodemographic factors in the case and healthy subjects exhibited strong differences (P<0.05. Conclusion. As a risk factor, ANP gene polymorphisms may affect hypertension. Despite the small sample size in this study, it is the first research assessing the ANP gene polymorphisms in both EH and T2DM patients among Malaysian population.
Preparation of Silver Immobilised TiO2-Hectorite for Phenol Removal and Eschericia coli Desinfection
Directory of Open Access Journals (Sweden)
Is Fatimah
2013-03-01
Full Text Available Preparation of silver immobilized TiO2-Hectorite and its application in phenol photooxidation and Eschericia coli bacteria desinfection has been conducted. Material was obtained by two steps of synthesis: preparation of TiO2-Hectorite and silver immobilization into TiO2-Hectorite. Physico-chemical characterization to the prepared material compared to raw hectorite was conducted by X-ray Diffraction, gas sorption analyzer, scanning electron microscope and DRUV-Visible spectrophotometry and for photoactivity study, phenol photooxidation and Eschericia coli desinfection were investigated. The results indicated that the modification to hectorite material improve the physico-chemical character related to its role as photo-catalyst. Kinetic study of phenol photooxidation revealed the role of TiO2 pillarization and silver immobilization in enhancing rate of reaction as well as increased photoactivity of the materials in E. coli desinfection. © 2013 BCREC UNDIP. All rights reservedReceived: 28th September 2012; Revised: 7th December 2012; Accepted: 20th Decemberber 2012[How to Cite: I. Fatimah (2013. Preparation of Silver Immobilised TiO2-Hectorite for Phenol Removal and Eschericia coli Desinfection. Bulletin of Chemical Reaction Engineering & Catalysis, 7 (3: 191-197. (doi:10.9767/bcrec.7.3.4047.191-197][Permalink/DOI: http://dx.doi.org/10.9767/bcrec.7.3.4047.191-197 ] View in |
Preliminary performance assessment for the Waste Isolation Pilot Plant, December 1992
International Nuclear Information System (INIS)
1993-08-01
Before disposing of transuranic radioactive waste in the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with applicable long-term regulations of the United States Environmental Protection Agency (EPA). Sandia National Laboratories is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for a final compliance evaluation. This volume of the 1992 PA contains results of uncertainty and sensitivity analyses with respect to the EPA's Environmental Protection Standards for Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191, Subpart B). Additional information about the 1992 PA is provided in other volumes. Results of the 1992 uncertainty and sensitivity analyses indicate that, conditional on the modeling assumptions, the choice of parameters selected for sampling, and the assigned parameter-value distributions, the most important parameters for which uncertainty has the potential to affect compliance with 40 CFR 191B are: drilling intensity, intrusion borehole permeability, halite and anhydrite permeabilities, radionuclide solubilities and distribution coefficients, fracture spacing in the Culebra Dolomite Member of the Rustler Formation, porosity of the Culebra, and spatial variability of Culebra transmissivity. Performance with respect to 40 CFR 191B is insensitive to uncertainty in other parameters; however, additional data are needed to confirm that reality lies within the assigned distributions
Directory of Open Access Journals (Sweden)
Juliana da Silva Agostini
2010-08-01
Full Text Available The objective of this work was to investigate the germination of hybrid sunflowers BRS191 and C11 as a means of lowering phytic acid (PA content by enhancing the activity of endogenous phytase and acid phosphatase. The concentration of PA in hybrid sunflower achenes varied from 2.16 to 2.83g/100g of sample (p O objetivo deste trabalho foi investigar a germinação de girassóis híbridos BRS 191 e C11 com finalidade de reduzir o teor de AF e aumentar as atividades de phytases e fosfatases endógenas. A concentração do AF nos aquênios de girassóis híbridos variou de 2,16 a 2,83 g /100g de amostra (p< 0,005. As atividades de fitases e fosfatases de girassóis BRS191 e C11 foram elevadas no 4º e 5º dia de germinação, respectivamente, com liberação do fósforo necessário para o desenvolvimento da semente. Estes resultados indicam que o AF do girassol hibrido reduz e a atividade de phytase aumenta em períodos distintos da germinação, possibilitando assim a aplicação desta enzima no controle do teor de AF em cereais, melhorando o seu valor nutricional.
Wang, H J; Xiao, Z Y; Gu, G R; Xue, Y; Shao, M; Deng, Z; Tao, Z G; Yao, C L; Tong, C Y
2017-11-24
Objective: To investigate the value of bedside echocardiography in diagnosis and risk assessment of in-hospital death of patients with Stanford type A aortic dissection. Methods: The clinical data of 229 patients with Stanford type A aortic dissection diagnosed by CT angiography in Zhongshan Hospital affiliated to Fudan University between January 2009 and January 2016 were retrospectively analyzed. The patients were divided into survival group(191 cases)and non-survival group(38 cases)according to presence or absence of in-hospital death. The bedside echocardiography features were analyzed, and influence factors of in-hospital death were determined by multivariate logistic regression analysis. Results: (1) Compared with the survival group, the non-survival group had lower surgery rate (60.52%(23/38) vs. 85.34%(163/191), P 0.05). (2) The bedside echocardiography results showed that prevalence of aortic valve involvement(65.79%(25/38) vs.34.03%(65/191), P 0.05). (3) The multivariate logistic regression analysis showed that aortic valve involvement( OR =3.275, 95% CI 1.290-8.313, P risk factors for in-hospital death in patients with Stanford type A aortic dissection. Conclusions: Bedside echocardiography has significant diagnostic value for Stanford type A aortic dissection. Aortic valve involvement, enlargement of aortic root diameter and without surgery are independent risk factors for patients with Stanford type A aortic dissection.
A Seismic Analysis for Reflective Metal Insulation
International Nuclear Information System (INIS)
Kim, Kyuhyung; Kim, Taesoon
2016-01-01
U.S. NRC (Nuclear Regulatory Commission) GSI- 191 (Generic Safety Issue-191) is concerned about the head-loss of emergency core cooling pumps caused by calcium silicate insulation debris accumulated on a sump screen when a loss of coolant accident (LOCA). In order to cope with the concern, many nuclear plants in U. S. have been replacing calcium silicate insulation in containment building with reflective metal insulation (RMI). In Korea, RMI has been used for only reactor vessels recently constructed, but the RMI was imported. Therefore, we have been developing the domestic design of RMI to supply to nuclear power plants under operation and construction in relation to the GSI-191. This paper covers that the structural integrity of the RMI assembly was evaluated under SSE (safety shutdown earthquake) load. An analysis model was built for the seismic test system of a reflective metal insulation assembly and pre-stress, modal, and spectrum analysis for the model were performed using a commercial structural analysis code, ANSYS. According to the results of the analyses, the buckles fastening the RMIs showed the structural integrity under the required response spectrum containing the safety shutdown earthquake loads applied to main components in containment building. Consequently, since the RMI isn't disassembled under the SSE load, the RMI is judged not to affect safety related components
19 CFR 191.14 - Identification of merchandise or articles by accounting method.
2010-04-01
... applies to identification of merchandise or articles in inventory or storage, as well as identification of... identified as being received into and withdrawn from the same inventory. Even if merchandise or articles are... or articles under this section, subject to the conditions of this section. If any such inventory...
19 CFR 191.91 - Waiver of prior notice of intent to export.
2010-04-01
... Service (IRS) number (with suffix) of applicant; (B) Name, address, and Internal Revenue Service (IRS... by this application; (D) Commodity/product lines of imported and exported merchandise covered by this... will take effect after completion of the challenge procedures in paragraph (g) of this section unless...
Chemical effects head-loss research in support of generic safety issue 191.
Energy Technology Data Exchange (ETDEWEB)
Park, J. H.; Kasza, K.; Fisher, B.; Oras, J.; Natesan, K.; Shack, W. J.; Nuclear Engineering Division
2006-10-31
This summary report describes studies conducted at Argonne National Laboratory on the potential for chemical effects on head loss across sump screens. Three different buffering solutions were used for these tests: trisodium phosphate (TSP), sodium hydroxide, and sodium tetraborate. These pH control agents used following a LOCA at a nuclear power plant show various degrees of interaction with the insulating materials Cal-Sil and NUKON. Results for Cal-Sil dissolution tests in TSP solutions, settling rate tests of calcium phosphate precipitates, and benchmark tests in chemically inactive environments are also presented. The dissolution tests were intended to identify important environmental variables governing both calcium dissolution and subsequent calcium phosphate formation over a range of simulated sump pool conditions. The results from the dissolution testing were used to inform both the head loss and settling test series. The objective of the head loss tests was to assess the head loss produced by debris beds created by Cal-Sil, fibrous debris, and calcium phosphate precipitates. The effects of both the relative arrival time of the precipitates and insulation debris and the calcium phosphate formation process were specifically evaluated. The debris loadings, test loop flow rates, and test temperature were chosen to be reasonably representative of those expected in plants with updated sump screen configurations, although the approach velocity of 0.1 ft/s used for most of the tests is 3-10 times that expected in plants with large screens . Other variables were selected with the intent to reasonably bound the head loss variability due to arrival time and calcium phosphate formation uncertainty. Settling tests were conducted to measure the settling rates of calcium phosphate precipitates (formed by adding dissolved Ca to boric acid and TSP solutions) in water columns having no bulk directional flow. For PWRs where NaOH and sodium tetraborate are used to control sump pH and fiberglass insulation is prevalent, relatively high concentrations of soluble aluminum can be expected. Tests in which the dissolved aluminum (Al) resulted from aluminum nitrate additions were used to investigate potential chemical effects that may lead to high head loss. Dissolved Al concentrations of 100 ppm were shown to lead to large pressure drops for the screen area to sump volume ratio and fiber debris bed studied. No chemical effects on head loss were observed in sodium tetraborate buffered solutions even for environments with high ratios of submerged Al area to sump volume. However, in tests with much higher concentrations of dissolved Al than expected in plants, large pressure drops did occur. Interaction with NUKON/Cal-Sil debris mixtures produced much lower head losses than observed in corresponding tests with TSP, although tests were not performed over the full range of Cal-Sil that might be of interest.
Health (Radiation Safety) Regulations 1984 (Victoria), No. 191 of 8 May 1984
International Nuclear Information System (INIS)
1984-01-01
These Regulations promulgated pursuant to the Health Act 1958, as amended, repeal the Irradiating Apparatus and Radioactive Substances Regulations 1959. The provisions of the Regulations are designed to safeguard the public, patients and employees of registered premises from harmful effects of radiation. (NEA) [fr
19 CFR 191.35 - Notice of intent to export; examination of merchandise.
2010-04-01
..., if available, fax number and e-mail address of a contact person, and the location of the merchandise... merchandise shall be transported in-bond to the port of exportation. (e) Extent of examination. The...
19 CFR 191.194 - Action on application to participate in compliance program.
2010-04-01
... to coordinate its decision making on the package both with CBP Headquarters and with the other field drawback offices as appropriate. CBP processing of the package will consist of the review of the information contained therein as well as any additional information requested (see paragraph (a)(2) of this...
Czech Academy of Sciences Publication Activity Database
Lipovská, P.; Rathouská, L.; Šimůnek, O.; Hošek, J.; Kolaříková, V.; Rybáčková, M.; Cvačka, Josef; Svoboda, Martin; Kvíčala, J.
2016-01-01
Roč. 191, Nov (2016), s. 14-22 ISSN 0022-1139 Institutional support: RVO:61388963 Keywords : racemic * chiral * ruthenium complex * perfluorooxaalkanoate * polyfluorooxaalkanoate Subject RIV: CC - Organic Chemistry Impact factor: 2.101, year: 2016
Tim Ingold and Jo Lee Vergunst, eds., . Aldershot, Ashgate ...
African Journals Online (AJOL)
ANBR
gatherers; her ethnographic descriptions are ... (averaging two weeks per. Ways of walking: Ethnography and practice on foot. Department of Anthropology. Rhodes University. Grahamstown. South Africa content process. 191. BOOK REVIEWS. 0. 5. 25.
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 292 ... Dalit Women in Indian Politics: Making Impact through Parliament? ... Justice, Reparations and Accountability for Religious and Caste Massacres in India. The secular ... Establishing an IPS/UNCCP Information System.
Případ tinea corporis vyvolaný Microsporum incurvatum, geofilním druhem příbuzným M. gypseum
Czech Academy of Sciences Publication Activity Database
Lysková, P.; Hubka, Vít; Bodnárová, J.
2014-01-01
Roč. 89, č. 4 (2014), s. 187-191 ISSN 0009-0514 Grant - others:Universita Karlova(CZ) 1344214 Institutional support: RVO:61388971 Keywords : tinea corporis * Microsporum incurvatum * Arthroderma Subject RIV: EE - Microbiology, Virology
TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development
Czech Academy of Sciences Publication Activity Database
Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.
2008-01-01
Roč. 133, č. 1 (2008), s. 177-191 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008
Rings without a lord? Enigmatic fossils from the lower Palaeozoic of Bohemia and the Carnic Alps
Czech Academy of Sciences Publication Activity Database
Ferretti, A.; Cardini, A.; Crampton, J. S.; Serpagli, E.; Sheets, H. D.; Štorch, Petr
2013-01-01
Roč. 46, č. 2 (2013), s. 211-222 ISSN 0024-1164 Institutional support: RVO:67985831 Keywords : phosphatic rings * Problematica * Palaeozoic * morphometric analysis Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.191, year: 2013
The effect of lactose-in-saline infusion on packed cell volume ...
African Journals Online (AJOL)
STORAGESEVER
2008-06-03
Jun 3, 2008 ... concluded that lactose ameliorated anaemia, by inhibiting the sequestration of desialylated ..... lactose infusion further supports the conclusion that lactose played ... statistics. 3rd. Ed. Chapman and Hall, London, pp. 191-194.
Negation and Affirmation: a critique of sociology in South Africa
African Journals Online (AJOL)
2013-12-17
Dec 17, 2013 ... Eurocentrism, sociology of religion, inter-religious dialogue, Ibn. Khaldun, paper read at ... Unpublished Master's Thesis. University of South Africa. ... Journal of Investigative Psychology, 1(3): 191-206. Lebakeng, T.J., 2000.
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 875 ... Filter by type ... Perspectives filter · Training materials 1 Apply Training materials .... Resistance in plants against pathogen infection is defined as a ... susceptibility to a hypersensitive response (complete resistance).
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 1119 ... Supporting Biotechnology Regulatory Policy Processes in Southeast Asia ... Decreasing food availability for wildlife is likely to exacerbate the impacts of ... of unhealthy diets (including ultra-processed and fast foods).
Japanese family with congenital factor VII deficiency.
Sakakibara, Kanae; Okayama, Yoshiki; Fukushima, Kenji; Kaji, Shunsaku; Muraoka, Michiko; Arao, Yujiro; Shimada, Akira
2015-10-01
Congenital factor VII (FVII) deficiency is a rare bleeding disorder with autosomal recessive inheritance. The present female patient was diagnosed with congenital FVII deficiency because of low hepaplastin test (HPT), although vitamin K was given. Heterozygous p.A191T mutation was detected in the peripheral blood, and the same mutation was also found in the mother and sister. To the best of our knowledge, this is the fourth reported case of p.A191T mutation of FVII in the literature and the first to be reported in Japan. FVII coagulation activity (FVII:C) in asymptomatic heterozygous carriers is mildly reduced. Therefore, some patients may not be accurately diagnosed with congenital FVII deficiency. In infants with low HPT without vitamin K deficiency, congenital FVII deficiency should be considered. © 2015 Japan Pediatric Society.
(Radioiodinated free fatty acids)
Energy Technology Data Exchange (ETDEWEB)
Knapp, Jr., F. F.
1987-12-11
The traveler participated in the Second International Workshop on Radioiodinated Free Fatty Acids in Amsterdam, The Netherlands where he presented an invited paper describing the pioneering work at the Oak Ridge National Laboratory (ORNL) involving the design, development and testing of new radioiodinated methyl-branched fatty acids for evaluation of heart disease. He also chaired a technical session on the testing of new agents in various in vitro and in vivo systems. He also visited the Institute for Clinical and Experimental Nuclear Medicine in Bonn, West Germany, to review, discuss, plan and coordinate collaborative investigations with that institution. In addition, he visited the Cyclotron Research Center in Liege, Belgium, to discuss continuing collaborative studies with the Osmium-191/Iridium-191m radionuclide generator system, and to complete manuscripts and plan future studies.
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
Czech Academy of Sciences Publication Activity Database
Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.
2012-01-01
Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 224 ... Asia-Pacific Research and Training Network on Trade (ARTNET) - Phase II ... 2004 to enhance the capacity of researchers and research institutions to deliver ... Business Regulations Evaluation Group in Latin America.
Kinetics of Inhibition of Xanthine Oxidase by Lycium arabicum and ...
African Journals Online (AJOL)
Induced Hyperuricemia and Renal Dysfunction in Mice ... Therefore, there is urgent need to develop new ..... Development of Research in Health (ANDRS). ... New. York: Academic Press; 1965 ; pp 32-191. 6. Markham KR. Techniques of ...
Excitation of triplet states of hypericin in water mediated by hydrotropic cromolyn sodium salt
Czech Academy of Sciences Publication Activity Database
Keša, P.; Jančura, D.; Kudláčová, Júlia; Valušová, E.; Antalík, M.
2018-01-01
Roč. 193, 15 March (2018), s. 185-191 ISSN 1386-1425 Institutional support: RVO:61389013 Keywords : cromolyn * hydrotrope * hypericin Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.536, year: 2016
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 8494 ... HOST PARASITE RELATIONSHIPS NUTRITION POLICY CROP LOSSES ... team aims to protect human health and the environment by improving ... Research is finding ways to make their work sustainable and better ...
Publications | Page 20 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 6341 ... ... and offer free training materials to guide researchers and institutions. ... Improving citizen awareness and democratic elections in Peru ... Africa has achieved impressive economic growth in the past 15 years; from ...
Publications | Page 20 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 6382 ... Food advertising to children in Argentinean television : a ... Use of Mobile Phones by the Rural Poor: Gender perspectives from ... food and nutrition security strategy that links agriculture to health and nutrition.
Czech Academy of Sciences Publication Activity Database
Rizzato, C.; Campa, D.; Pezzilli, R.; Souček, P.; Greenhalf, W.; Capurso, G.; Talar-Wojnarowska, R.; Heller, A.; Jamroziak, K.; Khaw, K. T.; Key, T.; Bambi, F.; Landi, S.; Mohelníková-Duchoňová, B.; Vodičková, Ludmila; Buechler, M. W.; Bugert, P.; Vodička, Pavel; Neoptolemos, J. P.; Werner, J.; Hoheisel, J. D.; Bauer, A. S.; Giese, N.; Canzian, F.
2013-01-01
Roč. 29, č. 4 (2013), s. 1637-1644 ISSN 1021-335X Institutional support: RVO:68378041 Keywords : pancreatic cancer * genetic susceptibility * cancer risk Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.191, year: 2013
Czech Academy of Sciences Publication Activity Database
Uchman, A.; Mikuláš, Radek; Stachacz, M.
2017-01-01
Roč. 24, č. 3 (2017), s. 191-203 ISSN 1042-0940 Institutional support: RVO:67985831 Keywords : Ephemeroptera * ichnology * lebensspuren * fluvial environment Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.182, year: 2016
Feasibility study for the redesign of MDOT's pavement management systems software.
2011-04-01
In August of 2006 the Mississippi Department of Transportation (MDOT) initiated State Study No. 191, entitled Feasibility : Study for the Redesign of MDOTs Pavement Management System (PMS) Software. At the initiation of this study, the : Dep...
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 257 ... Involving urban communities in controlling dengue fever in Latin America ... For most countries, raising the minimum wage has long been considered a way ... Evaluating vocational training program for women in Brazil.
Directory of Open Access Journals (Sweden)
Sandra Szir
2015-09-01
Full Text Available Reseña bibliográfica del libro de Teresa Zweifel, Medir lo inconmensurable. Los cambios en los procedimientos para relevar la pampa anterior (1796-1895, Rosario, Prohistoria Ediciones, 2014, 191 pp.
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 8517 ... Expanding women's financial inclusion: A win-win for women and financial institutions. Rose, an astute and driven business woman runs a “table banking” operation in the heart of Nairobi. Profile.
The comsumption and the supply of radioisotopes in Argentina
International Nuclear Information System (INIS)
Radicella, Renato.
1975-07-01
The isotopes consumption is analysed. The geographical distribution of the users and the use of radioactive material is also described. The local production in 1973 reached 191 Ci being the total consumption 232 Ci. (author) [es
Fatigue Properties of Orthotropic Decks on Railway Bridges
Czech Academy of Sciences Publication Activity Database
Frýba, Ladislav; Gajdoš, Lubomír
1999-01-01
Roč. 21, č. 7 (1999), s. 639-652 ISSN 0141-0296 Grant - others:XX(CZ) ERRI D 191 Keywords : railway bridges * orthotropic decks * fatigue Subject RIV: JM - Building Engineering Impact factor: 0.364, year: 1999
Risk factors for teenage pregnancy among sexually active black ...
African Journals Online (AJOL)
... with 191 cases and 353 age-matched controls from the same school or neighbourhood. ... sex (risk ratio (RR) 30.81) without reliable contraceptive protection (RR 24.35), ... and broader social development and promotion of gender equality.
A conceptual framework to model long-run qualitative change in the energy system
Ebersberger, Bernd
2004-01-01
A conceptual framework to model long-run qualitative change in the energy system / A. Pyka, B. Ebersberger, H. Hanusch. - In: Evolution and economic complexity / ed. J. Stanley Metcalfe ... - Cheltenham [u.a.] : Elgar, 2004. - S. 191-213
Studies of doped negative valve-regulated lead-acid battery electrodes
Czech Academy of Sciences Publication Activity Database
Micka, Karel; Calábek, M.; Bača, P.; Křivák, P.; Lábus, R.; Bilko, R.
2009-01-01
Roč. 191, č. 1 (2009), s. 154-158 ISSN 0378-7753 Institutional research plan: CEZ:AV0Z40400503 Keywords : lead-acid * negative electrode * sulfation suppression Subject RIV: CG - Electrochemistry Impact factor: 3.792, year: 2009
Czech Academy of Sciences Publication Activity Database
Tijare, S.N.; Bakardjieva, Snejana; Šubrt, Jan; Joshi, M.V.; Rayalu, S.S.; Hishita, S.; Labhsetwar, N.
2014-01-01
Roč. 126, č. 2 (2014), s. 517-525 ISSN 0974-3626 Institutional support: RVO:61388980 Keywords : Perovskite * PrFeO3 * photocatalyst * water-splitting * hydrogen Subject RIV: CA - Inorganic Chemistry Impact factor: 1.191, year: 2014
National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Serial data in this accession was collected as part of Global Ocean Data Archeaology and Rescue (GODAR) project from 2,138 stations and contains 19,191...
Czech Academy of Sciences Publication Activity Database
Martinez-Aquino, A.; Mendoza-Palmero, Carlos Alonso; Aguilar-Aguilar, R.; Pérez-Ponce de León, G.
2014-01-01
Roč. 3856, č. 2 (2014), s. 151-191 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : taxonomy * Digenea * Monogenea * Cestoda * Nematoda * Acanthocephala * Mexico Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.906, year: 2014
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 650 ... Filter by topic ... DNA barcoding is a new tool for taxonomic research. ... and advocacy organization based in Kampala, Uganda, with a reputation for producing good quality research to underpin its advocacy work.
Linda Maria Koldau: Die Moldau. Smetanas Zyklus "Mein Vaterland"
Czech Academy of Sciences Publication Activity Database
Gabrielová, Jarmila
2009-01-01
Roč. 46, 1-2 (2009), s. 190-191 ISSN 0018-7003 Institutional research plan: CEZ:AV0Z90580513 Keywords : Bedřich Smetana * "My Fatherland" ("My Country") Cycle Subject RIV: AL - Art, Architecture, Cultural Heritage
African Journals Online (AJOL)
abp
2017-01-30
Jan 30, 2017 ... cross-sectional study involving women attending antenatal clinic at selected clinics of Nairobi .... had ASB, giving a prevalence of 21.5%(95 CI range 19.1- ..... technical advice in proposal development, in-process consultation.
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 8530 ... Taking control of air pollution in Mexico city. The United Nations described Mexico City's air as the most polluted on the planet. Story. Economics Development Social Policy WOMEN'S RIGHTS Gender Equity ...
Czech Academy of Sciences Publication Activity Database
Šturma, Pavel
2010-01-01
Roč. 18, č. 6 (2010), s. 191-194 ISSN 1210-6410 Institutional research plan: CEZ:AV0Z70680506 Keywords : the Lisbon Treaty * the Charter of Fundamental Rights of the EU Subject RIV: AG - Legal Sciences
Aqueous marker penetration into ion irradiated polyimide
Czech Academy of Sciences Publication Activity Database
Fink, D.; Muller, M.; Petrov, A.; Klett, R.; Palmetshofer, L.; Hnatowicz, Vladimír; Vacík, Jiří; Červená, Jarmila; Chadderton, L. T.
2002-01-01
Roč. 191, - (2002), s. 662-668 ISSN 0168-583X R&D Projects: GA AV ČR IAA7011908 Keywords : transport * energy * mass Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.158, year: 2002
EST Table: CK561988 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available CK561988 rswpb0_004912.y1 10/09/29 64 %/191 aa ref|XP_001605087.1| PREDICTED: similar to fetal alzheimer... PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] CK536202 swp ...
South African Journal of Animal Science - Vol 16, No 4 (1986)
African Journals Online (AJOL)
The effect of a dietary leucine excess on the immunoresponsiveness and growth of chickens · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Karen J. Tinker, RM Gous, 187-191 ...
Od Fermatových čísel ke geometrii. Věnováno prof. O. Kowalskému k jeho 65. narozeninám
Czech Academy of Sciences Publication Activity Database
Křížek, Michal
2001-01-01
Roč. 46, č. 3 (2001), s. 179-191 ISSN 0032-2423 R&D Projects: GA ČR GA201/01/1200 Keywords : Heron and Pascal triangle%Sierpienski fractal set%regular polygons Subject RIV: BA - General Mathematics
Nuclear medicine progress report for quarter ending September 30, 1982
Energy Technology Data Exchange (ETDEWEB)
Knapp, F.F. Jr.; Ambrose, K.R.; Butler, T.A.; Goodman, M.M.; Hoeschele, J.D.; Srivastava, P.C.
1983-01-01
In this report a new kit is described for the rapid, regiospecific radioiodination of 15-(p-iodophenyl)pentadecanoic acid (IPP). Iodine-123-labeled IPP is used clinically to monitor myocardial fatty acid metabolism and the new kit offers a major improvement over present methods of radioiodination. During the period three shipments of /sup 191/Os-osmate were made to Medical Cooperative investigators for fabrication of the /sup 191/Os-/sup 191m/Ir radionuclide generator. Five production runs of /sup 11/C labeled amino acids including L-valine, DL-tryptophan and 1-aminocyclohexanecarboxylic acid were synthesized for clinical studies at the Oak Ridge Associated Universities. In addition, seven shipments of /sup 195m/Pt-cis-dichlorodiammineplatinum(II) were made to collaborators for evaluation of the pharmacologic properties of this antitumor agent and to monitor the effective therapeutic dose levels. Several /sup 125/I- and /sup 123m/Te-labeled fatty acids were prepared for evaluation in conjunction with collaborators at the Massachusetts General Hospital. Studies of radioiodinated barbiturates as potential new agents to measure cerebral blood perfusion have also continued. Iodine-125-labeled 5-ethyl-t-(meta-iodophenyl)barbituric acid was prepared as a model agent in which the iodine was stabilized by attachment to a phenyl ring. Evaluation in rats indicated brain uptake with only minimal deiodination. Preliminary studies with tritium-labeled benzo(a)pyrene have also been performed using Syrian hamster embryo (SHE) cells grown in diffusion chambers implanted in rats.
Scenario development for the Waste Isolation Pilot Plant compliance certification application
International Nuclear Information System (INIS)
GALSON, D.A.; SWIFT, PETER N.; ANDERSON, D. RICHARD; BENNETT, D.G.
1998-01-01
Demonstrating compliance with the applicable regulations for the Waste Isolation Pilot Plant (WIPP) requires an assessment of the long-term performance of the disposal system. Scenario development is one starting point of this assessment, and generates inquiry about the present state and future evolution of the disposal system. Scenario development consists of four tasks: (1) identifying and classifying features, events and processes (FEPs), (2) screening FEPs according to well-defined criteria, (3) forming scenarios (combinations of FEPs) in the context of regulatory performance criteria and (4) specifying of scenarios for consequence analysis. The development and screening of a comprehensive FEP list provides assurance that the identification of significant processes and events is complete, that potential interactions between FEPs are not overlooked, and that responses to possible questions are available and well documented. Two basic scenarios have been identified for the WIPP: undisturbed performance (UP) and disturbed performance (DP). The UP scenario is used to evaluate compliance with the Environmental Protection Agency's (EPA's) Individual Dose (40 CFR Section 191-15) and Groundwater Protection (40 CFR Section 191-24) standards and accounts for all natural-, waste- and repository-induced FEPs that survive the screening process. The DP scenario is required for assessment calculations for the EPA's cumulative release standard (Containment Requirements, 40 CFR Section 191-13) and accounts for disruptive future human events, which have an uncertain probability of occurrence, in addition to the UP FEPs
Czech Academy of Sciences Publication Activity Database
Lisá, Lenka; Bajer, A.; Pacina, J.; McCool, J-P.; Cílek, Václav; Rohovec, Jan; Matoušková, Šárka; Kallistová, Anna; Gottvald, Z.
2017-01-01
Roč. 149, č. 1 (2017), s. 273-282 ISSN 0341-8162 Institutional support: RVO:67985831 Keywords : climate change * micromorphology * sahel * saprolite * soil chemistry Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.191, year: 2016
Governance challenges in Tanzania's environmental impact ...
African Journals Online (AJOL)
EJIRO
Cap 191. This Act promotes Environmental Assessment, gives it the legal support and defines the institutional set up for the management of the environment. However ..... Ministry of Natural Resources and Tourism, built along a very busy road ...
Rétoři na moři a pomeranč v refektáři neboli Umění elokvence P. Johanna Krause SJ
Czech Academy of Sciences Publication Activity Database
Svatoš, Martin
2010-01-01
Roč. 50, č. 1 (2010), s. 169-191 ISSN 0323-0562 Institutional research plan: CEZ:AV0Z90090514 Keywords : P. Johann Kraus SJ * conceptual sermons * rhetoric * Jesuits in Bohemia Subject RIV: AJ - Letters, Mass-media, Audiovision
2013-12-09
... Specification Alloys, Inc... Saginaw, MI......... September 25, 2012. 83,191 Victor Innovative Textiles, LLC... Polycom, Inc., PolyOne Cape Girardeau, MO.. Designed Structures & Solutions, Workforce Employment.... 83,214 Timken Company (The), Altavista Altavista, VA....... Bearing Plant. [[Page 73889
Indian Academy of Sciences (India)
Unknown
A four-element based transposon system for allele specific tagging in plants ... 191. BRCA1. Analysis of BRCA1 involvement in breast cancer in Indian women. 19. Brain ... Cortical tissue. Transfer of learning across the somatosensory cortex. 5.
Evaluation of poultry processing practices, related public health laws ...
African Journals Online (AJOL)
ADEYEYE
2015-02-16
Feb 16, 2015 ... the Meat Law (1968), Food and Drug Act (1974) and Animal Diseases (Control) ... production and processing are coordinated for the benefits and health of the ..... Pp 191-210. ... Ouedraogo JB, Maikano I, Mbah PO, Kremer.
Evropské mezinárodní právo soukromé a zamyšlení nad výročím Římských smluv
Czech Academy of Sciences Publication Activity Database
Pauknerová, Monika
2017-01-01
Roč. 156, č. 3 (2017), s. 179-191 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : European private international law * Czech private international law * international unification of private law Subject RIV: AG - Legal Sciences OBOR OECD: Law
Czech Academy of Sciences Publication Activity Database
Ruiselová, Z.; Urbánek, Tomáš
2008-01-01
Roč. 50, č. 2 (2008), s. 191-200 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : adolescents * norm-breaking behavior * structural equations model Subject RIV: AN - Psychology Impact factor: 0.258, year: 2008
Monroe, TalaWanda R.
2017-08-01
The spectrophotometric white dwarf G191-B2B will be observed with the E140M grating to obtain an updated set of sensitivity curves for this highly used mode. Spectroscopic sensitivity monitoring observations of BD+284211 have shown that the blaze function shapes have changed since SM4 and now limit the relative photometric flux accuracy of 14 of 43 E140M spectral orders to 5-10% at the edges. The blaze function shape changes have hindered attempts to determine the post-SM4 temporal blaze function shifts for this grating. Given the popularity of this unique FUV mode, with almost full simultaneous coverage of 1144 to 1710 A in a single observation, and consideration of the STIS archival legacy, we request 1 orbit to re-observe G191-B2B with the E140/1425 setting.
DEFF Research Database (Denmark)
Sigtryggsdóttir, Asta Rós; Papaleo, Elena; Thorbjarnardóttir, Sigríður H.
2014-01-01
activity of cold adapted enzymes when compared to homologues from thermophiles, reflects their higher molecular flexibility. To assess a potential difference in molecular flexibility between the two homologous proteinases, we have measured their Trp fluorescence quenching by acrylamide at different......The subtilisin-like serine proteinases, VPR, from a psychrotrophic Vibrio species and aqualysin I (AQUI) from the thermophile Thermus aquaticus, are structural homologues, but differ significantly with respect to stability and catalytic properties. It has been postulated that the higher catalytic...... to Trp (Y191W). A lower quenching effect of acrylamide on the intrinsic fluorescence of the thermophilic AQUI_Y191W was observed at all temperatures measured (10-55°C), suggesting that it possesses a more rigid structure than VPR. The MD analysis (Cα rmsf profiles) showed that even though VPR and AQUI...
Isomeric cross sections of neutron induced reactions on Ge and Ir isotopes
International Nuclear Information System (INIS)
Vlastou, R.; Papadopoulos, C.T.; Kokkoris, M.; Perdikakis, G.; Galanopoulos, S.; Patronis, N.; Serris, M.; Perdikakis, G.; Harissopulos, S.; Demetriou, P.
2008-01-01
The 72 Ge(n,α) 69m Zn, 74 Ge(n,α) 71m Zn, 76 Ge(n,2n) 75g+m Ge and 191 Ir(n,2n) 190 Ir g+m1 and 191 Ir(n,2n) 190 Ir m2 reaction cross sections were measured from 9.6 to 11.4 MeV relative to the 27 Al(n,α) 24 Na reference reaction via the activation method. The quasi-monoenergetic neutron beams were produced via the 2 H(d,n) 3 He reaction at the 5 MV VdG Tandem T11/25 accelerator of NCSR 'Demokritos'. Statistical model calculations using the codes STAPRE-F and EMPIRE (version 2.19) and taking into account pre-equilibrium emission were performed on the data measured in this work as well as on data reported in literature. (authors)
Nuclear orientation experiments concerning odd-A gold isotopes
International Nuclear Information System (INIS)
Ligthart, H.J.
1982-01-01
This thesis describes nuclear spectroscopy aspects of nuclear orientation in the odd-A gold isotopes 191 Au, 193 Au, 195 Au and 197 Au. These isotopes lie in a transitional region between the spherical nuclei in the lead region and the strongly deformed rare earth isotopes. Following a general introduction to nuclear orientation, the experimental arrangement is described. A new technique is presented that applies in-beam recoil implantation inside the refrigerator itself and this was applied to the case of 191 Au. The three other gold isotopes were oriented using a conventional dilution refrigerator. The nuclear orientation experiments concerning 11/2 - isomers of the isotopes are described. The long-lived isomeric states were oriented using the large hyperfine field of gold in iron. Higher lying levels were studied by nuclear orientation of the Hg parent states. (Auth./C.F.)
Kristalizacione karakteristike i sinterabilnost prahova lantan-stroncijum-boratnih stakala
Smiljanić, Sonja V.
2017-01-01
Predmet ove doktorske disertacije je ispitvanje kristalizacionog ponašanja i sinterabilnosti boratnih stakala iz sistema La2O3-SrO-B2O3, o čemu postoji ograničen broj podataka u literaturi. Preliminarna ispitivanja su obuhvatala dobijanje 4 različita sastava ovog sistema, tako što se sadržaj lantana povećavao na račun stroncijuma, dok je sadržaj bora bio konstantan: 5,7La2O3·22,9SrO·71,4B2O3; 9,5La2O3·19,1SrO·71,4B2O3; 14,3La2O3·14,3SrO·71,4B2O3 i 19,1La2O3·9,5SrO·71,4B2O3. ...
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...
Althusser, Marx a neempiristická teorie dějin
Czech Academy of Sciences Publication Activity Database
Kužel, Petr
2013-01-01
Roč. 10, č. 2 (2013), s. 191-208 ISSN 1214-7249 Institutional support: RVO:67985955 Keywords : empiricism * historical epistemology * Louis Althusser * Karl Marx Subject RIV: AA - Philosophy ; Religion http://www.dejinyteoriekritika.cz/Modules/ViewDocument.aspx?Did=410
African Journal of Environmental Science and Technology - Vol 9 ...
African Journals Online (AJOL)
191 ... Seasonal variation of meteorological factors on air parameters and the impact of gas flaring on air quality of some cities in Niger Delta (Ibeno and its environs) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL ...
Dicty_cDB: Contig-U13293-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 093214_1( AF093214 |pid:none) Hirtodrosophila pictiventris xanth... 206 6e-52 FB7...23 |pid:none) Sequence 7019 from Patent WO200903... 191 2e-47 AF058984_1( AF058984 |pid:none) Scaptodrosophila
Czech Academy of Sciences Publication Activity Database
Spoustová, Petra; Synková, Helena; Valcke, R.; Čeřovská, Noemi
2013-01-01
Roč. 51, č. 2 (2013), s. 191-201 ISSN 0300-3604 Institutional research plan: CEZ:AV0Z50380511 Keywords : gas- exchange parameters * cytokinins * chlorophyll a fluorescence imaging Subject RIV: EF - Botanics Impact factor: 1.007, year: 2013
2002-01-01
The visit itinerary includes five area of halls 191 and 180:. End-Cap Toroid Integration Area . Barrel Toroid Integration Area . Cryogenic Test Facility for Toroid Magnets and Helium Pumps . Liquid Argon Cryostats Assembly Area . Central Solenoid Magnet Test Station
Aerobasics–An Introduction to Aeronautics
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 2. Aerobasics–An Introduction to Aeronautics - Airfoils and Wings in Subsonic Flow. S P Govinda Raju. Series Article Volume 14 Issue 2 February 2009 pp 191-203 ...
State ownership and control in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Kočenda, Evžen; Hanousek, Jan
2012-01-01
Roč. 45, č. 3 (2012), s. 157-191 ISSN 1573-9414 R&D Projects: GA ČR GA402/09/1595 Institutional support: PRVOUK-P23 Keywords : corporate performance * corporate pyramid * golden share * privatization Subject RIV: AH - Economics
Ethical issues in measuring biomarkers in children´s environmental health
Czech Academy of Sciences Publication Activity Database
Sly, P. D.; Eskenazi, B.; Pronczuk, J.; Šrám, Radim; Diaz-Barriga, F.; Machin, D. G.; Carpenter, D. O.; Surdu, S.; Meslin, E. M.
2009-01-01
Roč. 117, č. 8 (2009), s. 1185-1190 ISSN 0091-6765 Institutional research plan: CEZ:AV0Z50390512 Keywords : biobanks * biomarkers * children Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 6.191, year: 2009
Czech experience with market maker trading system
Czech Academy of Sciences Publication Activity Database
Hanousek, Jan; Podpiera, R.
2004-01-01
Roč. 28, č. 2 (2004), s. 177-191 ISSN 0939-3625 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : trading systems * informed trading * emerging markets Subject RIV: AH - Economics
Plate Tectonics and Europa's Icy Shell
Indian Academy of Sciences (India)
defence of his theory with the 1915 publication of The Origin of Continents and Oceans. Wegener .... is one of the most promising places in our solar system to search .... Universe, Paperback Edition, Copernicus Books, pp.191–216, 2003.
Physiological and biochemical responses to low temperature stress ...
African Journals Online (AJOL)
ajl yemi
2011-11-09
Nov 9, 2011 ... Levels of electrolyte leak and MDA were lower than in UD189 or UD191. Poplar hybrid clones ... humidity, exposure, and water status and health conditions of ... consecutive low temperature treatment; and to detect variation ...
Surgical Anatomy of the Vertebrobasilar Territory and Posterior ...
African Journals Online (AJOL)
RESULTS: The male: female ratio was 1.9:1 and a mean age of 44 years. Statistical analysis showed significant differences between the sizes of posterior inferior cerebellar arteries and ... Fifty-six percent of the brains had no anomalies.
Genoprotective and Genotoxic Effects of Thymoquinone on ...
African Journals Online (AJOL)
was obtained from each blood donor prior to their participation. Chemicals ..... that protects against genetic damage with the least toxicity. ... traditional drugs sold in Israel at the end of the 20th century. J Ethnopharmacol 2000; 72: 191-205.
Ilorin Journal of Religious Studies - Vol 3, No 2 (2013)
African Journals Online (AJOL)
Re-Interpreting “Sodom and Gomorrah” Passages in the Context of Homosexuality Controversy: A Nigerian Perspective · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SO Olanisebe, AJ Adelakun, 191-209 ...
: tous les projets | Page 629 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: HEALTH SERVICES, HOSPITALS, MEDICAL RECORDS, TELECOMMUNICATIONS NETWORKS, INFORMATION TECHNOLOGY, MEDICAL EDUCATION, DISTANCE STUDY. Région: Algeria, North of Sahara, South of Sahara. Financement total : CA$ 191,675.00. Intégration des TIC dans la gouvernance locale au ...
Czech Academy of Sciences Publication Activity Database
Janský, Petr; Kalíšková, Klára; Münich, Daniel
2016-01-01
Roč. 54, č. 3 (2016), s. 191-207 ISSN 0012-8775 R&D Projects: GA TA ČR(CZ) TD020188 Institutional support: RVO:67985998 Keywords : Czech Republic * expenditures * income Subject RIV: AH - Economics Impact factor: 0.288, year: 2016
COMMUNITY HEALTH & PRIMARY HEALTH CARE
African Journals Online (AJOL)
the_monk
2012-05-01
May 1, 2012 ... with the quality of care in a tertiary health facility in Delta State, Nigeria ... includes contributions from families, charges have been .... employees at 23.5%, self employed 19.1% of showed that most of the respondents (41.3%).
Pattern of femoral fractures and associated injuries in a Nigerian ...
African Journals Online (AJOL)
2014-10-09
Oct 9, 2014 ... The analysis was performed using descriptive statistics in Microsoft Excel 2007. Results: A total of ... using Microsoft Excel from Microsoft Office 2007 developed by Microsoft. and ..... J Midlife Health 2013;4:191‑4. 21. Adili A ...
Targeted design of α-MnO2 based catalysts for oxygen reduction
Czech Academy of Sciences Publication Activity Database
Lehtimäki, M.; Hoffmannová, Hana; Boytsová, O.; Bastl, Zdeněk; Bush, M.; Halck, N. B.; Rossmeisl, J.; Krtil, Petr
2016-01-01
Roč. 191, FEB 2016 (2016), s. 452-461 ISSN 0013-4686 EU Projects: European Commission(XE) 214936 - ELCAT Institutional support: RVO:61388955 Keywords : electrocatalysis * oxygen reduction * MnO2 Subject RIV: CG - Electrochemistry Impact factor: 4.798, year: 2016
Presence of the amphibian chytrid pathogen confirmed in Cameroon
Czech Academy of Sciences Publication Activity Database
Baláž, V.; Kopecký, O.; Gvoždík, Václav
2012-01-01
Roč. 22, č. 3 (2012), s. 191-194 ISSN 0268-0130 R&D Projects: GA MŠk LC06073 Institutional support: RVO:67985904 Keywords : Afromontane * chytridiomycosis * Congolian lowland rainforests Subject RIV: EG - Zoology Impact factor: 1.081, year: 2012
2010-11-02
... Docket No. 10-191; FCC 10-161] Telecommunications Relay Services and Speech-to-Speech Services for...-Based Telecommunications Relay Service Numbering AGENCY: Federal Communications Commission. ACTION... Internet-based Telecommunications Relay Service (iTRS), specifically, Video Relay Service (VRS) and IP...
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 8531 ... Environmental pollution ... Taking control of air pollution in Mexico city. The United Nations described Mexico City's air as the most polluted on the ... Held in Ottawa, the event profiled IDRC's impact over the past year, ...
77 FR 1039 - Internet-Based Telecommunications Relay Service Numbering
2012-01-09
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 64 [WC Docket No. 10-191; Report No. 2939] Internet... toll-free numbers by users of Internet- based Telecommunications Relay Services (iTRS). DATES... any rules of particular applicability. Subject: Internet-Based Telecommunications Relay Service...
Barnacle larval transport in the Mandovi–Zuari estuarine system, central west coast of India
Digital Repository Service at National Institute of Oceanography (India)
George, G.; Desai, D.V.; Gaonkar, C.A.; Aboobacker, V.M.; Vethamony, P.; Anil, A.C.
Santos A, Dubert J, González-Gordillo JI, Paula J, Peliz A, Santos AMP (2007) Oceanographic and behavioural processes affecting invertebrate larval dispersal and supply in the western Iberia upwelling ecosystem. Prog Oceanogr 74:174-191 Roff JC, Pett...
2011-05-17
... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration 49 CFR 191... Reports AGENCY: Pipeline and Hazardous Materials Safety Administration (PHMSA), DOT. ACTION: Issuance of... Pipeline and Hazardous Materials Safety Administration (PHMSA) published a final rule on November 26, 2010...
Czech Academy of Sciences Publication Activity Database
Montagnes, D. J. S.; Roberts, E. C.; Lukeš, Julius; Lowe, Ch.
2012-01-01
Roč. 20, č. 4 (2012), s. 184-191 ISSN 0966-842X Institutional research plan: CEZ:AV0Z60220518 Keywords : ecology * model organism * physiology * protist * teaching * toxins Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 8.434, year: 2012
Das IPR der Verbraucherverbandsklage / Peter Rott
Rott, Peter
2016-01-01
Euroopa Kohtu kohtuasjast VKI v. Amazon (C‑191/15), mis puudutab lepinguliste ja lepinguväliste võlasuhete suhtes kohaldatavat õigust, tarbijaga elektroonilise kaubanduse teel sõlmitud lepingute kohaldamist ja isikuandmete töötlemist, mida teostab elektroonilise kaubanduse ettevõtja
2017-01-10
C.S.S. wrote the paper . TR-16-191 DISTRIBUTION STATEMENT A: Approved for public release; distribution is unlimited. UNCLASSIFIED 3 Introduction...and recorded. Chemistry and hematology assessments included measurements of blood glucose, urea nitrogen, creatinine, uric acid, calcium, albumin
Mycoflore de quelques variétés du fraisier (Fragaria ananassa L ...
African Journals Online (AJOL)
SARAH
5 et 19,1%, il est ... antagonist and saprophyte which can give indication about the health of the plants growing in this region ...... espèces de mauvaises herbes du genre Rubus ..... compost et les Trichoderma spp. seul ou en.
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-10-20
Results 191 - 200 of 8492 ... Lessons about research to make cities safer and more inclusive. SAIC was a global research program that brought leading experts together to help understand the drivers of urban violence. Published date. October 20, 2017. Webpage.
10 CFR Appendix II to Part 960 - NRC and EPA Requirements for Preclosure Repository Performance
2010-01-01
...) that, except for variances permitted for unusual operations under Section 191.04 as an upper limit..., and schedule. 10 CFR part 20 establishes (a) exposure limits for operating personnel and (b... necessary to ensure consistency with 10 CFR part 60. ...
Directory of Open Access Journals (Sweden)
Silvia N. López
2006-12-01
Full Text Available En la línea de sexado genético «Cast191» las hembras de Ceratitis capitata son homocigotas para el gen slow , lo que reduce su velocidad de desarrollo; los machos son heterocigotas y muestran una velocidad de desarrollo normal. Esta característica permitió producir, con Cast191, machos estériles por un lado, y parasitoides criados sobre las larvas remanentes por el otro. Nuestro objetivo con este trabajo fue producir ambos insumos simultáneamente y a una escala mayor que hasta ahora. Además, bajo estas condiciones, y en un intento por aumentar la separación entre sexos, se aplicó a las larvas del primer estadío un pulso de 15º C, durante 1 ó 2 días, luego del cual se las mantuvo a 20º C ó 25º C, hasta que entraron al estado de pupa, luego se mantuvo todo el material a 25º C. La mejor separación de sexos, lograda con el tratamiento a 20º C sin pulso de frío, se usó para comparar la calidad del parasitoide Diachasmimorpha longicaudata, criado sobre las larvas obtenidas tras la separación de los machos, con aquellos criados sobre la línea salvaje. Para ello, este tratamiento de separación fue aplicado en la cría de la mosca, y el material remanente de dieta con larvas fue expuesto al parasitoide. La tasa de parasitismo obtenida fue semejante a la hallada sobre la línea salvaje, y la tasa sexual de la F 1 del parasitoide presentó un sesgo hacia las hembras aún mayor. Se discute la factibilidad de utilizar la línea Cast191 de C. Capitata, para la producción a mayor escala de machos de mosca y para la cría masiva del parasitoide D. longicaudata.In the genetic sexing strain «Cast191», the females of Ceratitis capitata are homozygous for the mutation slow , slowing down their rate of development, and the males are heterozygous, having a normal rate of development. This feature made Cast191 capable of producing sterile males, on one hand, and parasitoids that are reared on the remaining larvae, on the other. The
Energy Technology Data Exchange (ETDEWEB)
Nilsson, Kersti (Geosigma AB (Sweden))
2011-03-15
This report presents chemistry data from the extended sampling in SFR, performed every five years. The extended sampling yielded groundwater chemistry data in accordance with SKB chemistry class 3, 4 and 5 and included all water bearing borehole sections. Supplementary, more extensive, hydrochemical groundwater investigations were performed in three borehole sections: KFR7A:1 (48.0-74.7 m borehole length; 134.0-134.9 m.b.s.l.), KFR08:1 (63.0-104.0 m borehole length; 91.5-95.1 m.b.s.l.) and KFR19:1 (95.6-110.0 m borehole length; 58.2-54.5 m.b.s.l.) with a second purpose to supply important additional data to the SFR extension project. Samples for chemical analyses (major constituents, trace metals and isotopes) were collected in all three borehole sections and on-line measurements of pH, redox potential (Eh) and water temperature were also performed. The measurements were conducted in a flow through cell at the orifice of the boreholes. In addition, on-line measurements of electrical conductivity (EC) and dissolved oxygen were conducted in KFR19:1. Furthermore, enrichments of humic and fulvic acids for determination of delta13C and 14C in organic material were performed in all three sections and sampling for analyses of dissolved gas was performed in KFR08:1 and KFR19:1. The three borehole sections with redox measurements showed stable water composition during the sampling periods. The chloride concentrations amounted to between 2,790 mg/L (KFR19:1) and 3,670 mg/L (KFR7A:1). All of the measured redox potentials (Eh) reached stable and consistent values (-153 mV in KFR7A:1, -156 mV in KFR08:1 and -168 mV in KFR19:1). All three borehole sections showed relatively high oxygen-18 values indicating a clearly marine origin of the groundwaters. No major changes of the water chemistry in the four boreholes included in the annual hydrochemistry monitoring program have been noticed during 2010. A slow shift towards lower chloride concentrations can be noticed when data for a
Baracks, Joshua; Casa, Douglas J; Covassin, Tracey; Sacko, Ryan; Scarneo, Samantha E; Schnyer, David; Yeargin, Susan W; Neville, Christopher
2018-06-13
Without a true criterion standard assessment, the sport-related concussion (SRC) diagnosis remains subjective. Inertial balance sensors have been proposed to improve acute SRC assessment, but few researchers have studied their clinical utility. To determine if group differences exist when using objective measures of balance in a sample of collegiate athletes with recent SRCs and participants serving as the control group and to calculate sensitivity and specificity to determine the diagnostic utility of the inertial balance sensor for acute SRC injuries. Cohort study. Multicenter clinical trial. We enrolled 48 participants with SRC (age = 20.62 ± 1.52 years, height = 179.76 ± 10.00 cm, mass = 83.92 ± 23.22 kg) and 45 control participants (age = 20.85 ± 1.42 years, height = 177.02 ± 9.59 cm, mass = 74.61 ± 14.92 kg) at 7 clinical sites in the United States. All were varsity or club collegiate athletes, and all participants with SRC were tested within 72 hours of SRC. Balance performance was assessed using an inertial balance sensor. Two measures (root mean square [RMS] sway and 95% ellipse sway area) were analyzed to represent a range of general balance measures. Balance assessments were conducted in double-legged, single-legged, and tandem stances. A main effect for group was associated with the root mean square sway measure ( F 1,91 = 11.75, P = .001), with the SRC group demonstrating balance deficits compared with the control group. We observed group differences in the 95% ellipse sway area measure for the double-legged ( F 1,91 = 11.59, P = .001), single-legged ( F 1,91 = 6.91, P = .01), and tandem ( F 1,91 = 7.54, P = .007) stances. Sensitivity was greatest using a cutoff value of 0.5 standard deviations (54% [specificity = 71%]), whereas specificity was greatest using a cutoff value of 2 standard deviations (98% [sensitivity = 33%]). Inertial balance sensors may be useful tools for objectively measuring balance during acute
Michiels, J; Van Soom, T; D'hooghe, I; Dombrecht, B; Benhassine, T; de Wilde, P; Vanderleyden, J
1998-04-01
The rpoN region of Rhizobium etli was isolated by using the Bradyrhizobium japonicum rpoN1 gene as a probe. Nucleotide sequence analysis of a 5,600-bp DNA fragment of this region revealed the presence of four complete open reading frames (ORFs), ORF258, rpoN, ORF191, and ptsN, coding for proteins of 258, 520, 191, and 154 amino acids, respectively. The gene product of ORF258 is homologous to members of the ATP-binding cassette-type permeases. ORF191 and ptsN are homologous to conserved ORFs found downstream from rpoN genes in other bacterial species. Unlike in most other microorganisms, rpoN and ORF191 are separated by approximately 1.6 kb. The R. etli rpoN gene was shown to control in free-living conditions the production of melanin, the activation of nifH, and the metabolism of C4-dicarboxylic acids and several nitrogen sources (ammonium, nitrate, alanine, and serine). Expression of the rpoN gene was negatively autoregulated and occurred independently of the nitrogen source. Inactivation of the ptsN gene resulted in a decrease of melanin synthesis and nifH expression. In a search for additional genes controlling the synthesis of melanin, an R. etli mutant carrying a Tn5 insertion in ptsA, a gene homologous to the Escherichia coli gene coding for enzyme I of the phosphoenolpyruvate:sugar phosphotransferase system, was obtained. The R. etli ptsA mutant also displayed reduced expression of nifH. The ptsN and ptsA mutants also displayed increased sensitivity to the toxic effects of malate and succinate. Growth of both mutants was inhibited by these C4-dicarboxylates at 20 mM at pH 7.0, while wild-type cells grow normally under these conditions. The effect of malate occurred independently of the nitrogen source used. Growth inhibition was decreased by lowering the pH of the growth medium. These results suggest that ptsN and ptsA are part of the same regulatory cascade, the inactivation of which renders the cells sensitive to toxic effects of elevated concentrations of
SU-E-T-191: First Principle Calculation of Quantum Yield in Photodynamic Therapy
Energy Technology Data Exchange (ETDEWEB)
Abolfath, R; Guo, F; Chen, Z; Nath, R [Yale New Haven Hospital, New Haven, CT (United States)
2014-06-01
Purpose: We present a first-principle method to calculate the spin transfer efficiency in oxygen induced by any photon fields especially in MeV energy range. The optical pumping is mediated through photosensitizers, e.g., porphyrin and/or ensemble of quantum dots. Methods: Under normal conditions, oxygen molecules are in the relatively non-reactive triplet state. In the presence of certain photosensitizer compounds such as porphyrins, electromagnetic radiation of specific wavelengths can excite oxygen to highly reactive singlet state. With selective uptake of photosensitizers by certain malignant cells, photon irradiation of phosensitized tumors can lead to selective killing of cancer cells. This is the basis of photodynamic therapy (PDT). Despite several attempts, PDT has not been clinically successful except in limited superficial cancers. Many parameters such as photon energy, conjugation with quantum dots etc. can be potentially combined with PDT in order to extend the role of PDT in cancer management. The key quantity for this optimization is the spin transfer efficiency in oxygen by any photon field. The first principle calculation model presented here, is an attempt to fill this need. We employ stochastic density matrix description of the quantum jumps and the rate equation methods in quantum optics based on Markov/Poisson processes and calculate time evolution of the population of the optically pumped singlet oxygen. Results: The results demonstrate the feasibility of our model in showing the dependence of the optical yield in generating spin-singlet oxygen on the experimental conditions. The adjustable variables can be tuned to maximize the population of the singlet oxygen hence the efficacy of the photodynamic therapy. Conclusion: The present model can be employed to fit and analyze the experimental data and possibly to assist researchers in optimizing the experimental conditions in photodynamic therapy.
Sexospécificités | Page 191 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Women in many African countries have a legal right to own land, but this often means little in areas where “customary law” prevails. ... Land is an important source of security against poverty across the developing world, but, in many places, unequal rights to land put women at a disadvantage, perpetuates poverty, and ...
191 Analyse de la répartition spatiale des places publiques dans la ...
African Journals Online (AJOL)
TOHOZIN
de Porto-Novo, Bénin. Coovi Aimé Bernadin TOHOZIN1* et Odile DOSSOU GUEDEGBE2. 1RECTAS, Département de Cartographie, Obafemi Awolowo University Campus Off Road 1,. PMB 5545, Ilé - Ifè, Osun State, Nigéria. 2Université d'Abomey-Calavi, Département de Géographie et d'Aménagement du Territoire, Bénin ...
Kolasani et al., Afr J Tradit Complement Altern Med. (2011) 8(S):191 ...
African Journals Online (AJOL)
AJTCAM
2 School of Biomedical and Health Sciences, Victoria University, Australia. 3 Institute of ... The development of herbal formulae has been an empirical process in which the properties of herbs and the effects of .... Table 1. The method of preparation of decoction was done according to the Chinese standard procedure. The.
15 CFR 19.1 - What definitions apply to the regulations in this Part?
2010-01-01
... bureaus currently include the Bureau of Industry and Security, the Economics and Statistics Administration... applicable agreement or instrument (including a post-delinquency payment agreement) unless other satisfactory...
The effect of soil properties on cadmium bonds to organic substances of spinach biomass
Czech Academy of Sciences Publication Activity Database
Pavlíková, D.; Pavlík, Milan; Vašíčková, Soňa; Száková, J.; Tlustoš, P.; Vokáč, Karel; Balík, J.
2002-01-01
Roč. 16, - (2002), s. 187-191 ISSN 0268-2605 R&D Projects: GA ČR GA526/97/0845 Institutional research plan: CEZ:AV0Z4055905 Keywords : cadmium * sequential analysis Subject RIV: CE - Biochemistry Impact factor: 1.286, year: 2002
76 FR 24473 - Transwestern Pipeline Company, LLC; Notice of Request Under Blanket Authorization
2011-05-02
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP11-191-000] Transwestern...,000 HP reciprocating gas engines, compressors, and ancillary facilities (Project Facilities) at its... to access the document. For assistance, contact FERC at [email protected] or call toll-free...
An early fragment of Constantine the African's Viaticum in Beneventan Script
Irving, A J M; Long, Brian
2016-01-01
A brief codicological and palaeographical description of a fragment of Constantine the African's Viaticum preserved in Orleans, Mediatheque municipale, Ms. 301 (pp. 176-191). The description of the Beneventan script of the fragment reveals the importance of the manuscript for the manuscript
TASCC newsletter. Vol. 5 No. 3
International Nuclear Information System (INIS)
Thomson, L.
1991-03-01
The TASCC superconducting cyclotron produced iodine-127 beams at both 15 and 19 MeV per nucleon, with total energyies of 1.91 and 2.41 GeV, the highest ion-beam energies recorded in Canada. Planned experiments and staff changes are noted
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 201 ... For the past 35 years, the Diamalaye (Malika) landfill in the city of Pikine has been ... Mitigating Health Risks in the Pottery Sector : Case Study in ... Regional Network on HIV/AIDS, Rural Livelihoods and Food Security ...
Mupirocin-mucin agar for selective enumeration of Bifidobacterium bifidum
Czech Academy of Sciences Publication Activity Database
Pechar, R.; Rada, V.; Parafati, L.; Musilová, S.; Bunešová, V.; Vlková, E.; Killer, Jiří; Mrázek, Jakub; Kmeť, V.; Svejštil, R.
2014-01-01
Roč. 191, č. 1 (2014), s. 32-35 ISSN 0168-1605 R&D Projects: GA ČR GA13-08803S Institutional support: RVO:67985904 Keywords : probiotics * Bifidobacterium bifidum * selective enumeration Subject RIV: EE - Microbiology, Virology Impact factor: 3.082, year: 2014
Czech Academy of Sciences Publication Activity Database
Janáček, Karel; Sigler, Karel
2000-01-01
Roč. 49, - (2000), s. 191-195 ISSN 0862-8408 R&D Projects: GA ČR GA204/99/0488 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EE - Microbiology, Virology Impact factor: 1.366, year: 2000