Energy Technology Data Exchange (ETDEWEB)
Maeder, Dennis L.; Anderson, Iain; Brettin, Thomas S.; Bruce,David C.; Gilna, Paul; Han, Cliff S.; Lapidus, Alla; Metcalf, William W.; Saunders, Elizabeth; Tapia, Roxanne; Sowers, Kevin R.
2006-05-19
We report here a comparative analysis of the genome sequence of Methanosarcina barkeri with those of Methanosarcina acetivorans and Methanosarcina mazei. All three genomes share a conserved double origin of replication and many gene clusters. M. barkeri is distinguished by having an organization that is well conserved with respect to the other Methanosarcinae in the region proximal to the origin of replication with interspecies gene similarities as high as 95%. However it is disordered and marked by increased transposase frequency and decreased gene synteny and gene density in the proximal semi-genome. Of the 3680 open reading frames in M. barkeri, 678 had paralogs with better than 80% similarity to both M. acetivorans and M. mazei while 128 nonhypothetical orfs were unique (non-paralogous) amongst these species including a complete formate dehydrogenase operon, two genes required for N-acetylmuramic acid synthesis, a 14 gene gas vesicle cluster and a bacterial P450-specific ferredoxin reductase cluster not previously observed or characterized in this genus. A cryptic 36 kbp plasmid sequence was detected in M. barkeri that contains an orc1 gene flanked by a presumptive origin of replication consisting of 38 tandem repeats of a 143 nt motif. Three-way comparison of these genomes reveals differing mechanisms for the accrual of changes. Elongation of the large M. acetivorans is the result of multiple gene-scale insertions and duplications uniformly distributed in that genome, while M. barkeri is characterized by localized inversions associated with the loss of gene content. In contrast, the relatively short M. mazei most closely approximates the ancestral organizational state.
Holden, Todd; Tremberger, G., Jr.; Cheung, E.; Subramaniam, R.; Sullivan, R.; Schneider, P.; Flamholz, A.; Marchese, P.; Hiciano, O.; Yao, H.; Lieberman, D.; Cheung, T.
2008-08-01
Cultures of the methane-producing archaea Methanosarcina, have recently been isolated from Alaskan sediments. It has been proposed that methanogens are strong candidates for exobiological life in extreme conditions. The spatial environmental gradients, such as those associated with the polygons on Mars' surface, could have been produced by past methanogenesis activity. The 16S rRNA gene has been used routinely to classify phenotypes. Using the fractal dimension of nucleotide fluctuation, a comparative study of the 16S rRNA nucleotide fluctuation in Methanosarcina acetivorans C2A, Deinococcus radiodurans, and E. coli was conducted. The results suggest that Methanosarcina acetivorans has the lowest fractal dimension, consistent with its ancestral position in evolution. Variation in fluctuation complexity was also detected in the transcription factors. The transcription factor B (TFB) was found to have a higher fractal dimension as compared to transcription factor E (TFE), consistent with the fact that a single TFB in Methanosarcina acetivorans can code three different TATA box proteins. The average nucleotide pair-wise free energy of the DNA repair genes was found to be highest for Methanosarcina acetivorans, suggesting a relatively weak bonding, which is consistent with its low prevalence in pathology. Multitasking capacity comparison of type-I and type-II topoisomerases has been shown to correlate with fractal dimension using the methicillin-resistant strain MRSA 252. The analysis suggests that gene adaptation in a changing chemical environment can be measured in terms of bioinformatics. Given that the radiation resistant Deinococcus radiodurans is a strong candidate for an extraterrestrial origin and that the cold temperature Psychrobacter cryohalolentis K5 can function in Siberian permafrost, the fractal dimension comparison in this study suggests that a chemical resistant methanogen could exist in extremely cold conditions (such as that which existed on early
Ni, S.; Woese, C. R.; Aldrich, H. C.; Boone, D. R.
1994-01-01
A sequence analysis of the 16S rRNA of Methanolobus siciliae T4/M(T) (T = type strain) showed that this strain is closely related to members of the genus Methanosarcina, especially Methanosarcina acetivorans C2A(T). Methanolobus siciliae T4/M(T) and HI350 were morphologically more similar to members of the genus Methanosarcina than to members of the genus Methanolobus in that they both formed massive cell aggregates with pseudosarcinae. Thus, we propose that Methanolobus siciliae should be transferred to the genus Methanosarcina as Methanosarcina siciliae.
Jasso-Ch?vez, Ricardo; Diaz-Perez, C?sar; Rodr?guez-Zavala, Jos? S.; Ferry, James G.
2016-01-01
The multisubunit cation/proton antiporter 3 family, also called Mrp, is widely distributed in all three phylogenetic domains (Eukarya, Bacteria, and Archaea). Investigations have focused on Mrp complexes from the domain Bacteria to the exclusion of Archaea, with a consensus emerging that all seven subunits are required for Na+/H+ antiport activity. The MrpA subunit from the MrpABCDEFG Na+/H+ antiporter complex of the archaeon Methanosarcina acetivorans was produced in antiporter-deficient Esc...
Directory of Open Access Journals (Sweden)
Ricardo Jasso-Chávez
Full Text Available Methanosarcina acetivorans, considered a strict anaerobic archaeon, was cultured in the presence of 0.4-1% O2 (atmospheric for at least 6 months to generate air-adapted cells; further, the biochemical mechanisms developed to deal with O2 were characterized. Methane production and protein content, as indicators of cell growth, did not change in air-adapted cells respect to cells cultured under anoxia (control cells. In contrast, growth and methane production significantly decreased in control cells exposed for the first time to O2. Production of reactive oxygen species was 50 times lower in air-adapted cells versus control cells, suggesting enhanced anti-oxidant mechanisms that attenuated the O2 toxicity. In this regard, (i the transcripts and activities of superoxide dismutase, catalase and peroxidase significantly increased; and (ii the thiol-molecules (cysteine + coenzyme M-SH + sulfide and polyphosphate contents were respectively 2 and 5 times higher in air-adapted cells versus anaerobic-control cells. Long-term cultures (18 days of air-adapted cells exposed to 2% O2 exhibited the ability to form biofilms. These data indicate that M. acetivorans develops multiple mechanisms to contend with O2 and the associated oxidative stress, as also suggested by genome analyses for some methanogens.
A Heme-based Redox Sensor in the Methanogenic Archaeon Methanosarcina acetivorans*
Molitor, Bastian; Stassen, Marc; Modi, Anuja; El-Mashtoly, Samir F.; Laurich, Christoph; Lubitz, Wolfgang; Dawson, John H.; Rother, Michael; Frankenberg-Dinkel, Nicole
2013-01-01
Based on a bioinformatics study, the protein MA4561 from the methanogenic archaeon Methanosarcina acetivorans was originally predicted to be a multidomain phytochrome-like photosensory kinase possibly binding open-chain tetrapyrroles. Although we were able to show that recombinantly produced and purified protein does not bind any known phytochrome chromophores, UV-visible spectroscopy revealed the presence of a heme tetrapyrrole cofactor. In contrast to many other known cytoplasmic heme-containing proteins, the heme was covalently attached via one vinyl side chain to cysteine 656 in the second GAF domain. This GAF domain by itself is sufficient for covalent attachment. Resonance Raman and magnetic circular dichroism data support a model of a six-coordinate heme species with additional features of a five-coordination structure. The heme cofactor is redox-active and able to coordinate various ligands like imidazole, dimethyl sulfide, and carbon monoxide depending on the redox state. Interestingly, the redox state of the heme cofactor has a substantial influence on autophosphorylation activity. Although reduced protein does not autophosphorylate, oxidized protein gives a strong autophosphorylation signal independent from bound external ligands. Based on its genomic localization, MA4561 is most likely a sensor kinase of a two-component system effecting regulation of the Mts system, a set of three homologous corrinoid/methyltransferase fusion protein isoforms involved in methyl sulfide metabolism. Consistent with this prediction, an M. acetivorans mutant devoid of MA4561 constitutively synthesized MtsF. On the basis of our results, we postulate a heme-based redox/dimethyl sulfide sensory function of MA4561 and propose to designate it MsmS (methyl sulfide methyltransferase-associated sensor). PMID:23661702
Apo and ligand-bound structures of ModA from the archaeon Methanosarcina acetivorans
International Nuclear Information System (INIS)
Chan, Sum; Giuroiu, Iulia; Chernishof, Irina; Sawaya, Michael R.; Chiang, Janet; Gunsalus, Robert P.; Arbing, Mark A.; Perry, L. Jeanne
2010-01-01
Crystal structures of ModA from M. acetivorans in the apo and ligand-bound conformations confirm domain rotation upon ligand binding. The trace-element oxyanion molybdate, which is required for the growth of many bacterial and archaeal species, is transported into the cell by an ATP-binding cassette (ABC) transporter superfamily uptake system called ModABC. ModABC consists of the ModA periplasmic solute-binding protein, the integral membrane-transport protein ModB and the ATP-binding and hydrolysis cassette protein ModC. In this study, X-ray crystal structures of ModA from the archaeon Methanosarcina acetivorans (MaModA) have been determined in the apoprotein conformation at 1.95 and 1.69 Å resolution and in the molybdate-bound conformation at 2.25 and 2.45 Å resolution. The overall domain structure of MaModA is similar to other ModA proteins in that it has a bilobal structure in which two mixed α/β domains are linked by a hinge region. The apo MaModA is the first unliganded archaeal ModA structure to be determined: it exhibits a deep cleft between the two domains and confirms that upon binding ligand one domain is rotated towards the other by a hinge-bending motion, which is consistent with the ‘Venus flytrap’ model seen for bacterial-type periplasmic binding proteins. In contrast to the bacterial ModA structures, which have tetrahedral coordination of their metal substrates, molybdate-bound MaModA employs octahedral coordination of its substrate like other archaeal ModA proteins
Apo and ligand-bound structures of ModA from the archaeon Methanosarcina acetivorans.
Chan, Sum; Giuroiu, Iulia; Chernishof, Irina; Sawaya, Michael R; Chiang, Janet; Gunsalus, Robert P; Arbing, Mark A; Perry, L Jeanne
2010-03-01
The trace-element oxyanion molybdate, which is required for the growth of many bacterial and archaeal species, is transported into the cell by an ATP-binding cassette (ABC) transporter superfamily uptake system called ModABC. ModABC consists of the ModA periplasmic solute-binding protein, the integral membrane-transport protein ModB and the ATP-binding and hydrolysis cassette protein ModC. In this study, X-ray crystal structures of ModA from the archaeon Methanosarcina acetivorans (MaModA) have been determined in the apoprotein conformation at 1.95 and 1.69 A resolution and in the molybdate-bound conformation at 2.25 and 2.45 A resolution. The overall domain structure of MaModA is similar to other ModA proteins in that it has a bilobal structure in which two mixed alpha/beta domains are linked by a hinge region. The apo MaModA is the first unliganded archaeal ModA structure to be determined: it exhibits a deep cleft between the two domains and confirms that upon binding ligand one domain is rotated towards the other by a hinge-bending motion, which is consistent with the 'Venus flytrap' model seen for bacterial-type periplasmic binding proteins. In contrast to the bacterial ModA structures, which have tetrahedral coordination of their metal substrates, molybdate-bound MaModA employs octahedral coordination of its substrate like other archaeal ModA proteins.
Directory of Open Access Journals (Sweden)
Paolo Ascenzi
Full Text Available Within the globin superfamily, protoglobins (Pgb belong phylogenetically to the same cluster of two-domain globin-coupled sensors and single-domain sensor globins. Multiple functional roles have been postulated for Methanosarcina acetivorans Pgb (Ma-Pgb, since the detoxification of reactive nitrogen and oxygen species might co-exist with enzymatic activity(ies to facilitate the conversion of CO to methane. Here, the nitrite-reductase and peroxynitrite isomerization activities of the CysE20Ser mutant of Ma-Pgb (Ma-Pgb* are reported and analyzed in parallel with those of related heme-proteins. Kinetics of nitrite-reductase activity of ferrous Ma-Pgb* (Ma-Pgb*-Fe(II is biphasic and values of the second-order rate constant for the reduction of NO2- to NO and the concomitant formation of nitrosylated Ma-Pgb*-Fe(II (Ma-Pgb*-Fe(II-NO are k(app1= 9.6 ± 0.2 M(-1 s(-1 and k(app2 = 1.2 ± 0.1 M(-1 s(-1 (at pH 7.4 and 20 °C. The k(app1 and k(app2 values increase by about one order of magnitude for each pH unit decrease, between pH 8.3 and 6.2, indicating that the reaction requires one proton. On the other hand, kinetics of peroxynitrite isomerization catalyzed by ferric Ma-Pgb* (Ma-Pgb*-Fe(III is monophasic and values of the second order rate constant for peroxynitrite isomerization by Ma-Pgb*-Fe(III and of the first order rate constant for the spontaneous conversion of peroxynitrite to nitrate are h(app = 3.8 × 10(4 M(-1 s(-1 and h0 = 2.8 × 10(-1 s(-1 (at pH 7.4 and 20 °C. The pH-dependence of hon and h0 values reflects the acid-base equilibrium of peroxynitrite (pKa = 6.7 and 6.9, respectively; at 20 °C, indicating that HOONO is the species that reacts preferentially with the heme-Fe(III atom. These results highlight the potential role of Pgbs in the biosynthesis and scavenging of reactive nitrogen and oxygen species.
Directory of Open Access Journals (Sweden)
Lesley Tilleman
Full Text Available Studies of CO ligand binding revealed that two protein states with different ligand affinities exist in the protoglobin from Methanosarcina acetivorans (in MaPgb*, residue Cys(E20101 was mutated to Ser. The switch between the two states occurs upon the ligation of MaPgb*. In this work, site-directed mutagenesis was used to explore the role of selected amino acids in ligand sensing and stabilization and in affecting the equilibrium between the "more reactive" and "less reactive" conformational states of MaPgb*. A combination of experimental data obtained from electronic and resonance Raman absorption spectra, CO ligand-binding kinetics, and X-ray crystallography was employed. Three amino acids were assigned a critical role: Trp(60B9, Tyr(61B10, and Phe(93E11. Trp(60B9 and Tyr(61B10 are involved in ligand stabilization in the distal heme pocket; the strength of their interaction was reflected by the spectra of the CO-ligated MaPgb* and by the CO dissociation rate constants. In contrast, Phe(93E11 is a key player in sensing the heme-bound ligand and promotes the rotation of the Trp(60B9 side chain, thus favoring ligand stabilization. Although the structural bases of the fast CO binding rate constant of MaPgb* are still unclear, Trp(60B9, Tyr(61B10, and Phe(93E11 play a role in regulating heme/ligand affinity.
Santiago-Martínez, Michel Geovanni; Encalada, Rusely; Lira-Silva, Elizabeth; Pineda, Erika; Gallardo-Pérez, Juan Carlos; Reyes-García, Marco Antonio; Saavedra, Emma; Moreno-Sánchez, Rafael; Marín-Hernández, Alvaro; Jasso-Chávez, Ricardo
2016-05-01
Gluconeogenesis is an essential pathway in methanogens because they are unable to use exogenous hexoses as carbon source for cell growth. With the aim of understanding the regulatory mechanisms of central carbon metabolism in Methanosarcina acetivorans, the present study investigated gene expression, the activities and metabolic regulation of key enzymes, metabolite contents and fluxes of gluconeogenesis, as well as glycolysis and glycogen synthesis/degradation pathways. Cells were grown with methanol as a carbon source. Key enzymes were kinetically characterized at physiological pH/temperature. Active consumption of methanol during exponential cell growth correlated with significant methanogenesis, gluconeogenic flux and steady glycogen synthesis. After methanol exhaustion, cells reached the stationary growth phase, which correlated with the rise in glycogen consumption and glycolytic flux, decreased methanogenesis, negligible acetate production and an absence of gluconeogenesis. Elevated activities of carbon monoxide dehydrogenase/acetyl-CoA synthetase complex and pyruvate: ferredoxin oxidoreductase suggested the generation of acetyl-CoA and pyruvate for glycogen synthesis. In the early stationary growth phase, the transcript contents and activities of pyruvate phosphate dikinase, fructose 1,6-bisphosphatase and glycogen synthase decreased, whereas those of glycogen phosphorylase, ADP-phosphofructokinase and pyruvate kinase increased. Therefore, glycogen and gluconeogenic metabolites were synthesized when an external carbon source was provided. Once such a carbon source became depleted, glycolysis and methanogenesis fed by glycogen degradation provided the ATP supply. Weak inhibition of key enzymes by metabolites suggested that the pathways evaluated were mainly transcriptionally regulated. Because glycogen metabolism and glycolysis/gluconeogenesis are not present in all methanogens, the overall data suggest that glycogen storage might represent an environmental
Directory of Open Access Journals (Sweden)
Raymond Morales
Full Text Available Topoisomerases play a fundamental role in genome stability, DNA replication and repair. As a result, topoisomerases have served as therapeutic targets of interest in Eukarya and Bacteria, two of the three domains of life. Since members of Archaea, the third domain of life, have not been implicated in any diseased state to-date, there is a paucity of data on archaeal topoisomerases. Here we report Methanosarcina acetivorans TopoIIIα (MacTopoIIIα as the first biochemically characterized mesophilic archaeal topoisomerase. Maximal activity for MacTopoIIIα was elicited at 30-35°C and 100 mM NaCl. As little as 10 fmol of the enzyme initiated DNA relaxation, and NaCl concentrations above 250 mM inhibited this activity. The present study also provides the first evidence that a type IA Topoisomerase has activity in the presence of all divalent cations tested (Mg(2+, Ca(2+, Sr(2+, Ba(2+, Mn(2+, Fe(2+, Co(2+, Ni(2+, Cu(2+, Zn(2+ and Cd(2+. Activity profiles were, however, specific to each metal. Known type I (ssDNA and camptothecin and type II (etoposide, novobiocin and nalidixic acid inhibitors with different mechanisms of action were used to demonstrate that MacTopoIIIα is a type IA topoisomerase. Alignment of MacTopoIIIα with characterized topoisomerases identified Y317 as the putative catalytic residue, and a Y317F mutation ablated DNA relaxation activity, demonstrating that Y317 is essential for catalysis. As the role of Domain V (C-terminal domain is unclear, MacTopoIIIα was aligned with the canonical E. coli TopoI 67 kDa fragment in order to construct an N-terminal (1-586 and a C-terminal (587-752 fragment for analysis. Activity could neither be elicited from the fragments individually nor reconstituted from a mixture of the fragments, suggesting that native folding is impaired when the two fragments are expressed separately. Evidence that each of the split domains plays a role in Zn(2+ binding of the enzyme is also provided.
Directory of Open Access Journals (Sweden)
Nikolau Basil J
2011-06-01
Full Text Available Abstract Background Correct annotation of function is essential if one is to take full advantage of the vast amounts of genomic sequence data. The accuracy of sequence-based functional annotations is often variable, particularly if the sequence homology to a known function is low. Indeed recent work has shown that even proteins with very high sequence identity can have different folds and functions, and therefore caution is needed in assigning functions by sequence homology in the absence of experimental validation. Experimental methods are therefore needed to efficiently evaluate annotations in a way that complements current high throughput technologies. Here, we describe the use of nuclear magnetic resonance (NMR-based ligand screening as a tool for testing functional assignments of putative enzymes that may be of variable reliability. Results The target genes for this study are putative enzymes from the methanogenic archaeon Methanosarcina acetivorans (MA that have been selected after manual genome re-annotation and demonstrate detectable in vivo expression at the level of the transcriptome. The experimental approach begins with heterologous E. coli expression and purification of individual MA gene products. An NMR-based ligand screen of the purified protein then identifies possible substrates or products from a library of candidate compounds chosen from the putative pathway and other related pathways. These data are used to determine if the current sequence-based annotation is likely to be correct. For a number of case studies, additional experiments (such as in vivo genetic complementation were performed to determine function so that the reliability of the NMR screen could be independently assessed. Conclusions In all examples studied, the NMR screen was indicative of whether the functional annotation was correct. Thus, the case studies described demonstrate that NMR-based ligand screening is an effective and rapid tool for confirming or
Mining Proteomic Data to Expose Protein Modifications in Methanosarcina mazei strain Gö1
Directory of Open Access Journals (Sweden)
Deborah eLeon
2015-03-01
Full Text Available Proteomic tools identify constituents of complex mixtures, often delivering long lists of identified proteins. The high-throughput methods excel at matching tandem mass spectrometry data to spectra predicted from sequence databases. Unassigned mass spectra are ignored, but could, in principle, provide valuable information on unanticipated modifications and improve protein annotations while consuming limited quantities of material. Strategies to mine information from these discards are presented, along with discussion of features that, when present, provide strong support for modifications. In this study we mined LC-MS/MS datasets of proteolytically-digested concanavalin A pull down fractions from Methanosarcina mazei Gö1 cell lysates. Analyses identified 154 proteins. Many of the observed proteins displayed post-translationally modified forms, including O-formylated and methyl-esterified segments that appear biologically relevant (i.e., not artifacts of sample handling. Interesting cleavages and modifications (e.g., S-cyanylation and trimethylation were observed near catalytic sites of methanogenesis enzymes. Of 31 Methanosarcina protein N-termini recovered by concanavalin A binding or from a previous study, only M. mazei S-layer protein MM1976 and its M. acetivorans C2A orthologue, MA0829, underwent signal peptide excision. Experimental results contrast with predictions from algorithms SignalP 3.0 and Exprot, which were found to over-predict the presence of signal peptides. Proteins MM0002, MM0716, MM1364, and MM1976 were found to be glycosylated, and employing chromatography tailored specifically for glycopeptides will likely reveal more.This study supplements limited, existing experimental datasets of mature archaeal N-termini, including presence or absence of signal peptides, translation initiation sites, and other processing. Methanosarcina surface and membrane proteins are richly modified.
Duszenko, Nikolas; Buan, Nicole R
2017-09-15
Many, but not all, organisms use quinones to conserve energy in their electron transport chains. Fermentative bacteria and methane-producing archaea (methanogens) do not produce quinones but have devised other ways to generate ATP. Methanophenazine (MPh) is a unique membrane electron carrier found in Methanosarcina species that plays the same role as quinones in the electron transport chain. To extend the analogy between quinones and MPh, we compared the MPh pool sizes between two well-studied Methanosarcina species, Methanosarcina acetivorans C2A and Methanosarcina barkeri Fusaro, to the quinone pool size in the bacterium Escherichia coli We found the quantity of MPh per cell increases as cultures transition from exponential growth to stationary phase, and absolute quantities of MPh were 3-fold higher in M. acetivorans than in M. barkeri The concentration of MPh suggests the cell membrane of M. acetivorans , but not of M. barkeri , is electrically quantized as if it were a single conductive metal sheet and near optimal for rate of electron transport. Similarly, stationary (but not exponentially growing) E. coli cells also have electrically quantized membranes on the basis of quinone content. Consistent with our hypothesis, we demonstrated that the exogenous addition of phenazine increases the growth rate of M. barkeri three times that of M. acetivorans Our work suggests electron flux through MPh is naturally higher in M. acetivorans than in M. barkeri and that hydrogen cycling is less efficient at conserving energy than scalar proton translocation using MPh. IMPORTANCE Can we grow more from less? The ability to optimize and manipulate metabolic efficiency in cells is the difference between commercially viable and nonviable renewable technologies. Much can be learned from methane-producing archaea (methanogens) which evolved a successful metabolic lifestyle under extreme thermodynamic constraints. Methanogens use highly efficient electron transport systems and
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Methanosarcina acetivorans str. C2A] ... Length = 202 ... Query: 13 ... FSDGEFLPSELVRHAVLHGYEAVAITDHADHT...NXXXXXXXXXXXXXXXXXXDIRVLSGVE 72 ... FSDGEFLPSELVRHAVLHGYEAVAITDHADHTN ... ... ... DIRVLSGVE Sbjct: 1 ... FSDGEFLPSELVRHAVLHGYEAVAITDHADHTNLEWLLEAAKKAKYLEEEWDIRVLSGVE 60 ... Query:
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Methanosarcina acetivorans str. C2A] ... Length = 164 ... Query: 8 ... VLKSMIGEALIGTGPEIAHIDLIIGPR...GGPVETAFMNSLAMPRQGHTPLLAVLEPNVQPK 67 ... VLKSMIGEALIGTGPEIAHIDLIIGPRGGPVET...AFMNSLAMPRQGHTPLLAVLEPNVQPK Sbjct: 1 ... VLKSMIGEALIGTGPEIAHIDLIIGPRGGPVETAFMNSLAMPRQGHTPLLAVLEPNVQPK 60 ... Quer
Mycoplasma in Methanosarcina cultures
Energy Technology Data Exchange (ETDEWEB)
Zhilina, T.N.; Zavarzin, G.A.
1979-05-01
As was shown on ultra-thin sections of Methanosarcina, biotype 3, its aggregates can be subjected to lysis by Mycoplasma and substituted by it. Mycoplasma cells are located predominantly in the intercellular space and do not penetrate the cytoplasmic membrane of the Methanosarcina cells.
Jennings, Matthew E.; Schaff, Cody W.; Horne, Alexandra J.; Lessner, Faith H.
2014-01-01
Haem-dependent catalase is an antioxidant enzyme that degrades H2O2, producing H2O and O2, and is common in aerobes. Catalase is present in some strictly anaerobic methane-producing archaea (methanogens), but the importance of catalase to the antioxidant system of methanogens is poorly understood. We report here that a survey of the sequenced genomes of methanogens revealed that the majority of species lack genes encoding catalase. Moreover, Methanosarcina acetivorans is a methanogen capable of synthesizing haem and encodes haem-dependent catalase in its genome; yet, Methanosarcina acetivorans cells lack detectable catalase activity. However, inducible expression of the haem-dependent catalase from Escherichia coli (EcKatG) in the chromosome of Methanosarcina acetivorans resulted in a 100-fold increase in the endogenous catalase activity compared with uninduced cells. The increased catalase activity conferred a 10-fold increase in the resistance of EcKatG-induced cells to H2O2 compared with uninduced cells. The EcKatG-induced cells were also able to grow when exposed to levels of H2O2 that inhibited or killed uninduced cells. However, despite the significant increase in catalase activity, growth studies revealed that EcKatG-induced cells did not exhibit increased tolerance to O2 compared with uninduced cells. These results support the lack of catalase in the majority of methanogens, since methanogens are more likely to encounter O2 rather than high concentrations of H2O2 in the natural environment. Catalase appears to be a minor component of the antioxidant system in methanogens, even those that are aerotolerant, including Methanosarcina acetivorans. Importantly, the experimental approach used here demonstrated the feasibility of engineering beneficial traits, such as H2O2 tolerance, in methanogens. PMID:24222618
DEFF Research Database (Denmark)
Mladenovska, Zuzana; Ahring, Birgitte Kiær
1997-01-01
Two thermophilic strains, Methanosarcina thermophila TM-1 and Methanosarcina sp. SO-2P, were capable of mixotrophic growth on methanol and H-2/CO2. Activated carbon was, however, found to be necessary to support good growth. Both strains used hydrogen and methanol simultaneously. When methanol...
Directory of Open Access Journals (Sweden)
Dillon J Lieber
Full Text Available Multienzyme complexes catalyze important metabolic reactions in many organisms, but little is known about the complexes involved in biological methane production (methanogenesis. A crosslinking-mass spectrometry (XL-MS strategy was employed to identify proteins associated with coenzyme M-coenzyme B heterodisulfide reductase (Hdr, an essential enzyme in all methane-producing archaea (methanogens. In Methanosarcina acetivorans, Hdr forms a multienzyme complex with acetyl-CoA decarbonylase synthase (ACDS, and F420-dependent methylene-H4MPT reductase (Mer. ACDS is essential for production of acetyl-CoA during growth on methanol, or for methanogenesis from acetate, whereas Mer is essential for methanogenesis from all substrates. Existence of a Hdr:ACDS:Mer complex is consistent with growth phenotypes of ACDS and Mer mutant strains in which the complex samples the redox status of electron carriers and directs carbon flux to acetyl-CoA or methanogenesis. We propose the Hdr:ACDS:Mer complex comprises a special class of multienzyme redox complex which functions as a "biological router" that physically links methanogenesis and acetyl-CoA biosynthesis pathways.
Trace methane oxidation studied in several Euryarchaeota under diverse conditions
Directory of Open Access Journals (Sweden)
James J. Moran
2005-01-01
Full Text Available We used 13C-labeled methane to document the extent of trace methane oxidation by Archaeoglobus fulgidus, Archaeoglobus lithotrophicus, Archaeoglobus profundus, Methanobacterium thermoautotrophicum, Methanosarcina barkeri and Methanosarcina acetivorans. The results indicate trace methane oxidation during growth varied among different species and among methanogen cultures grown on different substrates. The extent of trace methane oxidation by Mb. thermoautotrophicum (0.05 ± 0.04%, ± 2 standard deviations of the methane produced during growth was less than that by M. barkeri (0.15 ± 0.04%, grown under similar conditions with H2 and CO2. Methanosarcina acetivorans oxidized more methane during growth on trimethylamine (0.36 ± 0.05% than during growth on methanol (0.07 ± 0.03%. This may indicate that, in M. acetivorans, either a methyltransferase related to growth on trimethylamine plays a role in methane oxidation, or that methanol is an intermediate of methane oxidation. Addition of possible electron acceptors (O2, NO3–, SO22–, SO32– or H2 to the headspace did not substantially enhance or diminish methane oxidation in M. acetivorans cultures. Separate growth experiments with FAD and NAD+ showed that inclusion of these electron carriers also did not enhance methane oxidation. Our results suggest trace methane oxidized during methanogenesis cannot be coupled to the reduction of these electron acceptors in pure cultures, and that the mechanism by which methane is oxidized in methanogens is independent of H2 concentration. In contrast to the methanogens, species of the sulfate-reducing genus Archaeoglobus did not significantly oxidize methane during growth (oxidizing 0.003 ± 0.01% of the methane provided to A. fulgidus, 0.002 ± 0.009% to A. lithotrophicus and 0.003 ± 0.02% to A. profundus. Lack of observable methane oxidation in the three Archaeoglobus species examined may indicate that methyl-coenzyme M reductase, which is not present in
Lead isotopes in archaean plutonic rocks
International Nuclear Information System (INIS)
Oversby, V.M.
1978-01-01
Archaean intrusive rocks have initial Pb isotopic compositions which show a varied and complex history for the source regions of the rocks. Even the oldest rocks from Greenland indicate heterogenous U and Pb distribution prior to 3800 m.y. ago. Source regions with μ values less than 7 must have played a significant role in the early history of the earth. By late Archaean time U/Pb ratios of source regions had increased substantially. Data from Australia and North America show distinct regional differences, both within and between continents. (Auth.)
DEFF Research Database (Denmark)
Rotaru, Amelia-Elena; Calabrese, Federica; Stryhanyuk, Hryhoriy
2017-01-01
pressure and their survival depends on successful partnership. Here we demonstrate that conductive minerals facilitate a SAO partnership between Geobacter and Methanosarcina from the coastal sediments of the Bothnian Bay, Baltic Sea. Bothnian methanogenic sediments showed a high apparent isotopic...... fractionation (αc 1.07) characteristic of CO2-reductive methanogenesis. The native community was represented by electrogens such as Geobacter and methanogens like Methanosarcina. Upon the addition of conductive particles (activated carbon and magnetite), methanogenesis from acetate increased fourfold. Geobacter...... (96% related to G. psychrophilus) and Methanosarcina (99% related to M. subterranea) dominated the conductive particle-spiked SAO communities. Using NanoSIMS we demonstrated that during SAO, Geobacter incorporated 82% of the labeled acetate as compared to only 18% by Methanosarcina. At the same time...
Fossil Microorganisms in Archaean deposits of Northern Karelia
Astafieva, M. M.; Hoover, R. B.; Rozanov, A. Y.; Vrevskiy, A. B.
2005-01-01
Newly found biomorphic microstructures from the Upper Archaean (lopian) rocks from Northern Karelia are described. The presence of various microorganisms of bacterial nature and even cyanobacteria (and possibly eukaryotic forms) is suggested. The necessity of employing methods of electron microscopy, as well as traditional methods, while studying the very early manifestations of life in Archaean and Early Proterozoic is noted.
Identification of the gene for disaggregatase from Methanosarcina mazei
Directory of Open Access Journals (Sweden)
Naoki Osumi
2008-01-01
Full Text Available The gene sequences encoding disaggregatase (Dag, the enzyme responsible for dispersion of cell aggregates of Methanosarcina mazei to single cells, were determined for three strains of M. mazei (S-6T, LYC and TMA. The dag genes of the three strains were 3234 bp in length and had almost the same sequences with 97% amino acid sequence identities. Dag was predicted to comprise 1077 amino acid residues and to have a molecular mass of 120 kDa containing three repeats of the DNRLRE domain in the C terminus, which is specific to the genus Methanosarcina and may be responsible for structural organization and cell wall function. Recombinant Dag was overexpressed in Escherichia coli and preparations of the expressed protein exhibited enzymatic activity. The RT-PCR analysis showed that dag was transcribed to mRNA in M. mazei LYC and indicated that the gene was expressed in vivo. This is the first time the gene involved in the morphological change of Methanosarcina spp. from aggregate to single cells has been identified.
Identification of the gene for disaggregatase from Methanosarcina mazei.
Osumi, Naoki; Kakehashi, Yoshihiro; Matsumoto, Shiho; Nagaoka, Kazunari; Sakai, Junichi; Miyashita, Kiyotaka; Kimura, Makoto; Asakawa, Susumu
2008-12-01
The gene sequences encoding disaggregatase (Dag), the enzyme responsible for dispersion of cell aggregates of Methanosarcina mazei to single cells, were determined for three strains of M. mazei (S-6(T), LYC and TMA). The dag genes of the three strains were 3234 bp in length and had almost the same sequences with 97% amino acid sequence identities. Dag was predicted to comprise 1077 amino acid residues and to have a molecular mass of 120 kDa containing three repeats of the DNRLRE domain in the C terminus, which is specific to the genus Methanosarcina and may be responsible for structural organization and cell wall function. Recombinant Dag was overexpressed in Escherichia coli and preparations of the expressed protein exhibited enzymatic activity. The RT-PCR analysis showed that dag was transcribed to mRNA in M. mazei LYC and indicated that the gene was expressed in vivo. This is the first time the gene involved in the morphological change of Methanosarcina spp. from aggregate to single cells has been identified.
Molecular characterization of the thioredoxin system from Methanosarcina acetivorans
McCarver, Addison C.; Lessner, Daniel J.
2014-01-01
The thioredoxin system, composed of thioredoxin reductase (TrxR) and thioredoxin (Trx), is widely distributed in nature, where it serves key roles in electron transfer and in defense against oxidative stress. Although recent evidence reveals Trx homologues are almost universally present among the methane-producing archaea (methanogens), a complete thioredoxin system has not been characterized from any methanogen. We examined the phylogeny of Trx homologues among methanogens and characterized ...
Deep and persistent melt layer in the Archaean mantle
Andrault, Denis; Pesce, Giacomo; Manthilake, Geeth; Monteux, Julien; Bolfan-Casanova, Nathalie; Chantel, Julien; Novella, Davide; Guignot, Nicolas; King, Andrew; Itié, Jean-Paul; Hennet, Louis
2018-02-01
The transition from the Archaean to the Proterozoic eon ended a period of great instability at the Earth's surface. The origin of this transition could be a change in the dynamic regime of the Earth's interior. Here we use laboratory experiments to investigate the solidus of samples representative of the Archaean upper mantle. Our two complementary in situ measurements of the melting curve reveal a solidus that is 200-250 K lower than previously reported at depths higher than about 100 km. Such a lower solidus temperature makes partial melting today easier than previously thought, particularly in the presence of volatiles (H2O and CO2). A lower solidus could also account for the early high production of melts such as komatiites. For an Archaean mantle that was 200-300 K hotter than today, significant melting is expected at depths from 100-150 km to more than 400 km. Thus, a persistent layer of melt may have existed in the Archaean upper mantle. This shell of molten material may have progressively disappeared because of secular cooling of the mantle. Crystallization would have increased the upper mantle viscosity and could have enhanced mechanical coupling between the lithosphere and the asthenosphere. Such a change might explain the transition from surface dynamics dominated by a stagnant lid on the early Earth to modern-like plate tectonics with deep slab subduction.
Salinity of the Archaean oceans from analysis of fluid inclusions in quartz
Marty, Bernard; Avice, Guillaume; Bekaert, David V.; Broadley, Michael W.
2018-05-01
Fluids trapped in inclusions in well-characterized Archaean hydrothermal quartz crystals were analyzed by the extended argon-argon method, which permits the simultaneous measurement of chlorine and potassium concentrations. Argon and nitrogen isotopic compositions of the trapped fluids were also determined by static mass spectrometry. Fluids were extracted by stepwise crushing of quartz samples from North Pole (NW Australia) and Barberton (South Africa) 3.5-3.0-Ga-old greenstone belts. The data indicate that fluids are a mixture of a low salinity end-member, regarded as the Archaean oceanic water, and several hydrothermal end-members rich in Cl, K, N, and radiogenic parentless 40Ar. The low Cl-K end-member suggests that the salinity of the Archaean oceans was comparable to the modern one, and that the potassium content of the Archaean oceans was lower than at present by about 40%. A constant salinity of the oceans through time has important implications for the stabilization of the continental crust and for the habitability of the ancient Earth.
Whole-cell hybridization of Methanosarcina cells with two new oligonucleotide probes
DEFF Research Database (Denmark)
Sørensen, A.H.; Torsvik, V.L.; Torsvik, T.
1997-01-01
Two new oligonucleotide probes targeting the 16S rRNA of the methanogenic genus Methanosarcina were developed. The probes have the following sequences (Escherichia coli numbering): probe SARCI551, 5'-GAC CCAATAATCACGATCAC-3', and probe SARCI645, 5'-TCCCGGTTCCAAGTCTGGC-3'. In situ hybridization...... with the fluorescently labelled probes required several modifications of standard procedures. Cells of Methanosarcina mazeii S-6 were found to lyse during the hybridization step if fixed in 3% formaldehyde and stored in 50% ethanol. Lysis was, however, not observed with cells fixed and stored in 1.6% formaldehyde-0.......85% NaCl. Extensive autofluorescence of the cells was found upon hybridization in the presence of 5 mM EDTA, but successful hybridization could be obtained without addition of this compound. The mounting agent Citifluor AF1, often used in conjugation with the fluorochrome fluorescein, was found to wash...
Adakitic magmas: modern analogues of Archaean granitoids
Martin, Hervé
1999-03-01
Both geochemical and experimental petrological research indicate that Archaean continental crust was generated by partial melting of an Archaean tholeiite transformed into a garnet-bearing amphibolite or eclogite. The geodynamic context of tholeiite melting is the subject of controversy. It is assumed to be either (1) subduction (melting of a hot subducting slab), or (2) hot spot (melting of underplated basalts). These hypotheses are considered in the light of modern adakite genesis. Adakites are intermediate to felsic volcanic rocks, andesitic to rhyolitic in composition (basaltic members are lacking). They have trondhjemitic affinities (high-Na 2O contents and K 2O/Na 2O˜0.5) and their Mg no. (0.5), Ni (20-40 ppm) and Cr (30-50 ppm) contents are higher than in typical calc-alkaline magmas. Sr contents are high (>300 ppm, until 2000 ppm) and REE show strongly fractionated patterns with very low heavy REE (HREE) contents (Yb≤1.8 ppm, Y≤18 ppm). Consequently, high Sr/Y and La/Yb ratios are typical and discriminating features of adakitic magmas, indicative of melting of a mafic source where garnet and/or hornblende are residual phases. Adakitic magmas are only found in subduction zone environments, exclusively where the subduction and/or the subducted slab are young (subducted and where the adakitic character of the lavas correlates well with the young age of the subducting oceanic lithosphere. In typical subduction zones, the subducted lithosphere is older than 20 Ma, it is cool and the geothermal gradient along the Benioff plane is low such that the oceanic crust dehydrates before it reaches the solidus temperature of hydrated tholeiite. Consequently, the basaltic slab cannot melt. The released large ion lithophile element (LILE)-rich fluids rise up into the mantle wedge, inducing both its metasomatism and partial melting. Afterwards, the residue is made up of olivine+clinopyroxene+orthopyroxene, such that the partial melts are HREE-rich (low La/Yb and Sr
Effect of thicker oceanic crust in the Archaean on the growth of continental crust through time
International Nuclear Information System (INIS)
Wilks, M.E.
1988-01-01
Present crustal evolution models fail to account for the generation of the large volume of continental crust in the required time intervals. All Archaean plate tectonic models, whether invoking faster spreading rates, similar to today's spreading rates, or longer ridge lengths, essentially propose that continental crust has grown by island arc accretion due to the subduction of oceanic crust. The petrological differences that characterize the Archaean from later terrains result from the subduction of hotter oceanic crust into a hotter mantle. If the oceanic crust was appreciably thicker in the Archaean, as geothermal models would indicate, this thicker crust is surely going to have an effect on tectonic processes. A more valid approach is to compare the possible styles of convergence of thick oceanic crust with modern convergence zones. The best modern analog occurs where thick continental crust is colliding with thick continental crust. Oceanic crustal collision on the scale of the present-day Himalayan continental collision zone may have been a frequent occurrence in the Archaean, resulting in extensive partial melting of the hydrous underthrust oceanic crust to produce voluminous tonalite melts, leaving a depleted stabilized basic residuum. Present-day island arc accretion may not have been the dominant mechanism for the growth of the early Archaean crust
Methanosarcina plays a main role during methanogenesis of high-solids food waste and cardboard.
Capson-Tojo, Gabriel; Trably, Eric; Rouez, Maxime; Crest, Marion; Bernet, Nicolas; Steyer, Jean-Philippe; Delgenès, Jean-Philippe; Escudié, Renaud
2018-04-07
Anaerobic digestion of food waste is a complex process often hindered by high concentrations of volatile fatty acids and ammonia. Methanogenic archaea are more sensitive to these inhibitors than bacteria and thus the structure of their community is critical to avoid reactor acidification. In this study, the performances of three different inocula were compared using batch digestion tests of food waste and cardboard mixtures. Particular attention was paid to the archaeal communities in the inocula and after digestion. While the tests started with inocula rich in Methanosarcina led to efficient methane production, VFAs accumulated in the reactors where inocula initially were poor in this archaea and no methane was produced. In addition, higher substrate loads were tolerated when greater proportions of Methanosarcina were initially present in the inoculum. Independently of the inoculum origin, Methanosarcina were the dominant methanogens in the digestates from the experiments that efficiently produced methane. These results suggest that the initial archaeal composition of the inoculum is crucial during reactor start-up to achieve stable anaerobic digestion at high concentrations of ammonia and organic acids. Copyright © 2018 Elsevier Ltd. All rights reserved.
Stable isotope composition and volume of Early Archaean oceans
DEFF Research Database (Denmark)
Pope, Emily Catherine; Rosing, Minik Thorleif; Bird, Dennis K.
via biogenic methanogenesis [2]. Mass balance considerations within the Earth system places a cumulative upper limit on elemental hydrogen loss to space of ~1.8x1022mol elemental hydrogen H, constraining maximum Archaean atmospheric methane levels at ~3.8Ga to
Directory of Open Access Journals (Sweden)
Jean H. Bédard
2018-01-01
Full Text Available The lower plate is the dominant agent in modern convergent margins characterized by active subduction, as negatively buoyant oceanic lithosphere sinks into the asthenosphere under its own weight. This is a strong plate-driving force because the slab-pull force is transmitted through the stiff sub-oceanic lithospheric mantle. As geological and geochemical data seem inconsistent with the existence of modern-style ridges and arcs in the Archaean, a periodically-destabilized stagnant-lid crust system is proposed instead. Stagnant-lid intervals may correspond to periods of layered mantle convection where efficient cooling was restricted to the upper mantle, perturbing Earth's heat generation/loss balance, eventually triggering mantle overturns. Archaean basalts were derived from fertile mantle in overturn upwelling zones (OUZOs, which were larger and longer-lived than post-Archaean plumes. Early cratons/continents probably formed above OUZOs as large volumes of basalt and komatiite were delivered for protracted periods, allowing basal crustal cannibalism, garnetiferous crustal restite delamination, and coupled development of continental crust and sub-continental lithospheric mantle. Periodic mixing and rehomogenization during overturns retarded development of isotopically depleted MORB (mid-ocean ridge basalt mantle. Only after the start of true subduction did sequestration of subducted slabs at the core-mantle boundary lead to the development of the depleted MORB mantle source. During Archaean mantle overturns, pre-existing continents located above OUZOs would be strongly reworked; whereas OUZO-distal continents would drift in response to mantle currents. The leading edge of drifting Archaean continents would be convergent margins characterized by terrane accretion, imbrication, subcretion and anatexis of unsubductable oceanic lithosphere. As Earth cooled and the background oceanic lithosphere became denser and stiffer, there would be an increasing
the origin of late archaean granitoids in the sukumaland greenstone
African Journals Online (AJOL)
Mgina
melting at the base of a late Archaean thickened sub-arc basaltic crust. Melting to form the Suite 1 granitoids occurred in the eclogite stability field whereas Suite 2 formed by melting at shallower ... of TTG in terms of slab melting processes.
Beintema, K.A.
2003-01-01
The Archaean era lasted for about one third of the Earth's history, from ca 4.0 until 2.5 billion years ago. Because the Archaean spans such a long time, knowledge about this era is for understanding the evolution of the Earth until the present day, especially because it is the time
Beintema, K.A.
2003-01-01
The Archaean era lasted for about one third of the Earth's history, from ca 4.0 until 2.5 billion years ago. Because the Archaean spans such a long time, knowledge about this era is for understanding the evolution of the Earth until the present day, especially because it is the time offormation of
Genetic manipulation of Methanosarcina spp.
Directory of Open Access Journals (Sweden)
Petra Regine Adelheid Kohler
2012-07-01
Full Text Available The discovery of the third domain of life, the Archaea, is one of the most exciting findings of the last century. These remarkable prokaryotes are well known for their adaptations to extreme environments; however, Archaea have also conquered moderate environments. Many of the archaeal biochemical processes, such as methane production, are unique in nature and therefore of great scientific interest. Although formerly restricted to biochemical and physiological studies, sophisticated systems for genetic manipulation have been developed during the last two decades for methanogenic archaea, halophilic archaea and thermophilic, sulfur-metabolizing archaea. The availability of these tools has allowed for more complete studies of archaeal physiology and metabolism and most importantly provides the basis for the investigation of gene expression, regulation and function. In this review we provide an overview of methods for genetic manipulation of Methanosarcina spp., a group of methanogenic archaea that are key players in the global carbon cycle and which can be found in a variety of anaerobic environments.
Studying gene regulation in methanogenic archaea.
Rother, Michael; Sattler, Christian; Stock, Tilmann
2011-01-01
Methanogenic archaea are a unique group of strictly anaerobic microorganisms characterized by their ability, and dependence, to convert simple C1 and C2 compounds to methane for growth. The major models for studying the biology of methanogens are members of the Methanococcus and Methanosarcina species. Recent development of sophisticated tools for molecular analysis and for genetic manipulation allows investigating not only their metabolism but also their cell cycle, and their interaction with the environment in great detail. One aspect of such analyses is assessment and dissection of methanoarchaeal gene regulation, for which, at present, only a handful of cases have been investigated thoroughly, partly due to the great methodological effort required. However, it becomes more and more evident that many new regulatory paradigms can be unraveled in this unique archaeal group. Here, we report both molecular and physiological/genetic methods to assess gene regulation in Methanococcus maripaludis and Methanosarcina acetivorans, which should, however, be applicable for other methanogens as well. Copyright © 2011 Elsevier Inc. All rights reserved.
A hitherto unknown river type from the Archaean at Bhurkuli (Jharkhand, E India
Directory of Open Access Journals (Sweden)
Loon A.J. (Tom van
2017-06-01
Full Text Available The Archaean granitoid pluton of the Singhbhum craton in E India is overlain by Archaean to Palaeoproterozoic metasediments. These sediments are still poorly known and their stratigraphy is under debate. Several scattered, most probably Meso- to Neoarchaean, conglomerates are present in the state of Jharkhand that differ so much in characteristics that they are probably not related to each other. The sedimentology of a series of conglomerate patches and layers near Bhurkuli has been investigated, including the characteristics of the clasts. It is deduced on the basis of these characteristics and the sedimentological context that the Bhurkuli conglomerates represent the channel facies of a river system that differed from the types of fluvial systems that exist nowadays.
Czech Academy of Sciences Publication Activity Database
Lin, Qiang; Fang, X.; Ho, A.; Li, J.; Yan, X.; Tu, B.; Li, Ch.; Li, J.; Yao, M.; Li, X.
2017-01-01
Roč. 101, č. 19 (2017), s. 7303-7316 ISSN 0175-7598 Institutional support: RVO:60077344 Keywords : Methanosarcina barkeri * substrate regimes * diversity * co-expression * ecological strategies Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.420, year: 2016
Geranylfarnesyl diphosphate synthase from Methanosarcina mazei: Different role, different evolution
International Nuclear Information System (INIS)
Ogawa, Takuya; Yoshimura, Tohru; Hemmi, Hisashi
2010-01-01
The gene of (all-E) geranylfarnesyl diphosphate synthase that is responsible for the biosynthesis of methanophenazine, an electron carrier utilized for methanogenesis, was cloned from a methanogenic archaeon Methanosarcina mazei Goe1. The properties of the recombinant enzyme and the results of phylogenetic analysis suggest that the enzyme is closely related to (all-E) prenyl diphosphate synthases that are responsible for the biosynthesis of respiratory quinones, rather than to the enzymes involved in the biosynthesis of archaeal membrane lipids, including (all-E) geranylfarnesyl diphosphate synthase from a thermophilic archaeon.
International Nuclear Information System (INIS)
Bagas, L.
1999-01-01
The Archaean granite-greenstone rocks of the Marymia Inlier outcrop within Proterozoic rocks forming the Capricorn Orogen. Five major deformation events are recognised in the rocks of the Plutonic Well and Baumgarten greenstone belts. The first two events were Late Archaean and synchronous with major epithermal gold mineralisation in the belts. Palaeoproterozoic extensional faulting was probably related to the early stages of the Capricorn Orogeny. The fourth event records a compressional phase of the Capricorn Orogeny associated with greenschist-facies metamorphism, whereas the last major event involved wrench faulting associated with minor folding. The Archaean tectonic history, rock types and timing of mineralisation strongly suggest that the Marymia Inlier is part of the Yilgarn Craton, and that each of the provinces in the craton experienced the same geological history since 2.72 Ga. The inlier is now interpreted to include two components, one is the eastern or northern extension of either the Narryer Terrane. Murchison Province or Southern Cross Province, and the other is the northwestern extension of the Eastern Goldfields Province. The Jenkin Fault, which was active in Proterozoic times, separates these two components. Copyright (1999) Blackwell Science Pty Ltd
Manganiferous minerals of the epidote group from the Archaean basement of West Greenland
DEFF Research Database (Denmark)
Katerinopoulou, Anna; Balic Zunic, Tonci; Kolb, Jochen
2014-01-01
The chemical compositions and crystal structures of Mn3+-containing minerals from the epidote group in Greenland rocks are investigated and described in detail. They occur in hydrothermally altered Archaean mafic sequences within the gneissic complex of the North Atlantic craton of West Greenland...
DEFF Research Database (Denmark)
Lange, Marianne; Tolker-Nielsen, Tim; Molin, Søren
2000-01-01
An in situ reverse transcription-PCR protocol for detecting specific mRNA in Methanosarcina mazei S-6 is described. This method allowed us to detect heat shock-induced increases in the intracellular levels of the transcript of the universal stress gene dnaK. The cell walls of paraformaldehyde...
Archaean ultra-depleted komatiites formed by hydrous melting of cratonic mantle.
Wilson, A H; Shirey, S B; Carlson, R W
2003-06-19
Komatiites are ultramafic volcanic rocks containing more than 18 per cent MgO (ref. 1) that erupted mainly in the Archaean era (more than 2.5 gigayears ago). Although such compositions occur in later periods of Earth history (for example, the Cretaceous komatiites of Gorgona Island), the more recent examples tend to have lower MgO content than their Archaean equivalents. Komatiites are also characterized by their low incompatible-element content, which is most consistent with their generation by high degrees of partial melting (30-50 per cent). Current models for komatiite genesis include the melting of rock at great depth in plumes of hot, diapirically rising mantle or the melting of relatively shallow mantle rocks at less extreme, but still high, temperatures caused by fluxing with water. Here we report a suite of ultramafic lava flows from the Commondale greenstone belt, in the southern part of the Kaapvaal Craton, which represents a previously unrecognized type of komatiite with exceptionally high forsterite content of its igneous olivines, low TiO(2)/Al(2)O(3) ratio, high silica content, extreme depletion in rare-earth elements and low Re/Os ratio. We suggest a model for their formation in which a garnet-enriched residue left by earlier cratonic volcanism was melted by hydration from a subducting slab.
DEFF Research Database (Denmark)
Holmes, Dawn E; Orellana, Roberto; Giloteaux, Ludovic
2017-01-01
Previous studies of in situ bioremediation of uranium-contaminated groundwater with acetate injections have focused on the role of Geobacter species in U(VI) reduction because of a lack of other abundant known U(VI)-reducing microorganisms. Monitoring the levels of methyl CoM reductase subunit...... an important role in the long-term bioremediation of uranium-contaminated aquifers after depletion of Fe(III) oxides limits the growth of Geobacter species. The results also suggest that Methanosarcina have the potential to influence uranium geochemistry in a diversity of anaerobic sedimentary environments....
Maibam, B.; Goswami, J. N.; Srinivasan, R.
2009-04-01
Dharwar craton is one of the major Archaean crustal blocks in the Indian subcontinent. The craton is comprised of two blocks, western and eastern. The western domain is underlain by orthogneisses and granodiorites (ca. 2.9-3.3 Ga) collectively termed as Peninsular Gneiss [e.g., 1] interspersed with older tracts of metasedimentary and metamorphosed igneous suites (Sargur Group and Dharwar Group; [2]). The eastern part of the craton is dominated by Late Archaean (2.50-2.75 Ga) granitoids and their gneissic equivalents. They are interspersed with schist belts (also of Sargur Group and Dharwar Group), which are lithologically similar to the Dharwar Supergroup in the western block, but are in different metamorphic dress. Here we report 207Pb-206Pb age of zircons separated from the metasedimentary and gneissic samples from the two blocks to constrain the evolution of the Dharwar craton during the early Archaean. Detrital zircons of the metasedimentary rocks from both the blocks show a wide range of overlapping ages between ~2.9 to >3.5 Ga. Zircon ages of the orthogneisses from the two blocks showed that most of the analysed grains of the eastern Dharwar block are found to be of the age as old as the western Dharwar gneisses. Imprints of younger events could be discerned from the presence of overgrowths in zircons from the studied samples throughout the craton. Our data suggest that crust forming cycles in the two blocks of the Dharwar craton occurred contemporaneously during the Archaean. References [1] Beckinsale, R.D., Drury, S.A., Holt, R.W. (1980) Nature 283, 469-470. [2] Swami Nath J., Ramakrishnan M., Viswanatha M.N. (1976) Rec. Geol. Surv. Ind., 107, 149-175.
Nisbet, E. G.; Cheadle, M. J.; Arndt, N. T.; Bickle, M. J.
1993-09-01
The maximum potential temperature of the Archaean mantle is poorly known, and is best constrained by the MgO contents of komatiitic liquids, which are directly related to eruptive temperatures. However, most Archaean komatiites are significantly altered and it is difficult to assess the composition of the erupted liquid. Relatively fresh lavas from the SASKMAR suite, Belingwe Greenstone Belt, Zimbabwe (2.7 Ga) include chills of 25.6 wt.% MgO, and olivines ranging to Fo 93.6, implying eruption at around 1520°C. A chill sample from Alexo Township, Ontario (also 2.7 Ga) is 28 wt.% MgO, and associated olivines range to Fo 94.1, implying eruption at 1560°C. However, inferences of erupted liquids containing 32-33 wt.% MgO, from lavas in the Barberton Greenstone Belt, South Africa (3.45 Ga) and from the Perseverance Complex, Western Australia (2.7 Ga) may be challenged on the grounds that they contain excess (cumulate) olivine, or were enriched in Mg during alteration or metamorphism. Re-interpretation of olivine compositions from these rocks shows that they most likely contained a maximum of 29 wt.% MgO corresponding to an eruption temperature of 1580°C. This composition is the highest liquid MgO content of an erupted lava that can be supported with any confidence. The hottest modern magma, on Gorgona Island (0.155 Ga) contained 18-20% MgO and erupted at circa 1400°C. If 1580°C is taken as the temperature of the most magnesian known eruption, then the source mantle from which the liquids rose would have been at up to 2200°C at pressures of 18 GPa corresponding to a mantle potential temperature of 1900°C. These temperatures are in excess of the mantle temperatures predicted by secular cooling models, and thus komatiites can only be formed in hot rising convective jets in the mantle. This result requires that Archaean mantle jets may have been 300°C hotter than the Archaean ambient mantle temperature. This temperature difference is similar to the 200-300
Duda, Jan-Peter; Thiel, Volker; Bauersachs, Thorsten; Mißbach, Helge; Reinhardt, Manuel; Schäfer, Nadine; Van Kranendonk, Martin J.; Reitner, Joachim
2018-03-01
Archaean hydrothermal chert veins commonly contain abundant organic carbon of uncertain origin (abiotic vs. biotic). In this study, we analysed kerogen contained in a hydrothermal chert vein from the ca. 3.5 Ga Dresser Formation (Pilbara Craton, Western Australia). Catalytic hydropyrolysis (HyPy) of this kerogen yielded n-alkanes up to n-C22, with a sharp decrease in abundance beyond n-C18. This distribution ( ≤ n-C18) is very similar to that observed in HyPy products of recent bacterial biomass, which was used as reference material, whereas it differs markedly from the unimodal distribution of abiotic compounds experimentally formed via Fischer-Tropsch-type synthesis. We therefore propose that the organic matter in the Archaean chert veins has a primarily microbial origin. The microbially derived organic matter accumulated in anoxic aquatic (surface and/or subsurface) environments and was then assimilated, redistributed and sequestered by the hydrothermal fluids (hydrothermal pump hypothesis).
Witwatersrand gold deposits formed by volcanic rain, anoxic rivers and Archaean life
Heinrich, Christoph A.
2015-03-01
The Witwatersrand Basin in South Africa is one of the best-preserved records of fluvial sedimentation on an Archaean continent. The basin hosts the worlds biggest gold resource in thin pebble beds, but the process for gold enrichment is debated. Mechanical accumulation of gold particles from flowing river water is the prevailing hypothesis, yet there is evidence for hydrothermal mobilization of gold by fluids invading the metasedimentary rocks after their burial. Earth's atmosphere three billion years ago was oxygen free, but already sustained some of the oldest microbial life on land. Here I use thermodynamic modelling and mass-balance calculations to show that these conditions could have led to the chemical transport and precipitation of gold in anoxic surface waters, reconciling the evidence for fluvial deposition with evidence for hydrothermal-like chemical reactions. I suggest that the release of sulphurous gases from large volcanic eruptions created acid rain that enabled the dissolution and transport of gold in surface waters as sulphur complexes. Precipitation of the richest gold deposits could have been triggered by chemical reduction of the dissolved gold onto organic material in shallow lakes and pools. I conclude that the Witwatersrand gold could have formed only during the Archaean, after the emergence of continental life but before the rise of oxygen in the Earth's atmosphere.
Why Archaean TTG cannot be generated by MORB melting in subduction zones
Martin, Hervé; Moyen, Jean-François; Guitreau, Martin; Blichert-Toft, Janne; Le Pennec, Jean-Luc
2014-06-01
Until recently it was assumed that the Archaean continental crust (made of TTGs: tonalites, trondhjemites, and granodiorites) was generated through partial melting of MORB-like basalts in hot subduction environments, where the subducted oceanic crust melted at high pressure, leaving a garnet-bearing amphibolitic or eclogitic residue. However, recent geochemical models as well as basalt melting experiments have precluded MORB as a plausible source for TTGs. Rather, geochemical and experimental evidences indicate that formation of TTG required a LILE-enriched source, similar to oceanic plateau basalts. Moreover, subduction is a continuous process, while continental growth is episodic. Several “super-growth events” have been identified at ~ 4.2, ~ 3.8, ~ 3.2, ~ 2.7, ~ 1.8, ~ 1.1, and ~ 0.5 Ga, which is inconsistent with the regular pattern that would be expected from a subduction-driven process. In order to account for this periodicity, it has been proposed that, as subduction proceeds, descending residual slabs accumulate at the 660-km seismic discontinuity. When stored oceanic crust exceeds a certain mass threshold, it rapidly sinks into the mantle as a cold avalanche, which induces the ascent of mantle plumes that in turn produce large amounts of magmas resulting in oceanic plateaus. However, melting at the base of thick oceanic plateaus does not appear to be a realistic process that can account for TTG genesis. Modern oceanic plateaus contain only small volumes (≤ 5%) of felsic magmas generally formed by high degrees of fractional crystallization of basaltic magmas. The composition of these felsic magmas drastically differs from that of TTGs. In Iceland, the interaction between a mantle plume and the mid-Atlantic ridge gives rise to an anomalously (Archaean-like) high geothermal gradient resulting in thick basaltic crust able to melt at shallow depth. Even in this favorable context though, the characteristic Archaean TTG trace element signature is not being
Directory of Open Access Journals (Sweden)
Claudia Ehlers
2002-01-01
Full Text Available The mesophilic methanogenic archaeon Methanosarcina mazei strain Gö1 is able to utilize molecular nitrogen (N2 as its sole nitrogen source. We have identified and characterized a single nitrogen fixation (nif gene cluster in M. mazei Gö1 with an approximate length of 9 kbp. Sequence analysis revealed seven genes with sequence similarities to nifH, nifI1, nifI2, nifD, nifK, nifE and nifN, similar to other diazotrophic methanogens and certain bacteria such as Clostridium acetobutylicum, with the two glnB-like genes (nifI1 and nifI2 located between nifH and nifD. Phylogenetic analysis of deduced amino acid sequences for the nitrogenase structural genes of M. mazei Gö1 showed that they are most closely related to Methanosarcina barkeri nif2 genes, and also closely resemble those for the corresponding nif products of the gram-positive bacterium C. acetobutylicum. Northern blot analysis and reverse transcription PCR analysis demonstrated that the M. mazei nif genes constitute an operon transcribed only under nitrogen starvation as a single 8 kb transcript. Sequence analysis revealed a palindromic sequence at the transcriptional start site in front of the M. mazei nifH gene, which may have a function in transcriptional regulation of the nif operon.
Recycling of the Archaean continental crust: the case study of the Gavião, State of Bahia, NE Brazil
Pinto, M. Santos; Peucat, J. J.; Martin, H.; Sabaté, P.
1998-09-01
The Gavião block, located to the west of the São Francisco Craton (State of Bahia, NE Brazil), is the oldest crustal block so far recognised in South America—3.42 Ga. In its southern part, the Gavião block has been divided into three domains on the basis of 207Pb/ 206Pb dating on single zircons and monazites combined with Sr and Nd isotopic data and major and trace element geochemical modelling. These are: (1) an Archaean juvenile domain which consists of grey gneisses (Bernada massif) which evidence mantle extraction around 3.3 Ga; (2) an Archaean domain (3.24-3.16 Ga) either recycled, or juvenile with crustal contamination, consisting of trondhjemitic grey gneisses (Aracatu massif) and K-rich calc-alkaline granitic gneisses (Mariana and Serra do Eixo massifs); (3) a Paleoproterozoic recycled domain consisting mainly of the Umburanas granites, which yielded inherited zircons ages ranging from 3.1 to 2.8 Ga, whereas the monazite age is ca 2.0 Ga. The Aracatu and Mariana massifs are cut by granites at ca 2.0 Ga the same age of the Serra da Franga massif. The Gavião block is a type example of Archaean continental crust (3.2 Ga) that has been recycled through partial melting events mainly in Paleoproterozoic times during the Transamazonian orogeny (2.0-2.1 Ga). Brasiliano cooling ages are recorded by the Rb-Sr system of biotite-whole rock pairs ca 500 Ma.
International Nuclear Information System (INIS)
Robb, L.J.; Meyer, M.; Ferraz, M.F.; Drennan, G.R.
1989-05-01
Approximately 500 samples from the Archaean granitic basement of the southern Kaapvaal Craton have been analysed, for U and Th. When viewed in conjunction with geological relationships, the radioelement distribution patterns in the Archaean basement provide contraints regarding the origin of uranium in the Witwatersrand Basin. Granites in the Baberton region are sub-divided into three magnetic cycles, the earliest cycle comprising tonalite-trondhjemite gneisses, the intermediate cycle comprising literally extensive K-rich batholiths and the final stage consisting of discrete intrusive granitic plutons. Uranium and thorium contents vary as a function of age and rock type, an increase progressively from the first cycle through to the third cycle. Certain of the late granite plutons may have been S-type in origin, have relatively low Th/U ratios, high U contents, and are characterized by accessory minerals dominated by monazite-like phases. The late granite plutons with highest radioelement contents appear to have formed circa 2,8 Ga, an age which coincides with granulite facies metamorphism and uranium-thorium depletion in the lower crust, as recrorded in the Vredeford crustal profile. Uranium has been leached from portions of the regolith profile, but also concentrated into leucoxene-rich zones derived from the breakdown of pre-existing titanium-bearing phases. The widespread development of an uraniferous leucoxene protore in weathered source rocks of the Witwatersrand Basin has relevance to the genesis of authigenic U-Ti phases (brannerite) in the reefs themselves. The study of radioelement distribution in Archaean granites adjacent to the Witwatersrand Basin provides a framework within which considerations regarding the origin of the uranium deposits in the basin can be viewed. The secular evolution of the Archaean granitic basement, hydrothermal processes, and palaeoweathering all played a role in the formation of the Witwatersrand deposits
Directory of Open Access Journals (Sweden)
J.-P. Duda
2018-03-01
Full Text Available Archaean hydrothermal chert veins commonly contain abundant organic carbon of uncertain origin (abiotic vs. biotic. In this study, we analysed kerogen contained in a hydrothermal chert vein from the ca. 3.5 Ga Dresser Formation (Pilbara Craton, Western Australia. Catalytic hydropyrolysis (HyPy of this kerogen yielded n-alkanes up to n-C22, with a sharp decrease in abundance beyond n-C18. This distribution ( ≤ n-C18 is very similar to that observed in HyPy products of recent bacterial biomass, which was used as reference material, whereas it differs markedly from the unimodal distribution of abiotic compounds experimentally formed via Fischer–Tropsch-type synthesis. We therefore propose that the organic matter in the Archaean chert veins has a primarily microbial origin. The microbially derived organic matter accumulated in anoxic aquatic (surface and/or subsurface environments and was then assimilated, redistributed and sequestered by the hydrothermal fluids (hydrothermal pump hypothesis.
Directory of Open Access Journals (Sweden)
Zhen Yan
2017-02-01
Full Text Available Heterodisulfide reductases (Hdr of the HdrABC class are ancient enzymes and a component of the anaerobic core belonging to the prokaryotic common ancestor. The ancient origin is consistent with the widespread occurrence of genes encoding putative HdrABC homologs in metabolically diverse prokaryotes predicting diverse physiological functions; however, only one HdrABC has been characterized and that was from a narrow metabolic group of obligate CO2-reducing methanogenic anaerobes (methanogens from the domain Archaea. Here we report the biochemical characterization of an HdrABC homolog (HdrA2B2C2 from the acetate-utilizing methanogen Methanosarcina acetivorans with unusual properties structurally and functionally distinct from the only other HdrABC characterized. Homologs of the HdrA2B2C2 archetype are present in phylogenetically and metabolically diverse species from the domains Bacteria and Archaea. The expression of the individual HdrA2, HdrB2, and HdrB2C2 enzymes in Escherichia coli, and reconstitution of an active HdrA2B2C2 complex, revealed an intersubunit electron transport pathway dependent on ferredoxin or coenzyme F420 (F420H2 as an electron donor. Remarkably, HdrA2B2C2 couples the previously unknown endergonic oxidation of F420H2 and reduction of ferredoxin with the exergonic oxidation of F420H2 and reduction of the heterodisulfide of coenzyme M and coenzyme B (CoMS-SCoB. The unique electron bifurcation predicts a role for HdrA2B2C2 in Fe(III-dependent anaerobic methane oxidation (ANME by M. acetivorans and uncultured species from ANME environments. HdrA2B2C2, ubiquitous in acetotrophic methanogens, was shown to participate in electron transfer during acetotrophic growth of M. acetivorans and proposed to be essential for growth in the environment when acetate is limiting.
New Perspectives on Acetate and One-Carbon Metabolism in the Methanoarchaea
Energy Technology Data Exchange (ETDEWEB)
Ferry, James [Pennsylvania State Univ., University Park, PA (United States)
2017-03-20
Carbonic anhydrases catalyze the reversible hydration of carbon dioxide to bicarbonate. Although widespread in prokaryotes of the domains Bacteria and Archaea, few have been investigated and the physiological functions are largely unknown. Carbonic anhydrases are of biotechnological interest for carbon dioxide capture and sequestration at point sources. Prokaryotes encode three independently evolved classes. The alpha-class is restricted to a few pathogens and the other two are uniformly distributed in phylogenetically and physiologically diverse species. Although wide-spread in prokaryotes, only three gamma-class enzymes have been biochemically characterized and the physiological functions have not been investigated. The gamma-class is prominent in anaerobic acetate-utilizing methane-producing species of the genus Methanosarcina that encode three subclasses. Enzymes from two of the subclasses, Cam and CamH from Methanosarcina thermophila, have been characterized and found to utilize iron in the active site which is the first example of an iron-containing carbonic anhydrase. No representative of the third subclass has been isolated, although this subclass constitutes the great majority of the β-class. This grant application proposed to characterize gamma-class carbonic anhydrases from diverse anaerobic prokaryotes from the domains Bacteria and Archaea to broaden the understanding of this enzyme. In particular, the three subclasses present the genetically tractable acetate-utilizing methanogen Methanosarcina acetivorans will be investigated to extend studies of acetate and one-carbon metabolism in this species. A genetic approach will be taken to ascertain the physiological functions. It is also proposed to delve deeper into the mechanism of Cam from M. thermophila, the archetype of the gamma-class, via a high resolution neutron structure and kinetic analysis of site-specific amino acid replacement variants. In the course of the investigation, goals were added to
Mineral transformations associated with goethite reduction by Methanosarcina barkeri
Liu, D.; Wang, Hongfang; Dong, H.; Qiu, X.; Dong, X.; Cravotta, C.A.
2011-01-01
To investigate the interaction between methanogens and iron-containing minerals in anoxic environments, we conducted batch culture experiments with Methanosarcina barkeri in a phosphate-buffered basal medium (PBBM) to bioreduce structural Fe(III) in goethite with hydrogen as the sole substrate. Fe(II) and methane concentrations were monitored over the course of the bioreduction experiments with wet chemistry and gas chromatography, respectively. Subsequent mineralogical changes were characterized with X-ray diffraction (XRD) and scanning electron microscopy (SEM). In the presence of an electron shuttle anthraquinone-2,6-disulfonate (AQDS), 30% Fe(III) in goethite (weight basis) was reduced to Fe(II). In contrast, only 2% Fe(III) (weight basis) was bioreduced in the absence of AQDS. Most of the bioproduced Fe(II) was incorporated into secondary minerals including dufr??nite and vivianite. Our data implied a dufr??nite-vivianite transformation mechanism where a metastable dufr??nite transformed to a more stable vivianite over extended time in anaerobic conditions. Methanogenesis was greatly inhibited by bioreduction of goethite Fe(III). These results have important implications for the methane flux associated with Fe(III) bioreduction and ferrous iron mineral precipitation in anaerobic soils and sediments. ?? 2011 Elsevier B.V.
Did the formation of D″ cause the Archaean-Proterozoic transition?
Campbell, Ian H.; Griffiths, Ross W.
2014-02-01
The MgO content of the highest MgO plume-related komatiites and picrites remained constant at 32±2.5% between 3.5 and 2.7 Ga, then fell to 21±3% by ca. 2.0 Ga, a value similar to the present day value. Because there is a linear relationship between the liquidus temperature of dry magmas and their MgO content this observation implies that the temperature of mantle plumes changed little between 3.5 and 2.7 Ga, and then fell by 200-250 °C between 2.7 and 2.0 Ga to a temperature similar to that of present plumes. We suggest that Archaean plumes originate from the core-mantle boundary and that their temperature remained constant because the temperature of the outer core was buffered by solidification of the Fe-Ni inner core. At about 2.7 Ga dense former basaltic crust began to accumulate at the core and eventually covered it to produce an insulating layer that reduced the heat flux out of the core and lowered the temperature of mantle plumes. The temperature of mantle plumes fell as the dense layer above the core thickened until it exceeded the critical thickness required for convection. Because heat is transferred rapidly across the convecting part of the insulating layer, any further increase in its thickness by the addition more basaltic material has no influence on the temperature at the top of the layer, which is the source of Post-Archaean mantle plumes. We equate the dense layer above the core with the seismically identified layer D″. Our analyses suggest the drop in plume temperatures produced by a dense insulating layer above the core will be about 40% once it starts to convect, which is consistent with the observed drop inferred from the decrease in the MgO content of komatiites and picrites at that time.
DEFF Research Database (Denmark)
Rosing, Minik Thorleif; Brid, Dennis K.; Sleep, Norman H.
into account the apparent growth of Earth continents (Collerson and Kamber 1999) and the absence of land vegetation during the Precambrian for the evolution of the surface albedo, and a model for the abundance and properties of clouds that takes into account the lower abundance of biogenic cloud condensation......There is ample geological evidence that Earth’s climate resembled the present during the Archaean, despite a much lower solar luminosity. This was cast as a paradox by Sagan and Mullen in 1972. Several solutions to the paradox have been suggested, mostly focusing on adjustments of the radiative...... properties of Earth’s atmosphere e.g. Kasting (1993), by increasing the mixing ratio of CO2 and/or adding various other greenhouse gasses. We have used banded iron formation (BIF), which are chemical sediments precipitated out of the Archaean ocean to characterize the composition of the atmosphere...
International Nuclear Information System (INIS)
Zhuang, Ningning; Seo, Kyung Hye; Chen, Cong; Zhou, Jia; Kim, Seon Won; Lee, Kon Ho
2012-01-01
Recombinant mevalonate kinase from M. mazei has been crystallized. Diffraction data were collected to 2.08 Å resolution. Mevalonate kinase (MVK), which plays an important role in catalysing the biosynthesis of isoprenoid compounds derived from the mevalonate pathway, transforms mevalonate to 5-phosphomevalonate using ATP as a cofactor. Mevalonate kinase from Methanosarcina mazei (MmMVK) was expressed in Escherichia coli, purified and crystallized for structural analysis. Diffraction-quality crystals of MmMVK were obtained by the vapour-diffusion method using 0.32 M MgCl 2 , 0.08 M bis-tris pH 5.5, 16%(w/v) PEG 3350. The crystals belonged to space group P2 1 2 1 2, with unit-cell parameters a = 97.11, b = 135.92, c = 46.03 Å. Diffraction data were collected to 2.08 Å resolution
DEFF Research Database (Denmark)
Holmes, Dawn E; Orellana, Roberto; Giloteaux, Ludovic
2018-01-01
Previous studies of acetate-promoted bioremediation of uranium-contaminated aquifers focused on Geobacter because no other microorganisms that can couple the oxidation of acetate with U(VI) reduction had been detected in situ. Monitoring the levels of methyl CoM reductase subunit A (mcrA) transcr......Previous studies of acetate-promoted bioremediation of uranium-contaminated aquifers focused on Geobacter because no other microorganisms that can couple the oxidation of acetate with U(VI) reduction had been detected in situ. Monitoring the levels of methyl CoM reductase subunit A (mcr......(VI) reduction was observed in inactive controls. These results demonstrate that Methanosarcina species could play an important role in the long-term bioremediation of uranium-contaminated aquifers after depletion of Fe(III) oxides limits the growth of Geobacter species. The results also suggest...
Glikson, A. Y.
1992-01-01
Since the oldest intact terrestrial rocks of ca. 4.0 Ga and oldest zircon xenocrysts of ca. 4.3 Ga measured to date overlap with the lunar late heavy bombardment, the early Precambrian record requires close reexamination vis a vis the effects of megaimpacts. The identification of microtektite-bearing horizons containing spinals of chondritic chemistry and Ir anomalies in 3.5-3.4-Ga greenstone belts provides the first direct evidence for large-scale Archaean impacts. The Archaean crustal record contains evidence for several major greenstone-granite-forming episodes where deep upwelling and adiabatic fusion of the mantle was accompanied by contemporaneous crustal anatexis. Isotopic age studies suggest evidence for principal age clusters about 3.5, 3.0, and 2.7 (+/- 0.8) Ga, relics of a ca. 3.8-Ga event, and several less well defined episodes. These peak events were accompanied and followed by protracted thermal fluctuations in intracrustal high-grade metamorphic zones. Interpretations of these events in terms of internal dynamics of the Earth are difficult to reconcile with the thermal behavior of silicate rheologies in a continuously convecting mantle regime. A triggering of these episodes by mantle rebound response to intermittent extraterrestrial asteroid impacts is supported by (1) identification of major Archaean impacts from microtektite and distal ejecta horizons marked by Ir anomalies; (2) geochemical and experimental evidence for mantle upwelling, possibly from levels as deep as the transition zone; and (3) catastrophic adiabatic melting required to generate peridotitic komatites. Episodic differentiation/accretion growth of sial consequent on these events is capable of resolving the volume problem that arises from comparisons between modern continental crust and the estimated sial produced by continuous two-stage mantle melting processes. The volume problem is exacerbated by projected high accretion rates under Archaean geotherms. It is suggested that
Utilization of methanol plus hydrogen by Methanosarcina barkeri for methanogenesis and growth
International Nuclear Information System (INIS)
Mueller, V.; Blaut, M.; Gottschalk, G.
1986-01-01
Methanosarcina barkeri grew on methanol plus H 2 . Both substrates were consumed in equimolar amounts. Growth was strictly dependently on the presence of acetate, which was required for the biosynthesis of cellular constituents. Only about 0.4% of the methane produced originated from acetate. By using deuterated methanol, it was demonstrated that methanogenesis from this compound under H 2 did not occur via oxidation of methanol to CO 2 and subsequent reduction but by direct reduction with H 2 . Growth yields with methanol plus H 2 and with methanol alone were not significantly different: 2.8 g of cells per mol of methanol in mineral medium and 4.6 g of cells per mol of methanol in complex medium, respectively. Growth of M. barkeri on methanol plus H 2 depended strictly on the presence of sodium ions in the medium. In the presence of 50 mM K + the K/sub s/ for Na + was 5 mM
Directory of Open Access Journals (Sweden)
Pietikäinen, K.
1999-06-01
Full Text Available The study area in Vieremä, central Finland, contains part of Archaean-Palaeoproterozoic boundary. In the east, the area comprises Archaean gneiss and the Salahmi Schist Belt. The rocks of the schist belt are turbiditic metagreywackes, with well-preserved depositional structures, occurring as Proterozoic wedge-shaped blocks, and staurolite schists, the latter representing higher-strained and metamorphosed equivalents of the metagreywackes. In the west of the area there is an Archaean gneiss block, containing strongly elongated structures, and deformed Svecofennian supracrustal rocks, which are cut by deformed granitoids. These are juxtaposed with the schist belt. The boundaries of these tectonometamorphic blocks are narrow, highly strained mylonites and thrust zones. The metamorphic grade of the supracrustal rocks increases from east to west, the increase being stepwise across the mylonitic block boundaries. The rocks are more deformed from east to west with younger structures overprinting. In the staurolite schists of the Salahmi Schist Belt, the most prominent structure is a lineation (L2 that overprints the bedding and axial plane foliation. In Sorronmäki quarry, at the western boundary of the schist belt, this Palaeoproterozoic lineation dominates all the structures in tonalite gneiss, which gives a U-Pb age of 2731±6 Ma. Southeast of the quarry, at the same boundary, the Salahmi schists have been overturned towards the northeast, suggesting that the Archaean gneiss at Sorronmäki has been thrust towards the northeast over these rocks. In the western part of the study area, the Leppikangas granodiorite that intrudes the Svecofennian supracrustal rocks gives a U-Pb age of 1891+6 Ma. In the granodiorite, a strong lineation formed by the intersection of two foliations, which maybe L2 is associated with thrusting towards the northeast. The monazite age of the Archaean Sorronmäki gneiss is 1817+3 Ma, and the titanite age of the Svecofennian
New isotopic and field evidence for the ages and distribution of Archaean rocks in east Antarctica
International Nuclear Information System (INIS)
Kinny, P.D.; Delor, C.P.
1990-01-01
The Precambrian shield of East Antarctica is composed of a number of recognised Archaean cratonic nuclei surrounded by Proterozoic metamorphic complexes. Poor exposure, inaccessibility and the effects of multiple tectonothermal overprints combine to confound the knowledge of the early history of these terranes. Against this, it is shown how recent advances in zircon geochronology allied with new petrological, geochemical and field observations have resulted in major revisions to the chronostratigraphy of several key areas, including Napier Complex of Enderby Land, Vestfold Hills and Rauer Group. 11 refs
Eduok, Samuel; Ferguson, Robert; Jefferson, Bruce; Villa, Raffaella; Coulon, Frédéric
2017-12-31
To investigate the potential effect of aged engineered nanoparticles (a-ENPs) on sludge digestion performance, 150L pilot anaerobic digesters (AD) were fed with a blend of primary and waste activated sludge spiked either with a mixture of silver oxide, titanium dioxide and zinc oxide or a mixture of their equivalent bulk metal salts to achieve a target concentration of 250, 2000, and 2800mgkg -1 dry weight, respectively. Volatile fatty acids (VFA) were 1.2 times higher in the spiked digesters and significantly different (p=0.05) from the control conditions. Specifically, isovaleric acid concentration was 2 times lower in the control digester compared to the spiked digesters, whereas hydrogen sulfide was 2 times lower in the ENPs spiked digester indicating inhibitory effect on sulfate reducing microorganisms. Based on the ether-linked isoprenoids concentration, the total abundance of methanogens was 1.4 times lower in the ENPs spiked digester than in the control and metal salt spiked digesters. Pyrosequencing indicated 80% decrease in abundance and diversity of methanogens in ENPs spiked digester compared to the control digester. Methanosarcina acetivorans and Methanosarcina barkeri were identified as nano-tolerant as their relative abundance increased by a factor of 6 and 11, respectively, compared to the other digesters. The results further provide compelling evidence on the resilience of Fusobacteria, Actinobacteria and the Trojan horse-like effect of ENPs which offered a competitive advantage to some organisms while reducing microbial abundance and diversity. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Vidal, M.; Pouclet, A.; Delor, C.; Simeon, Y.; Alric, G.
1996-01-01
The litho-structural features of Palaeo-proterozoic terrains of northeastern Ivory-Coast, greenstones belts and then sedimentary basin Birimian), are similar to those of Archaean terrains. Their early deformation is only voluminal deformation due to granitoid intrusions, mainly between 2.2 and 2.16 Ga. The shortening deformation (main deformation) is expressed by right folds and transcurrent shear zones ca 2.1 Ga. Neither thrust deformation nor high pressure metamorphic assemblages are known. This pattern of flexible and hot crust, at least between 2.2 and 2.16 Ga, is pole apart to a collisional pattern, proposed for West African Craton by some authors. The Archaean/Palaeo-proterozoic boundary would not represent a drastic change of the geodynamic evolution of the crust. (authors). 60 refs., 5 figs., 6 photos
International Nuclear Information System (INIS)
Lovering, J.F.; Comaford, D.J.
1979-01-01
The ion microprobe has been used to study 207 Pb/ 206 Pb ages on 20μm-sized sites on single zircon grains from coastal rocks on either side of the rift in the Gondwanaland Archaean Shield between southwestern Australia and Wilkes Land, Antarctica. The ages on individual sites on zircon grains from a variety of rock types from southwestern Australia show a range from 1600 m.y. to about 3400 m.y., with an inverse dependence on the uranium abundance at each site. Ages of zircons from rocks from the Antartic region show a range from 1600 m.y. to 3100 m.y
Gövert, D.; Conrad, R.
2009-04-01
During the anaerobic degradation of organic matter in anoxic sediments and soils acetate is the most important substrate for the final step in production of CO2 and/or CH4. Sulfate-reducing bacteria (SRB) and methane-producing archaea both compete for the available acetate. Knowledge about the fractionation of 13C/12C of acetate carbon by these microbial groups is still limited. Therefore, we determined carbon isotope fractionation in different cultures of acetate-utilizing SRB (Desulfobacter postgatei, D. hydrogenophilus, Desulfobacca acetoxidans) and methanogens (Methanosarcina barkeri, M. acetivorans). Including literature values (e.g., Methanosaeta concilii), isotopic enrichment factors (epsilon) ranged between -35 and +2 permil, possibly involving equilibrium isotope effects besides kinetic isotope effects. The values of epsilon were dependent on the acetate-catabolic pathway of the particular microorganism, the methyl or carboxyl position of acetate, and the relative availability or limitation of the substrate acetate. Patterns of isotope fractionation in anoxic lake sediments and rice field soil seem to reflect the characteristics of the microorganisms actively involved in acetate catabolism. Hence, it might be possible using environmental isotopic information to determine the type of microbial metabolism converting acetate to CO2 and/or CH4.
Percolation of diagenetic fluids in the Archaean basement of the Franceville basin
Mouélé, Idalina Moubiya; Dudoignon, Patrick; Albani, Abderrazak El; Cuney, Michel; Boiron, Marie-Christine; Gauthier-Lafaye, François
2014-01-01
The Palaeoproterozoic Franceville basin, Gabon, is mainly known for its high-grade uranium deposits, which are the only ones known to act as natural nuclear fission reactors. Previous work in the Kiéné region investigated the nature of the fluids responsible for these natural nuclear reactors. The present work focuses on the top of the Archaean granitic basement, specifically, to identify and date the successive alteration events that affected this basement just below the unconformity separating it from the Palaeoproterozoic basin. Core from four drill holes crosscutting the basin-basement unconformity have been studied. Dating is based on U-Pb isotopic analyses performed on monazite. The origin of fluids is discussed from the study of fluid inclusion planes (FIP) in quartz from basement granitoids. From the deepest part of the drill holes to the unconformable boundary with the basin, propylitic alteration assemblages are progressively replaced by illite and locally by a phengite + Fe chlorite ± Fe oxide assemblage. Illitic alteration is particularly strong along the sediment-granitoid contact and is associated with quartz dissolution. It was followed by calcite and anhydrite precipitation as fracture fillings. U-Pb isotopic dating outlines three successive events: a 3.0-2.9-Ga primary magmatic event, a 2.6-Ga propylitic alteration and a late 1.9-Ga diagenetic event. Fluid inclusion microthermometry suggests the circulation of three types of fluids: (1) a Na-Ca-rich diagenetic brine, (2) a moderately saline (diagenetic + meteoric) fluid, and (3) a low-salinity fluid of probable meteoric origin. These fluids are similar to those previously identified within the overlying sedimentary rocks of the Franceville basin. Overall, the data collected in this study show that the Proterozoic-Archaean unconformity has operated as a major flow corridor for fluids circulation, around 1.9 Ga. highly saline diagenetic brines; hydrocarbon-rich fluids derived from organic matter
DEFF Research Database (Denmark)
Hofman-Bang, H Jacob Peider; Lange, Marianne; Ahring, Birgitte Kiær
1999-01-01
The hsp70 (dnaK) locus of the moderate thermophilic archaeon Methanosarcina thermophila TM-1 was cloned, sequenced, and tested in vitro to measure gene induction by heat and ammonia, i.e., stressors pertinent to the biotechnological ecosystem of this methanogen that plays a key role in anaerobic...... thermoautotrophicum Delta H, from another genus, in which trkA is not part of the locus. The proteins encoded in the TM-1 genes are very similar to the S-6 homologs, but considerably less similar to the Delta H proteins. The TM-1 Hsp70(DnaK) protein has the 23-amino acid deletion-by comparison with homologs from Gram...
Srivastava, Shanti Swaroop; Jamkhindikar, Aditya Anand; Raman, Rajeev; Jobby, Maroor K; Chadalawada, Swathi; Sankaranarayanan, Rajan; Sharma, Yogendra
2017-03-07
βγ-Crystallins are important constituents of the vertebrate eye lens, whereas in microbes, they are prevalent as Ca 2+ -binding proteins. In archaea, βγ-crystallins are conspicuously confined to two methanogens, viz., Methanosaeta and Methanosarcina. One of these, i.e., M-crystallin from Methanosarcina acetivorans, has been shown to be a typical Ca 2+ -binding βγ-crystallin. Here, with the aid of a high-resolution crystal structure and isothermal titration calorimetry, we report that "Methallin", a βγ-crystallin from Methanosaeta thermophila, is a trimeric, transition metal-binding protein. It binds Fe, Ni, Co, or Zn ion with nanomolar affinity, which is consistent even at 55 °C, the optimal temperature for the methanogen's growth. At the center of the protein trimer, the metal ion is coordinated by six histidines, two from each protomer, leading to an octahedral geometry. Small-angle X-ray scattering analysis confirms that the trimer seen in the crystal lattice is a biological assembly; this assembly dissociates to monomers upon removal of the metal ion. The introduction of two histidines (S17H/S19H) into a homologous βγ-crystallin, Clostrillin, allows it to bind nickel at the introduced site, though with micromolar affinity. However, because of the lack of a compatible interface, nickel binding could not induce trimerization, affirming that Methallin is a naturally occurring trimer for high-affinity transition metal binding. While βγ-crystallins are known to bind Ca 2+ and form homodimers and oligomers, the transition metal-binding, trimeric Methallin is a new paradigm for βγ-crystallins. The distinct features of Methallin, such as nickel or iron binding, are also possible imprints of biogeochemical changes during the period of its origin.
Energy Technology Data Exchange (ETDEWEB)
Qiu, Y.; McNaughton, N.J.; Groves, D.I.; Dunphy, J.M. [University of Western Australia, Nedlands, WA (Australia). Centre for Strategic Mineral Deposits, Department of Geology and Geophysics
1999-06-01
Ion microprobe (SHRIMP) U-Pb zircon dating. Pb-Nd isotope tracer studies and major, trace and rare-earth element analyses have identified, for the first time. a Mesoproterozoic (1.2 Ga) quartz diorite intrusion in the central part of the Archaean Yilgarn Craton. Western Australia The quartz diorite is characterised by intergrowths of quartz and plagioclase, having low A/CNK (0 8). low K{sub 2}O (0.28 wt%), Ba (54 ppm), Rb (11 ppm), Sr (92 ppm), Pb (13 ppm), U (1.7 ppm) and Th (6 ppm) contents, high Nd (41 ppm), Sm (10.5 ppm), Zr (399 ppm). Nb (18.5 ppm). Y (57.5 ppm) and Sc (19 ppm) contents. a low Pb isotope two-stage model {mu} value (6.3), and a primitive initial e{sub Nd} value (+3.4) at 1.2 Ga. It is interpreted that the 1.2 Ga quartz diorite was derived from a predominantly mantle source, with minor crustal contamination, possibly from the surrounding Archaean monzogranites or their source region, during magma ascent. The age (1215 {+-} 11 Ma) of the intrusion overlaps with the timing of a major continental collisional orogeny in the Albany-Fraser Orogen, about 400km south, and is broadly coeval with the diamond-bearing Argyle lamproites in the east Kimberley Block. This study extends the history of granitoid magmatism in the central craton by more than 1.0 billion years (2.6 to 1.2 Ga), and has implications for isotopic data interpretations of tectonothermal events in the craton. Copyright (1999) Blackwell Science Pty Ltd 33 refs., 3 tabs., 6 figs.
Directory of Open Access Journals (Sweden)
Kristoffer Szilas
2018-05-01
large-scale melting event(s, which resulted in the ultra-depleted cratonic keel under the North Atlantic Craton. Hence, a better understanding of such Archaean ultramafic complexes may provide constraints on the geodynamic setting of Earth's first continents and the corresponding SCLM. Keywords: North Atlantic Craton, Archaean, Dunite, Platinum-group elements, Ultra-depleted mantle, Fiskefjord
Energy Technology Data Exchange (ETDEWEB)
Brabban, A.D.; Orcutt, E.N.; Zinder, S.H. [Cornell Univ., Ithaca, NY (United States). Section of Microbiology
1999-03-01
The nitrogenase enzyme complex of Methanosarcina barkeri 227 was found to be more sensitive to NaCl than previously studied molybdenum nitrogenases are, with total inhibition of activity occurring at 190 mM NaCl, compared with >600 mM NaCl for Azotobacter vinelandii and Clostridium pasteurianum nitrogenases. Na{sup +} and K{sup +} had equivalent effects, whereas Mg{sup 2+} was more inhibitory than either monovalent cation, even on a per-charge basis. The anion Cl{sup {minus}} was more inhibitory than acetate was. Because M. barkeri 227 is a facultative halophile, the authors examined the effects of external salt on growth and diazotrophy and found that inhibition of growth was not greater with N{sub 2} than with NH{sub 4}{sup +}. Cells grown with N{sub 2} and cells grown with NH{sub 4}{sup +} produced equal concentrations of {alpha}-glutamate at low salt concentrations and equal concentrations of N{sup {var_epsilon}}-acetyl-{beta}-lysine at NaCl concentrations greater than 500 mM. Despite the high energetic cost of fixing nitrogen for these osmolytes, the authors obtained no evidence that there is a shift towards nonnitrogenous osmolytes during diazotrophic growth. In vitro nitrogenase enzyme assays showed that at a low concentration potassium glutamate enhanced activity but at higher concentrations this compound inhibited activity; 50% inhibition occurred at a potassium glutamate concentration of approximately 400 mM.
Hao, Liping; Lü, Fan; Mazéas, Laurent; Desmond-Le Quéméner, Elie; Madigou, Céline; Guenne, Angéline; Shao, Liming; Bouchez, Théodore; He, Pinjing
2015-02-01
Ammonia inhibition represents a major operational issue for anaerobic digestion. In order to refine our understanding of the terminal catabolic steps in thermophilic anaerobic digestion under ammonia stress, we studied batch thermophilic acetate fed experiments at low (0.26 g L(-1)) and high (7.00 g L(-1)) Total Ammonia Nitrogen concentrations (TAN). Although methane production started immediately for all incubations and resulted in methane yields close to stoichiometric expectations, a 62-72% decrease of methanogenic rate was observed throughout the incubation at 7.00 g L(-1) of TAN compared to 0.26 g L(-1). Stable Isotope Probing analysis of active microbial communities in (13)C-acetate fed experiments coupled to automated ribosomal intergenic spacer analysis and 16S rDNA pyrotag sequencing confirmed that microbial communities were similar for both TAN conditions. At both TAN levels, the (13)C-labeled bacterial community was mainly affiliated to Clostridia-relatives, with OPB54 bacteria being the most abundant sequence in the heavy DNA 16S rDNA pyrotag library. Sequences closely related to Methanosarcina thermophila were also abundantly retrieved in the heavy DNA fractions, showing that this methanogen was still actively assimilating labeled carbon from acetate at free ammonia nitrogen concentrations up to 916 mg L(-1). Stable isotopic signature analysis of biogas, measured in unlabeled acetate fed experiments that were conducted in parallel, confirmed that acetoclastic methanogenic pathway was dominant at both ammonia concentrations. Our work demonstrates that, besides the syntrophic acetate oxidation pathway, acetoclastic methanogenesis catalyzed by Methanosarcina can also play a major role in methane production at high ammonia levels. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Kalsbeek, Feiko
2009-11-01
Full Text Available The geological development of Greenland spans a period of nearly 4 Ga, from Eoarchaean to the Quaternary. Greenland is the largest island on Earth with a total area of 2 166 000 km2, but only c. 410 000 km2 are exposed bedrock, the remaining part being covered by a major ice sheet (the Inland Ice reaching over 3 km in thickness. The adjacent offshore areas underlain by continental crust have an area of c. 825 000 km2. Greenland is dominated by crystalline rocks of the Precambrian shield, which formed during a succession of Archaean and Palaeoproterozoic orogenic events and stabilised as a part of the Laurentian shield about 1600 Ma ago. The shield area can be divided into three distinct types of basement provinces: (1 Archaean rocks (3200–2600 Ma old, with local older units up to >3800Ma that were almost unaffected by Proterozoic or later orogenic activity; (2 Archaean terrains reworked during the Palaeoproterozoic around 1900–1750 Ma ago; and (3 terrains mainly composed of juvenile Palaeoproterozoic rocks (2000–1750 Ma in age.Subsequent geological developments mainly took place along the margins of the shield. During the Proterozoic and throughout the Phanerozoic major sedimentary basins formed, notably in North and North-East Greenland, in which sedimentary successions locally reaching 18 km in thickness were deposited. Palaeozoic orogenic activity affected parts of these successions in the Ellesmerian fold belt of North Greenland and the East Greenland Caledonides; the latter also incorporates reworked Precambrian crystalline basement complexes. Late Palaeozoic and Mesozoic sedimentary basins developed along the continent–ocean margins in North, East and West Greenland and are now preserved both onshore and offshore. Their development was closely related to continental break-up with formation of rift basins. Initial rifting in East Greenland in latest Devonian to earliest Carboniferous time and succeeding phases culminated with the
DEFF Research Database (Denmark)
Pope, Emily Catherine; Rosing, Minik Thorleif; Bird, Dennis K.
Quartz, carbonate and fuchsite (chromian muscovite) is a common metasomatic assemblage observed in orogenic gold systems, both in Phanerozoic convergent margin settings, and within supracrustal and greenstone belts of Precambrian rocks. Geologic and geochemical observations in younger orogenic...... systems suggest that ore-forming metasomatic fluids are derived from subduction-related devolitilization reactions, implying that orogenic Au-deposits in Archaean and Proterozoic supracrustal rock suites are related to subduction-style plate tectonics beginning early in Earth history. Justification...... with Phanerozoic orogenic deposits and that this type of metasomatism is a unique result of subduction-related processes. Fuchsite from the ISB has a δ18O and δD of 7.7 to 17.9‰ and -115 to -61‰, respectively. δ18O of quartz from the same rocks is between 10.3 and 18.6‰. Muscovite-quartz oxygen isotope thermometry...
The Archaean Granny Smith gold deposit, western Australia: age and Pb-isotope tracer studies
International Nuclear Information System (INIS)
Ojala, V.J.; McNaughton, N.J.; Groves, D.I.; Ridley, J.R.; Fanning, C.M.
1997-01-01
The Granny Smith gold deposits are situated within a greenstone sequence in the Laverton-Leonora area of the Northeastern Goldfields Province of the Archaean Yilgarn Block, Western Australia. The greenstone sequence (U-Pb zircon age of 2677±6 Ma, felsic pyroclastic rock) was intruded by the Granny Smith Granodiorite at 2665±4 Ma. Gold mineralisation is located along a reactivated N-S Stricking, thrust which wraps around the granitoid intrusion, and within the granitoid intrusion. Initial lead-isotope compositions of the Granny Smith Granodiorite and ore-fluid Pb, estimated from K-feldspar and galena and lead tellurides, respectively, are slightly different. Calculations based on Pb isotope data for the host rocks, and the U-Pb zircon age of the Granny Smith Granodiorite, suggest that ore-fluid Pb was derived from a source with a similar initial lead-isotopic composition to the source of the Granny Smith Granodiorite but about 30 million years after the intrusion of the granitoid. The Pb-isotope data for granitoids of the Northeastern Goldfields fall in a distinct field different to that of the granitoids of the Norseman area and those from Kambalda to Menzies. (authors)
Heubeck, Christoph; Lowe, Donald R.; Byerly, Gary R.
2010-05-01
Archaean tectonophysical models distinguish between thick, rigid and thin, mobile crust; from these the major mechanisms and rates for continental growth are derived. Archaean sedimentary rocks, preserved in metamorphosed and highly deformed greenstone belts, can contribute to constrain these models by estimating subsidence rates, derived from the combination of facies changes and precise age dates. Largely siliciclastic strata of the Moodies Group form the topmost unit of the Barberton Supergroup of the Barberton Greenstone Belt (BGB), South Africa, represent one of the world's oldest unmetamorphosed quartz-rich sedimentary sequences, and reach ca. 3500m thick (Lowe and Byerly, 2007). Large parts of the Moodies Group were deposited in apparent sedimentary continuity in alluvial, fluvial, shoreline and shallow-marine environments (e.g., Eriksson, 1979; Heubeck and Lowe, 1994). Distinctive sources and variations in facies indicate that Moodies deposition occurred at times in several basins. In several now tectonically separated regions, a regional basaltic lava (unit MdL of Anhaeusser, 1968) separates a lower unit (ca. 2000m thick and possibly representing an extensional setting) from an upper unit (ca. 1500m thick and characterized by progressive unconformities, rapidly changing facies, thicknesses, and sandstone petrographic composition). Single zircons separated from a felsic air-fall tuff of the middle Moodies Group and immediately overlying the basaltic lava in the Saddleback Syncline were dated on the Stanford-USGS SHRIMP RG. Out of 24 dated grains, two near-concordant groups have mean ages of 3230,6+-6,1Ma (2σ; n=9) and 3519+-7 Ma (2σ; n=9), respectively. We interpret the former age as representing the depositional age of the tuff, the latter as representing inherited zircons from underlying Onverwacht-age basement. The interpreted depositional age of the Moodies tuff is indistinguishable from numerous similar ages from felsic and dacitic volcanics at the
Yan, Zhen; Wang, Mingyu; Ferry, James G
2017-02-07
Heterodisulfide reductases (Hdr) of the HdrABC class are ancient enzymes and a component of the anaerobic core belonging to the prokaryotic common ancestor. The ancient origin is consistent with the widespread occurrence of genes encoding putative HdrABC homologs in metabolically diverse prokaryotes predicting diverse physiological functions; however, only one HdrABC has been characterized and that was from a narrow metabolic group of obligate CO 2 -reducing methanogenic anaerobes (methanogens) from the domain Archaea Here we report the biochemical characterization of an HdrABC homolog (HdrA2B2C2) from the acetate-utilizing methanogen Methanosarcina acetivorans with unusual properties structurally and functionally distinct from the only other HdrABC characterized. Homologs of the HdrA2B2C2 archetype are present in phylogenetically and metabolically diverse species from the domains Bacteria and Archaea The expression of the individual HdrA2, HdrB2, and HdrB2C2 enzymes in Escherichia coli, and reconstitution of an active HdrA2B2C2 complex, revealed an intersubunit electron transport pathway dependent on ferredoxin or coenzyme F 420 (F 420 H 2 ) as an electron donor. Remarkably, HdrA2B2C2 couples the previously unknown endergonic oxidation of F 420 H 2 and reduction of ferredoxin with the exergonic oxidation of F 420 H 2 and reduction of the heterodisulfide of coenzyme M and coenzyme B (CoMS-SCoB). The unique electron bifurcation predicts a role for HdrA2B2C2 in Fe(III)-dependent anaerobic methane oxidation (ANME) by M. acetivorans and uncultured species from ANME environments. HdrA2B2C2, ubiquitous in acetotrophic methanogens, was shown to participate in electron transfer during acetotrophic growth of M. acetivorans and proposed to be essential for growth in the environment when acetate is limiting. Discovery of the archetype HdrA2B2C2 heterodisulfide reductase with categorically unique properties extends the understanding of this ancient family beyond CO 2
Metal availability and the expanding network of microbial metabolisms in the Archaean eon
Moore, Eli K.; Jelen, Benjamin I.; Giovannelli, Donato; Raanan, Hagai; Falkowski, Paul G.
2017-09-01
Life is based on energy gained by electron-transfer processes; these processes rely on oxidoreductase enzymes, which often contain transition metals in their structures. The availability of different metals and substrates has changed over the course of Earth's history as a result of secular changes in redox conditions, particularly global oxygenation. New metabolic pathways using different transition metals co-evolved alongside changing redox conditions. Sulfur reduction, sulfate reduction, methanogenesis and anoxygenic photosynthesis appeared between about 3.8 and 3.4 billion years ago. The oxidoreductases responsible for these metabolisms incorporated metals that were readily available in Archaean oceans, chiefly iron and iron-sulfur clusters. Oxygenic photosynthesis appeared between 3.2 and 2.5 billion years ago, as did methane oxidation, nitrogen fixation, nitrification and denitrification. These metabolisms rely on an expanded range of transition metals presumably made available by the build-up of molecular oxygen in soil crusts and marine microbial mats. The appropriation of copper in enzymes before the Great Oxidation Event is particularly important, as copper is key to nitrogen and methane cycling and was later incorporated into numerous aerobic metabolisms. We find that the diversity of metals used in oxidoreductases has increased through time, suggesting that surface redox potential and metal incorporation influenced the evolution of metabolism, biological electron transfer and microbial ecology.
Archaean TTG of Vodlozero Terrain, Fennoscandian Shield
Chekulaev, Valery; Arestova, Natalia
2014-05-01
The Vodlozero terrain is the largest (about 270*240 km) early Archaean fragment of Fennoscandian Shield and composes its eastern part. The granitoids of TTG suite are predominant component of the terrain. The greenstone belts are placed along the margins of the terrain. Several stages of TTG formation can be distinguished in Achaean crust history. (1) The oldest TTG are trondhjemites and tonalities with age of 3240 Ma. They contain rare and small amphibolite inclusions of the same age. These TTG are characterized by high Sr (av. 412 ppm), Sr/Y (70), (La/Yb)n (54) and low Y (av. 7 ppm), Yb (0.32 ppm) and Nb (4 ppm). It was shown (Lobach-Zhuchenko et al., 2000), that the source of these TTG could be basic rocks, having composition similar with TH1 by K.Condie. (2) The tonalities and granodiorites with age of 3150 Ma are disposed near greenstone belts and contain compared to TTG of the first group less Sr (av. 250 ppm), Sr/Y (22), (La/Yb)n (18) and more K, Rb (av. 70 ppm), Ba (470 ppm), Y (11 ppm),Yb (1.16 ppm). TTG of both groups have identical T(DM)Nd (3250-3400 Ma) and differences in composition is evidently connected with lower level of source melting of the second group and also with K-metasomatism. The volcanics of the greenstone belts have age 3020 - 2940 Ma. Dykes of gabbro-amphibolites and andesites with the same age and composition cut TTG of the first and the second groups. The age of the third TTG group is about 2900 Ma ago. These rocks form leucosoma of migmatites within TTG of the second group. The composition of the third TTG and Nd isotope data suppose their origin by the melting of ancient TTG crust simultaneously with greenstone belt emplacement. The fourth TTG group with age 2780-2850 Ma forms a small intrusions, cutting older TTG and greenstone rocks. Their composition is similar to 3150 Ma TTG. Nd isotope data indicate that these TTG have younger (about 2850 Ma) source. Thus there are four TTG groups formed into interval more 400 Ma. The age and
Kulkarni, Gargi; Kridelbaugh, Donna M; Guss, Adam M; Metcalf, William W
2009-09-15
Methanogens use an unusual energy-conserving electron transport chain that involves reduction of a limited number of electron acceptors to methane gas. Previous biochemical studies suggested that the proton-pumping F(420)H(2) dehydrogenase (Fpo) plays a crucial role in this process during growth on methanol. However, Methanosarcina barkeri Delta fpo mutants constructed in this study display no measurable phenotype on this substrate, indicating that Fpo plays a minor role, if any. In contrast, Delta frh mutants lacking the cytoplasmic F(420)-reducing hydrogenase (Frh) are severely affected in their ability to grow and make methane from methanol, and double Delta fpo/Delta frh mutants are completely unable to use this substrate. These data suggest that the preferred electron transport chain involves production of hydrogen gas in the cytoplasm, which then diffuses out of the cell, where it is reoxidized with transfer of electrons into the energy-conserving electron transport chain. This hydrogen-cycling metabolism leads directly to production of a proton motive force that can be used by the cell for ATP synthesis. Nevertheless, M. barkeri does have the flexibility to use the Fpo-dependent electron transport chain when needed, as shown by the poor growth of the Delta frh mutant. Our data suggest that the rapid enzymatic turnover of hydrogenases may allow a competitive advantage via faster growth rates in this freshwater organism. The mutant analysis also confirms the proposed role of Frh in growth on hydrogen/carbon dioxide and suggests that either Frh or Fpo is needed for aceticlastic growth of M. barkeri.
Savko, K. A.; Samsonov, A. V.; Larionov, A. N.; Korish, E. Kh.; Bazikov, N. S.
2018-01-01
Framing of the Archaean greenstone belts of the Kursk Block (KB) of the East Sarmatia preserves rocks of the TTG association: those do not form massifs with distinct boundaries, but occur as fields gradually transiting into gneisses and migmatites. According to Sm-Nd isotope-geochemical data, the TTG are characterized by positive values of ɛNd(2960) = +0.3…+1.6 and protolith model ages of T Nd( DM) = 3100-3200 Ma. Magmatic protoliths of the Kursk Block TTG were formed about 2960 Ma by melting from a juvenile basite source. These age estimates are significantly younger than heterochronous (3.19, 3.13 and 3.07 Ga) TTGs of the Middle Dnieper granite-greenstone terrane. On the other hand, the similarity of ɛNd(T) implies a single source of their protoliths. Consequently, the KB TTGs, apparently, are a result of transformation of an older sial crust preserved within the Middle Dnieper Block.
A Field Trip to the Archaean in Search of Darwin’s Warm Little Pond
Directory of Open Access Journals (Sweden)
Bruce Damer
2016-05-01
Full Text Available Charles Darwin’s original intuition that life began in a “warm little pond” has for the last three decades been eclipsed by a focus on marine hydrothermal vents as a venue for abiogenesis. However, thermodynamic barriers to polymerization of key molecular building blocks and the difficulty of forming stable membranous compartments in seawater suggest that Darwin’s original insight should be reconsidered. I will introduce the terrestrial origin of life hypothesis, which combines field observations and laboratory results to provide a novel and testable model in which life begins as protocells assembling in inland fresh water hydrothermal fields. Hydrothermal fields are associated with volcanic landmasses resembling Hawaii and Iceland today and could plausibly have existed on similar land masses rising out of Earth’s first oceans. I will report on a field trip to the living and ancient stromatolite fossil localities of Western Australia, which provided key insights into how life may have emerged in Archaean, fluctuating fresh water hydrothermal pools, geological evidence for which has recently been discovered. Laboratory experimentation and fieldwork are providing mounting evidence that such sites have properties that are conducive to polymerization reactions and generation of membrane-bounded protocells. I will build on the previously developed coupled phases scenario, unifying the chemical and geological frameworks and proposing that a hydrogel of stable, communally supported protocells will emerge as a candidate Woese progenote, the distant common ancestor of microbial communities so abundant in the earliest fossil record.
The elusive Hadean enriched reservoir revealed by 142Nd deficits in Isua Archaean rocks.
Rizo, Hanika; Boyet, Maud; Blichert-Toft, Janne; O'Neil, Jonathan; Rosing, Minik T; Paquette, Jean-Louis
2012-11-01
The first indisputable evidence for very early differentiation of the silicate Earth came from the extinct (146)Sm-(142)Nd chronometer. (142)Nd excesses measured in 3.7-billion-year (Gyr)-old rocks from Isua (southwest Greenland) relative to modern terrestrial samples imply their derivation from a depleted mantle formed in the Hadean eon (about 4,570-4,000 Gyr ago). As dictated by mass balance, the differentiation event responsible for the formation of the Isua early-depleted reservoir must also have formed a complementary enriched component. However, considerable efforts to find early-enriched mantle components in Isua have so far been unsuccessful. Here we show that the signature of the Hadean enriched reservoir, complementary to the depleted reservoir in Isua, is recorded in 3.4-Gyr-old mafic dykes intruding into the Early Archaean rocks. Five out of seven dykes carry (142)Nd deficits compared to the terrestrial Nd standard, with three samples yielding resolvable deficits down to -10.6 parts per million. The enriched component that we report here could have been a mantle reservoir that differentiated owing to the crystallization of a magma ocean, or could represent a mafic proto-crust that separated from the mantle more than 4.47 Gyr ago. Our results testify to the existence of an enriched component in the Hadean, and may suggest that the southwest Greenland mantle preserved early-formed heterogeneities until at least 3.4 Gyr ago.
Energy Technology Data Exchange (ETDEWEB)
Kuijper, R P; Priem, H N.A. [Laboratorium voor Isotopen-Geologie, Amsterdam (Netherlands); Den Tex, E [Rijksuniversiteit Utrecht (Netherlands). Inst. voor Aardwetenschappen
1982-08-01
U-Pb data are reported for nine suites of zircons and three monazites from the Paleozoic orogen in western Galicia: one paragneiss and six orthogneisses from the early Paleozoic basement, and two Carboniferous (ca. 310 Ma old) intrusions of two-mica granite. New whole-rock Rb-Sr analyses, along with earlier data, indicate an age of ca. 470-440 Ma (Ordovician) for the emplacement of the granitic precursors of the orthogneisses. Monazite from the paragneiss also yields an U-Pb age of ca. 470 Ma. From the high initial /sup 87/Sr//sup 86/Sr ratios an involvement of Precambrian continental crust material is evident in the generation of the early Paleozoic suite of granites, while the zircon U-Pb data give evidence of the presence of about 3.0-2.0 Ga old (late Archaean-early Proterozoic) components in the source material. Zircons from the oldest sedimentary rocks in the area, now present as catazonal paragneisses and a likely source for the granites, likewise reveal a provenance age of 3.0-2.0 Ga.
ORF Sequence: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ethanosarcina acetivorans C2A] MTPAKDMQKMAEMMKPVKDMQKMAEIMAPAIESQKKIAEIMAPVIESQKRMANIVADMTEPAIESQKKIAEIMAPVI...ESQKRMADIVADMTEPAIESQKKIAEIMAPVKDMQKMAEMMTPVKDMQKIAEIMAPAIESQKKIAEIMAPVIESQKRMADIVADMTEPAIESQKKIAEIMAPAIESQK
International Nuclear Information System (INIS)
Wijbrans, J.R.; McDougall, I.
1987-01-01
Age spectrum analyses of blue-green hornblendes from amphibolites from the Western Shaw Belt, East Pilbara, Western Australia, indicate an age of at least 3200 Ma for early regional metamorphism. Ages on hornblende and muscovite from the narrow contact zone with the adjacent Yule Batholith probably data updoming of the granitoid gneiss terranes at 2950 Ma. Hornblendes from within the Shaw Batholith and from a contact zone of a post-tectonic granitoid yield ages of 2840-2900 Ma, indicating either prolonged high temperatures within the granitoid gneiss terranes or a separate thermal pulse associated with the intrusion of post-tectonic granitoids. The preservation of very old hornblendes in a narrow greenstone belt surrounded by massive granitoid gneiss domes indicates that remarkable contrasts in metamorphic geotherms existed over short distances during the Late Archaean, suggesting that updoming occurred during a period of rapid tectonism. (orig.)
Zhamaletdinov, A. A.; Velikhov, E. P.; Shevtsov, A. N.; Kolobov, V. V.; Kolesnikov, V. E.; Skorokhodov, A. A.; Korotkova, T. G.; Ivonin, V. V.; Ryazantsev, P. A.; Birulya, M. A.
2017-06-01
This paper addresses the Kovdor-2015 Experiment involving frequency electromagnetic soundings of the Archaean basement of the Earth's crust in the southwestern part of the Kola Peninsula. Eleven soundings were carried out using two transmitting arrangements, 85 km apart. Each arrangement consisted of two mutually orthogonal grounded electric dipoles of 1.5 km long. The distances between the source and the receiver were 25 and 50 km. Interpretation of the results took into account the influence of displacement currents and static distortions. It is found that there is an intermediate conductive layer of the dilatancy-diffusion nature (DD layer) with a longitudinal conductivity of about one siemens at depths ranging from 1.5-2 to 5-7 km. The results are interpreted in the terms of geodynamics.
Moyen, J.-F.; Martin, H.; Jayananda, M.; Peucat, J.-J.
2003-04-01
The South Indian Dharwar Craton assembled during the late-Archaean (ca. 2.5 Ga). This event was associated with intense granite genesis and emplacement. Based on petrography and geochemistry, 4 main types of late Archaean granitoids were distinguished: (1) Anatectic granites (and diatexites), formed by partial melting of TTG gneisses; (2) Classical TTGs; (3) Sanukitoids, generated by interaction between slab melts (TTG) and mantle peridotite; (4) The high HFSE Closepet granite, interpreted as derived from partial melting of a mantle metasomatized by slab melts (TTG). While the 3 later groups all are interpreted as resulting from slab melt/mantle wedge interactions, their differences are related to decreasing felsic melt/peridotite ratios during the ascent “slab melts” in the mantle wedge above an active subduction zone. Field data together with geochronology and isotope geochemistry allow to subdivide the Dharwar craton into three main domains: (1) The Western Dharwar Craton (WDC) is an old (3.3 2.9 Ga ), stable continental block with limited amounts of 2.5 Ga old anatectic granites. (2) The Eastern Dharwar Craton (EDC) is subdivided into two parts: (2a) West of Kolar Schist Belt, a region of 3.0-2.7 Ga old basement intruded by 2.5 Ga old anatectic granites; (2b) East of Kolar, an area featuring mainly 2.5 Ga old diatexites and granites, derived of partial melting of a newly accreted TTG crust. Anatectic granites are ubiquitous, and late in the cratonic evolution; they witnessed generalized melting of a juvenile crust. In contrast, deep-originated granites emplaced before this melting and are restricted to the boundaries between the blocks. This structure of distinct terranes separated by narrow bands operating as channels for deep-originated magmas provides independent evidences for a two-stage evolution: an arc accretion context for the TTG, sanukitoids and related rocks, immediately followed by high temperature reworking of the newly accreted craton
Rifting an Archaean Craton: Insights from Seismic Anisotropy Patterns in E. Africa
Ebinger, C. J.; Tiberi, C.; Currie, C. A.; van Wijk, J.; Albaric, J.
2016-12-01
Few places worldwide offer opportunities to study active deformation of deeply-keeled cratonic lithosphere. The magma-rich Eastern rift transects the eastern edge of the Archaean Tanzania craton in northeastern Tanzania, which has been affected by a large-scale mantle upwelling. Abundant xenolith locales offer constraints on mantle age, composition, and physical properties. Our aim is to evaluate models for magmatic fluid-alteration (metasomatism) and deformation of mantle lithosphere along the edge of cratons by considering spatial variations in the direction and magnitude of seismic anisotropy, which is strongly influenced by mantle flow patterns along lithosphere-asthenosphere topography, fluid-filled cracks (e.g., dikes), and pre-existing mantle lithosphere strain fabrics. Waveforms of teleseismic earthquakes (SKS, SKKS) recorded on the 39-station CRAFTI-CoLiBREA broadband array in southern Kenya and northern Tanzania are used to determine the azimuth and amount of shear-wave splitting accrued as seismic waves pass through the uppermost mantle and lithosphere at the craton edge. Lower crustal earthquakes enable evaluation of seismic anisotropy throughout the crust along the rift flanks and beneath the heavily intruded Magadi and Natron basins, and the weakly intruded Manyara basin. Our results and those of earlier studies show a consistent N50E splitting direction within the craton, with delay times of ca. 1.5 s, and similar direction east of the rift in thinner Pan-African lithosphere. Stations within the rift zone are rotated to a N15-35E splitting, with the largest delay times of 2.5 s at the margin of the heavily intruded Magadi basin. The short length scale of variations and rift-parallel splitting directions are similar to patterns in the Main Ethiopian rift attributed to melt-filled cracks or oriented pockets rising from the base of the lithosphere. The widespread evidence for mantle metasomatism and magma intrusion to mid-crustal levels suggests that
Energy Technology Data Exchange (ETDEWEB)
Wijbrans, J.R.; McDougall, I.
1987-07-01
Age spectrum analyses of blue-green hornblendes from amphibolites from the Western Shaw Belt, East Pilbara, Western Australia, indicate an age of at least 3200 Ma for early regional metamorphism. Ages on hornblende and muscovite from the narrow contact zone with the adjacent Yule Batholith probably data updoming of the granitoid gneiss terranes at 2950 Ma. Hornblendes from within the Shaw Batholith and from a contact zone of a post-tectonic granitoid yield ages of 2840-2900 Ma, indicating either prolonged high temperatures within the granitoid gneiss terranes or a separate thermal pulse associated with the intrusion of post-tectonic granitoids. The preservation of very old hornblendes in a narrow greenstone belt surrounded by massive granitoid gneiss domes indicates that remarkable contrasts in metamorphic geotherms existed over short distances during the Late Archaean, suggesting that updoming occurred during a period of rapid tectonism.
Early Archaean collapse basins, a habitat for early bacterial life.
Nijman, W.
For a better definition of the sedimentary environment in which early life may have flourished during the early Archaean, understanding of the basin geometry in terms of shape, depth, and fill is a prerequisite. The basin fill is the easiest to approach, namely from the well exposed, low-grade metamorphic 3.4 - 3.5 Ga rock successions in the greenstone belts of the east Pilbara (Coppin Gap Greenstone Belt and North Pole Dome) in West Australia and of the Barberton Greenstone Belt (Buck Ridge volcano-sedimentary complex) in South Africa. They consist of mafic to ultramafic volcanic rocks, largely pillow basalts, with distinct intercalations of intermediate to felsic intrusive and volcanic rocks and of silicious sediments. The, partly volcaniclastic, silicious sediments of the Buck Ridge and North Pole volcano-sedimentary complexes form a regressive-transgressive sequence. They were deposited close to base level, and experienced occasional emersion. Both North Pole Chert and the chert of the Kittys Gap volcano-sedimentary complex in the Coppin Gap Greenstone Belt preserve the flat-and-channel architecture of a shallow tidal environment. Thickness and facies distribution appear to be genetically linked to systems, i.e. arrays, of syn-depositionally active, extensional faults. Structures at the rear, front and bottoms of these fault arrays, and the fault vergence from the basin margin towards the centre characterize the basins as due to surficial crustal collapse. Observations in the Pilbara craton point to a non-linear plan view and persistence for the basin-defining fault patterns over up to 50 Ma, during which several of these fault arrays became superposed. The faults linked high-crustal level felsic intrusions within the overall mafic rock suite via porphyry pipes, black chert veins and inferred hydrothermal circulations with the overlying felsic lavas, and more importantly, with the cherty sediments. Where such veins surfaced, high-energy breccias, and in the
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... acetivorans str. C2A] ... Length = 90 ... Query: 8 ... MKNKSNHISSKEQNTEDIDGYFYEGTDGSQMAFWTCYSDRASRKHIHEF...DEYMVCISGQY 67 ... MKNKSNHISSKEQNTEDIDGYFYEGTDGSQMAFWTCYSDRASRKHIHEFDEYMVCISGQY Sbjct: 1 ... MKNKSNHIS
Directory of Open Access Journals (Sweden)
M Luisa Romero-Romero
Full Text Available The relationship between the denaturation temperatures of proteins (Tm values and the living temperatures of their host organisms (environmental temperatures: TENV values is poorly understood. Since different proteins in the same organism may show widely different Tm's, no simple universal relationship between Tm and TENV should hold, other than Tm≥TENV. Yet, when analyzing a set of homologous proteins from different hosts, Tm's are oftentimes found to correlate with TENV's but this correlation is shifted upward on the Tm axis. Supporting this trend, we recently reported Tm's for resurrected Precambrian thioredoxins that mirror a proposed environmental cooling over long geological time, while remaining a shocking ~50°C above the proposed ancestral ocean temperatures. Here, we show that natural selection for protein kinetic stability (denaturation rate can produce a Tm↔TENV correlation with a large upward shift in Tm. A model for protein stability evolution suggests a link between the Tm shift and the in vivo lifetime of a protein and, more specifically, allows us to estimate ancestral environmental temperatures from experimental denaturation rates for resurrected Precambrian thioredoxins. The TENV values thus obtained match the proposed ancestral ocean cooling, support comparatively high Archaean temperatures, and are consistent with a recent proposal for the environmental temperature (above 75°C that hosted the last universal common ancestor. More generally, this work provides a framework for understanding how features of protein stability reflect the environmental temperatures of the host organisms.
International Nuclear Information System (INIS)
Panigrahi, B.; Shaji, T.S.; Sharma, G.S.; Yadav, O.P.; Nanda, L.K.
2008-01-01
Prominent shear zones cutting through the basement and cover rocks of Delhi Supergroup have been recognized in Dhani Basri - Ramewala sector of Dausa district, Rajasthan. One such shear zone traversing the granite gneiss (Archaean basement) has been observed at Dhani Basri. The sheared rock is exposed in the form of a small hump and gives appearance of quartzite due to intense silicification. Grab samples collected from the shear zone rock analysed upto 93 ppm U 3 O 8 and <10 ppm ThO 2 , which is anomalous in comparison to unsheared rock which analysed 51 ppm eU 3 O 8 , upto 5 ppm U 3 O 8 and 80 ppm ThO 2 . Gamma-ray logging of boreholes drilled by GSI across this shear zone indicated uranium mineralization of the order of 0.030% eU 3 O 8 x 5.40 m and the primary radioactive mineral has been identified as uraninite. The extension of Dhani Basri shear zone inside the cover rocks of Meso-Proterozoic Delhi Supergroup of rocks of Alwar sub-basin is of paramount importance in locating unconformity related as well as hydrothermal vein type uranium mineralization. (author)
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... acetivorans str. C2A] ... Length = 115 ... Query: 8 ... LESLINSSPIVIFLCKATENWPVELITENVRNFGHEVEE...FTLRGVRYLDIVHPEDKEKVK 67 ... LESLINSSPIVIFLCKATENWPVELITENVRNFGHEVEEFTLRGV...RYLDIVHPEDKEKVK Sbjct: 1 ... LESLINSSPIVIFLCKATENWPVELITENVRNFGHEVEEFTLRGVRYLDIVHPEDKEKVK 60 ...
Energy Technology Data Exchange (ETDEWEB)
Kgaswane, E M; Nyblade, A A; Julia, J; Dirks, P H H M; Durrheim, R J; Pasyanos, M E
2008-11-11
Crustal structure in southern Africa has been investigated by jointly inverting receiver functions and Rayleigh wave group velocities for 89 broadband seismic stations spanning much of the Precambrian shield of southern Africa. 1-D shear wave velocity profiles obtained from the inversion yield Moho depths that are similar to those reported in previous studies and show considerable variability in the shear wave velocity structure of the lower part of the crust between some terrains. For many of the Archaean and Proterozoic terrains in the shield, S velocities reach 4.0 km/s or higher over a substantial part of the lower crust. However, for most of the Kimberley terrain and adjacent parts of the Kheis Province and Witwatersrand terrain, as well as for the western part of the Tokwe terrain, mean shear wave velocities of {le} 3.9 km/s characterize the lower part of the crust along with slightly ({approx}5 km) thinner crust. These findings indicate that the lower crust across much of the shield has a predominantly mafic composition, except for the southwest portion of the Kaapvaal Craton and western portion of the Zimbabwe Craton, where the lower crust is intermediate-to-felsic in composition. The parts of the Kaapvaal Craton underlain by intermediate-to-felsic lower crust coincide with regions where Ventersdorp rocks have been preserved, and thus we suggest that the intermediate-to-felsic composition of the lower crust and the shallower Moho may have resulted from crustal melting during the Ventersdorp tectonomagmatic event at c. 2.7 Ga and concomitant crustal thinning caused by rifting.
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... acetivorans str. C2A] ... Length = 137 ... Query: 14 ... ENCLFCKIITGEIPSHRIYEDDAIYAFLDIYPASEGHTLI...APKKHLSNFTDMNAEDVALL 73 ... ENCLFCKIITGEIPSHRIYEDDAIYAFLDIYPASEGHTLIAPKKHL...SNFTDMNAEDVALL Sbjct: 1 ... ENCLFCKIITGEIPSHRIYEDDAIYAFLDIYPASEGHTLIAPKKHLSNFTDMNAEDVALL 60 ... Query: 134 PDTANL
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... acetivorans str. C2A] ... Length = 291 ... Query: 27 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWIND...TL 86 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWIND...TL Sbjct: 1 ... CASPTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWINDTL 60 ... Query: 147 GNSFYNM
International Nuclear Information System (INIS)
Bolhar, R.; Hergt, J.; Woodhead, J.
1999-01-01
Full text: Magnesian- to Fe-rich tholeiitic basalts represent the dominant lithology in the Marble Bar Greenstone Belt, E-Pilbara Craton, and are locally associated with komatiitic basalts and rare komatiitic cumulates. Based on trace element characteristics, the extrusive and intrusive rocks from all three major stratigraphic units can be subdivided into LREE enriched and unfractionated to weakly LREE depleted groups. The former group is characterized by La/Sm pm = 1.7-4.6, Gd/Yb pm = 1.23.2 and Nb/Th pm 0.1-0.5, while the latter rocks possess ratios of La/Sm pm = 0.5-1.7, Gd/Yb pm = 0.8-1.9 and Nb/Th pm = 0.4-1.3. Nb/La -Nb/Th relationships in the LREE enriched samples indicate 7-28% contamination by crustal material similar in composition to Pilbara granitoids. LREE enrichment and strong negative HFSE anomalies, along with MgO = 2.2-22.0 wt% and SiO 2 = 39.2-63.5 wt%, have been observed in numerous Archaean greenstone belts, and can be successfully modeled in this study by AFC processes. In contrast, strong HFSE depletion combined with unfractionated to slightly depleted LREE in rocks of the latter group require different processes. Melting of mantle material previously depleted by melt extraction, enrichment of LILE and LREE relative to the HFSE in an arc-like environment and HFSE fractionation as a result of garnet retention in the melting source cannot account for negative Nb, Ta, Ti, P and strong positive Pb anomalies. Introduction of small amounts of crustal material into a depleted or primitive mantle, as possibly indicated by Nb/Ta ratios between 12 and 18, also fails to reproduce the trace element abundances of the second group of rocks. Recycling of oceanic crust previously processed through a subduction zone (low Th/Nb, La/Nb) and sub-arc lithospheric mantle (high Th/Nb, La/Nb), and subsequent mixing into the Archaean mantle has been recently invoked by several workers (e.g. Kerrich et al., EPSL, 168, 101-115; 1999) to explain the origin of
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... acetivorans str. C2A] ... Length = 291 ... Query: 37 ... PTPHIIYIDTDGSGDYNCDGRNDHIEINKALSFVNENSNFTTVHLNGSNTYWIND...TLYIG 96 ... PT ... I+YIDTDGSGDYNCDG+NDHIEIN+ALSFVN+NS+FTTVHLNGSNTYWIND...TLYIG Sbjct: 4 ... PTAPIVYIDTDGSGDYNCDGKNDHIEINEALSFVNKNSDFTTVHLNGSNTYWINDTLYIG 63 ... Query: 157 FYDMINL
Directory of Open Access Journals (Sweden)
Jamie A FitzGerald
Full Text Available Macro-algae represent an ideal resource of third generation biofuels, but their use necessitates a refinement of commonly used anaerobic digestion processes. In a previous study, contrasting mixes of dairy slurry and the macro-alga Ulva lactuca were anaerobically digested in mesophilic continuously stirred tank reactors for 40 weeks. Higher proportions of U. lactuca in the feedstock led to inhibited digestion and rapid accumulation of volatile fatty acids, requiring a reduced organic loading rate. In this study, 16S pyrosequencing was employed to characterise the microbial communities of both the weakest (R1 and strongest (R6 performing reactors from the previous work as they developed over a 39 and 27-week period respectively. Comparing the reactor communities revealed clear differences in taxonomy, predicted metabolic orientation and mechanisms of inhibition, while constrained canonical analysis (CCA showed ammonia and biogas yield to be the strongest factors differentiating the two reactor communities. Significant biomarker taxa and predicted metabolic activities were identified for viable and failing anaerobic digestion of U. lactuca. Acetoclastic methanogens were inhibited early in R1 operation, followed by a gradual decline of hydrogenotrophic methanogens. Near-total loss of methanogens led to an accumulation of acetic acid that reduced performance of R1, while a slow decline in biogas yield in R6 could be attributed to inhibition of acetogenic rather than methanogenic activity. The improved performance of R6 is likely to have been as a result of the large Methanosarcina population, which enabled rapid removal of acetic acid, providing favourable conditions for substrate degradation.
FitzGerald, Jamie A; Allen, Eoin; Wall, David M; Jackson, Stephen A; Murphy, Jerry D; Dobson, Alan D W
2015-01-01
Macro-algae represent an ideal resource of third generation biofuels, but their use necessitates a refinement of commonly used anaerobic digestion processes. In a previous study, contrasting mixes of dairy slurry and the macro-alga Ulva lactuca were anaerobically digested in mesophilic continuously stirred tank reactors for 40 weeks. Higher proportions of U. lactuca in the feedstock led to inhibited digestion and rapid accumulation of volatile fatty acids, requiring a reduced organic loading rate. In this study, 16S pyrosequencing was employed to characterise the microbial communities of both the weakest (R1) and strongest (R6) performing reactors from the previous work as they developed over a 39 and 27-week period respectively. Comparing the reactor communities revealed clear differences in taxonomy, predicted metabolic orientation and mechanisms of inhibition, while constrained canonical analysis (CCA) showed ammonia and biogas yield to be the strongest factors differentiating the two reactor communities. Significant biomarker taxa and predicted metabolic activities were identified for viable and failing anaerobic digestion of U. lactuca. Acetoclastic methanogens were inhibited early in R1 operation, followed by a gradual decline of hydrogenotrophic methanogens. Near-total loss of methanogens led to an accumulation of acetic acid that reduced performance of R1, while a slow decline in biogas yield in R6 could be attributed to inhibition of acetogenic rather than methanogenic activity. The improved performance of R6 is likely to have been as a result of the large Methanosarcina population, which enabled rapid removal of acetic acid, providing favourable conditions for substrate degradation.
Goswami, Deepjyoti; Akkiraju, Vyasulu V.; Misra, Surajit; Roy, Sukanta; Singh, Santosh K.; Sinha, Amalendu; Gupta, Harsh; Bansal, B. K.; Nayak, Shailesh
2017-08-01
Reservoir triggered earthquakes have been occurring in the Koyna area, western India for the past five decades. Triaxial tests carried out on 181 core samples of Archaean granitoids underlying the Deccan Traps provide valuable constraints on rock strength properties in the Koyna seismogenic zone for the first time. The data include measurements on granite gneiss, granite, migmatitic gneiss and mylonitised granite gneiss obtained from boreholes KBH-3, KBH-4A, KBH-5 and KBH-7 located in the western and eastern margins of the seismic zone. Salient results are as follows. (i) Increase of rock strength with increasing confining pressure allow determination of the linearized failure envelopes from which the cohesive strength and angle of internal friction are calculated. (ii) Variable differential stresses at different depths are the manifestations of deformation partitioning in close association of fault zone(s) or localized fracture zones. (iii) Fractures controlled by naturally developed weak planes such as cleavage and fabric directly affect the rock strength properties, but the majority of failure planes developed during triaxial tests is not consistent with the orientations of pre-existing weak planes. The failure planes may, therefore, represent other planes of weakness induced by ongoing seismic activity. (iv) Stress-strain curves confirm that axial deformation is controlled by the varying intensity of pre-existing shear in the granitoids, viz., mylonite, granite gneiss and migmatitic gneiss. (v) Frequent occurrences of low magnitude earthquakes may be attributed to low and variable rock strength of the granitoids, which, in turn, is modified by successive seismic events.
Energy Technology Data Exchange (ETDEWEB)
Laufer, K; Eikmanns, B; Frimmer, U; Thauer, R K
1987-04-01
Cell suspensions of Methanosarcina barkeri grown on acetate catalyze the formation of methane and CO/sub 2/ from acetate as well as an isotopic exchange between the carboxyl group of acetate and CO/sub 2/. Here we report that these cells also mediate the synthesis of acetate from methyl iodide, CO/sub 2/, and reducing equivalents (H/sub 2/ or CO), the methyl group of acetate being derived from methyl iodide and the carboxyl group from CO/sub 2/. Methyl chloride and methyltosylate but not methanol can substitute for methyl iodide in this reaction. Acetate formation from methyl iodide, CO/sub 2/, and reducing equivalents is coupled with the phosphorylation of ADP. Evidence is presented that methyl iodide is incorporated into the methyl group of acetate via a methyl corrinoid intermediate (deduced from inhibition experiments with propyl iodide) and that CO/sub 2/ is assimilated into the carboxyl group via a C/sub 1/ intermediate which does not exchange with free formate or free CO. The effects of protonophores, of the proton-translocating ATPase inhibitor N,N'-dicyclohexylcarbodiimide, and of arsenate on acetate formation are interpreted to indicate that the reduction of CO/sub 2/ to the oxidation level of the carboxyl group of acetate requires the presence of an electrochemical proton potential and that acetyl-CoA or acetyl-phosphate rather than free acetate is the immediate product of the condensation reaction. These results are dicsussed with respect to the mechanism of methanogenesis from acetate.
Sarkar, Saheli; Patole, Vishal; Saha, Lopamudra; Pati, Jayanta Kumar; Nasipuri, Pritam
2015-04-01
The transformation of palaeo-continents involve breakup, dispersal and reassembly of cratonic blocks by collisional suturing that develop a network of orogenic (mobile) belts around the periphery of the stable cratons. The nature of deformation in the orogenic belt depends on the complex interaction of fracturing, plastic deformation and diffusive mass transfer. Additionally, the degree and amount of melting during regional deformation is critical as the presence of melt facilitates the rate of diffusive mass transfer and weakens the rock by reducing the effective viscosity of the deformed zone. The nature of strain localization and formation of ductile shear zones surrounding the cratonic blocks have been correlated with Proterozoic-Palaeozoic supercontinent assembly (Columbia, Rodinia and Gondwana reconstruction). Although, a pre-Columbia supercontinent termed as Kenorland has been postulated, there is no evidence that supports the notion due to lack of the presence of shear zones within the Archaean cratonic blocks. In this contribution, we present the detailed structural analysis of ductile shear zones within the Bundelkhand craton. The ductlile shear zone is termed as Bundelkhand Tectonic Zone (BTZ) that extends east-west for nearly 300 km throughout the craton with a width of two-three kilometer . In the north-central India, the Bundelkhand craton is exposed over an area of 26,000 sq. The craton is bounded by Central Indian Tectonic zone in the south, the Great Boundary fault in the west and by the rocks of Lesser Himalaya in the north. A series of tonalite-trondjhemite-granodiorite gneiss are the oldest rocks of the Bundelkhand craton that also contains a succession of metamorphosed supracrustal rocks comprising of banded iron formation, quartzite, calc-silicate and ultramafic rocks. K-feldspar bearing granites intrude the tonalite-trondjhemite-granodiorite and the supracrustal rocks during the time span of 2.1 to 2.5 Ga. The TTGs near Babina, in central
Directory of Open Access Journals (Sweden)
Keturah A Odoi
Full Text Available Systematic studies of nonsense and sense suppression of the original and three derivative Methanosarcina mazei PylRS-tRNA(Pyl pairs and cross recognition between nonsense codons and various tRNA(Pyl anticodons in the Escherichia coli BL21(DE3 cell strain are reported. tRNA(CUA(Pyl is orthogonal in E. coli and able to induce strong amber suppression when it is co-expressed with pyrrolysyl-tRNA synthetase (PylRS and charged with a PylRS substrate, N(ε-tert-butoxycarbonyl-L-lysine (BocK. Similar to tRNA(CUA(Pyl, tRNA(UUA(Pyl is also orthogonal in E. coli and can be coupled with PylRS to genetically incorporate BocK at an ochre mutation site. Although tRNA(UUA(Pyl is expected to recognize a UAG codon based on the wobble hypothesis, the PylRS-tRNA(UUA(Pyl pair does not give rise to amber suppression that surpasses the basal amber suppression level in E. coli. E. coli itself displays a relatively high opal suppression level and tryptophan (Trp is incorporated at an opal mutation site. Although the PylRS-tRNA(UCA(Pyl pair can be used to encode BocK at an opal codon, the pair fails to suppress the incorporation of Trp at the same site. tRNA(CCU(Pyl fails to deliver BocK at an AGG codon when co-expressed with PylRS in E. coli.
Mrp Antiporters Have Important Roles in Diverse Bacteria and Archaea.
Ito, Masahiro; Morino, Masato; Krulwich, Terry A
2017-01-01
Mrp (Multiple resistance and pH) antiporter was identified as a gene complementing an alkaline-sensitive mutant strain of alkaliphilic Bacillus halodurans C-125 in 1990. At that time, there was no example of a multi-subunit type Na + /H + antiporter comprising six or seven hydrophobic proteins, and it was newly designated as the monovalent cation: proton antiporter-3 (CPA3) family in the classification of transporters. The Mrp antiporter is broadly distributed among bacteria and archaea, not only in alkaliphiles. Generally, all Mrp subunits, mrpA-G , are required for enzymatic activity. Two exceptions are Mrp from the archaea Methanosarcina acetivorans and the eubacteria Natranaerobius thermophilus , which are reported to sustain Na + /H + antiport activity with the MrpA subunit alone. Two large subunits of the Mrp antiporter, MrpA and MrpD, are homologous to membrane-embedded subunits of the respiratory chain complex I, NuoL, NuoM, and NuoN, and the small subunit MrpC has homology with NuoK. The functions of the Mrp antiporter include sodium tolerance and pH homeostasis in an alkaline environment, nitrogen fixation in Schizolobium meliloti , bile salt tolerance in Bacillus subtilis and Vibrio cholerae , arsenic oxidation in Agrobacterium tumefaciens , pathogenesis in Pseudomonas aeruginosa and Staphylococcus aureus , and the conversion of energy involved in metabolism and hydrogen production in archaea. In addition, some Mrp antiporters transport K + and Ca 2+ instead of Na + , depending on the environmental conditions. Recently, the molecular structure of the respiratory chain complex I has been elucidated by others, and details of the mechanism by which it transports protons are being clarified. Based on this, several hypotheses concerning the substrate transport mechanism in the Mrp antiporter have been proposed. The MrpA and MrpD subunits, which are homologous to the proton transport subunit of complex I, are involved in the transport of protons and their
Directory of Open Access Journals (Sweden)
Allen P. Nutman
2014-07-01
Full Text Available A diverse suite of Archaean gneisses at Huangbaiyu village in the North China Craton, includes rare fuchsite-bearing (Cr-muscovite siliceous rocks – known as the Caozhuang quartzite. The Caozhuang quartzite is strongly deformed and locally mylonitic, with silica penetration and pegmatite veining common. It contains abundant 3880–3600 Ma and some Palaeoarchaean zircons. Because of its siliceous nature, the presence of fuchsite and its complex zircon age distribution, it has until now been accepted as a (mature quartzite. However, the Caozhuang quartzite sample studied here is feldspathic. The shape and cathodoluminescence petrography of the Caozhuang quartzite zircons show they resemble those found in immature detrital sedimentary rocks of local provenance or in Eoarchaean polyphase orthogneisses, and not those in mature quartzites. The Caozhuang quartzite intra-zircon mineral inclusions are dominated by quartz, with lesser biotite, apatite (7% and alkali-feldspar, and most inclusions are morphologically simple. A Neoarchaean orthogneiss from near Huangbaiyu displays morphologically simple inclusions with much more apatite (73%, as is typical for fresh calc-alkaline granitoids elsewhere. Zircons were also examined from a mature conglomerate quartzite clast and an immature feldspathic sandstone of the overlying weakly metamorphosed Mesoproterozoic Changcheng System. These zircons have oscillatory zoning, showing they were sourced from igneous rocks. The quartzite clast zircons contain only rare apatite inclusions (<1%, with domains with apatite habit now occupied by intergrowths of muscovite + quartz ± Fe-oxides ± baddeleyite. We interpret that these were once voids after apatite inclusions that had dissolved during Mesoproterozoic weathering, which were then filled with clays ± silica and then weakly metamorphosed. Zircons in the immature feldspathic sandstone show a greater amount of preserved apatite (11%, but with petrographic
Microbial Ecology of Thermophilic Anaerobic Digestion. Final Report
Zinder, Stephen H.
2000-04-15
This grant supported research on methanogenic archaea. The two major areas that were supported were conversion of acetic acid to methane and nitrogen fixation by Methanosarcina. Among the achievements of this research were the isolation of novel methanogenic cultures, elucidation of the pathways from acetate to methane, description of a specific DNA-binding complex in nitrogen fixing methanogens, and demonstration of an alternative nitrogenase in Methanosarcina.
Microbial ecology of thermophilic anaerobic digestion. Final report
Energy Technology Data Exchange (ETDEWEB)
Stephen H. Zinder
2000-04-15
This grant supported research on methanogenic archaea. The two major areas that were supported were conversion of acetic acid to methane and nitrogen fixation by Methanosarcina. Among the achievements of this research were the isolation of novel methanogenic cultures, elucidation of the pathways from acetate to methane, description of a specific DNA-binding complex in nitrogen fixing methanogens, and demonstration of an alternative nitrogenase in Methanosarcina.
Ohnemueller, Frank; Heubeck, Christoph; Kirstein, Jens; Gamper, Antonia
2010-05-01
time and immediately predates the initiation of basin shortening. Basin compartmentalization was likely due to the movement along a group of major faults (Sheba, Haki, Barbrook, Saddleback Faults) between the present Saddleback and Eureka Synclines, creating at least two subbasins in late Moodies time. Even though sediment provenance thus became localized, intensive Archaean weathering likely contributed to generate petrographically similar quartz-rich sandstones in fault-bounded minibasins. The late-Moodies minibasins may have become connected occasionally, allowing concurrent deposition of thin BIFs. A similar phase of movement along the major transcurrent Inyoka Fault may be responsible for the distinct petrographic character of Moodies sandstones south of that fault.
Directory of Open Access Journals (Sweden)
Shimba D. Kwelwa
2018-04-01
Full Text Available Three major gold deposits, Matandani, Kukuluma, and Area 3, host several million ouncez (Moz of gold, along a ~5 km long, WNW trend in the E part of the Geita Greenstone Belt, NW Tanzania. The deposits are hosted in Archaean volcanoclastic sediment and intrusive diorite. The geological evolution of the deposits involved three separate stages: (1 an early stage of syn-sedimentary extensional deformation (D1 around 2715 Ma; (2 a second stage involving overprinting ductile folding (D2–4 and shearing (D5–6 events during N-S compression between 2700 and 2665 Ma, coeval with the emplacement of the Kukuluma Intrusive Complex; and (3 a final stage of extensional deformation (D7 accommodated by minor, broadly east-trending normal faults, preceded by the intrusion of felsic porphyritic dykes at ~2650 Ma. The geometry of the ore bodies at Kukuluma and Matandani is controlled by the distribution of magnetite-rich meta-ironstone, near the margins of monzonite-diorite bodies of the Kukuluma Intrusive Complex. The lithological contacts acted as redox boundaries, where high-grade mineralization was enhanced in damage zones with higher permeability, including syn-D3 hydrothermal breccia, D2–D3 fold hinges, and D6 shears. The actual mineralizing event was syn-D7, and occurred in an extensional setting that facilitated the infiltration of mineralizing fluids. Thus, whilst gold mineralization is late-tectonic, ore zone geometries are linked to older structures and lithological boundaries that formed before gold was introduced. The deformation-intrusive history of the Kukuluma and Matandani deposits is near identical to the geological history of the world-class Nyankanga and Geita Hill deposits in the central part of the Geita Greenstone Belt. This similarity suggests that the geological history of much of the greenstone belt is similar. All major gold deposits in the Geita Greenstone Belt lack close proximity to crustal-scale shear zones; they are associated
Final Technical Report for Award # ER64999
Energy Technology Data Exchange (ETDEWEB)
Metcalf, William W. [University of Illinois
2014-10-08
This report provides a summary of activities for Award # ER64999, a Genomes to Life Project funded by the Office of Science, Basic Energy Research. The project was entitled "Methanogenic archaea and the global carbon cycle: a systems biology approach to the study of Methanosarcina species". The long-term goal of this multi-investigator project was the creation of integrated, multiscale models that accurately and quantitatively predict the role of Methanosarcina species in the global carbon cycle under dynamic environmental conditions. To achieve these goals we pursed four specific aims: (1) genome sequencing of numerous members of the Order Methanosarcinales, (2) identification of genomic sources of phenotypic variation through in silico comparative genomics, (3) elucidation of the transcriptional networks of two Methanosarcina species, and (4) development of comprehensive metabolic network models for characterized strains to address the question of how metabolic models scale with genetic distance.
Moyen, Jean-François; Martin, Hervé
2012-09-01
TTGs (tonalite-trondhjemite-granodiorite) are one of the archetypical lithologies of Archaean cratons. Since their original description in the 1970s, they have been the subject of many studies and discussions relating to Archaean geology. In this paper, we review the ideas, concepts and arguments brought forward in these 40 years, and try to address some open questions — both old and new. The late 1960s and the 1970s mark the appearance of "grey gneisses" (TTG) in the scientific literature. During this period, most work was focused on the identification and description of this suite, and the recognition that it is a typical Archaean lithology. TTGs were already recognised as generated by melting of mafic rocks. This was corroborated during the next decade, when detailed geochemical TTG studies allowed us to constrain their petrogenesis (melting of garnet-bearing metamafic rocks), and to conclude that they must have been generated by Archaean geodynamic processes distinct from their modern counterparts. However, the geodynamic debate raged for the following 30 years, as many distinct tectonic scenarios can be imagined, all resulting in the melting of mafic rocks in the garnet stability field. The 1990s were dominated by experimental petrology work. A wealth of independent studies demonstrated that melting of amphibolites as well as of mafic eclogites can give rise to TTG liquids; whether amphibolitic or eclogitic conditions are more likely is still an ongoing debate. From 1990s onwards, one of the key questions became the comparison with modern adakites. As originally defined these arc lavas are reasonably close equivalents to Archaean TTGs. Pending issues largely revolve around definitions, as the name TTG has now been applied to most Archaean plutonic rocks, whether sodic or potassic, irrespective of their HREE contents. This leads to a large range of petrogenetic and tectonic scenarios; a fair number of which may well have operated concurrently, but are
International Nuclear Information System (INIS)
Lafon, J.M.; Scheller, T.; Pereira, E.D.; Macambira, J.B.
1990-01-01
The Cumaru granodiorite occurs in the Serra dos Gradaus region, southeastern part of the Metallogenic Province of Carajas, Para. Rb-Sr systematics have been provided in whole rocks and minerals for samples of the Cumaru granodiorite thus an age of 2543 ± 53 Ma, with an initial isotopic ratio of 0.70311 ± 34 (MSWD+1.87) was obtained for whole rocks samples. Taking in account that these rocks are not affected by metamorphism and/or deformation, we consider the age of 2543 ± 53 Ma as an emplacement age corresponding to the crystallization of the body. Such an age confirms the existence of a late Archaean plutonic event in the Serra dos Gradaus area and the interpretation of the Cumaru granodiorite as a contemporaneous and cogenetic body of the Juruena type granites (Ca. 2000 Ma old), as proposed previously, must be definitively abandoned. Therefore, Archaean ages for the greenstone belt sequence (Gradaus group) as well as for the Xingu complex in this area are also confirmed, although by indirect evidence. The age obtained implies that the latter represents an Archaean metamorphic basement in the Serra dos Gradaus region rather than the reworking of the late archaean granitics rocks during the Transmazonian orogenic event. The initial isotopic ratio of 0.70311 ± 34 is close to a mantellic or low time of crustal residence source material ratios at the end of Archaean times. Therefore, comparison with isotopic initial ratios of other granitic rocks which occur in the Rio Maria region identifies an evolution line with a Rb-Sr ratio of 0.25 for a crustal source material that would have separated from mantle about 2.8 Ga ago. (author)
Key, R.M.; Pitfield, P.E.J.; Thomas, Ronald J.; Goodenough, K.M.; Waele, D.; Schofield, D.I.; Bauer, W.; Horstwood, M.S.A.; Styles, M.T.; Conrad, J.; Encarnacion, J.; Lidke, D.J.; O'connor, E. A.; Potter, C.; Smith, R.A.; Walsh, G.J.; Ralison, A.V.; Randriamananjara, T.; Rafahatelo, J.-M.; Rabarimanana, M.
2011-01-01
Our recent geological survey of the basement of central and northern Madagascar allowed us to re-evaluate the evolution of this part of the East Africa-Antarctica Orogen (EAAO). Five crustal domains are recognized, characterized by distinctive lithologies and histories of sedimentation, magmatism, deformation and metamorphism, and separated by tectonic and/or unconformable contacts. Four consist largely of Archaean metamorphic rocks (Antongil, Masora and Antananarivo Cratons, Tsaratanana Complex). The fifth (Bemarivo Belt) comprises Proterozoic meta-igneous rocks. The older rocks were intruded by plutonic suites at c. 1000 Ma, 820-760 Ma, 630-595 Ma and 560-520 Ma. The evolution of the four Archaean domains and their boundaries remains contentious, with two end-member interpretations evaluated: (1) all five crustal domains are separate tectonic elements, juxtaposed along Neoproterozoic sutures and (2) the four Archaean domains are segments of an older Archaean craton, which was sutured against the Bemarivo Belt in the Neoproterozoic. Rodinia fragmented during the early Neoproterozoic with intracratonic rifts that sometimes developed into oceanic basins. Subsequent Mid- Neoproterozoic collision of smaller cratonic blocks was followed by renewed extension and magmatism. The global 'Terminal Pan-African' event (560-490 Ma) finally stitched together the Mid-Neoproterozoic cratons to form Gondwana. ?? The Geological Society of London 2011.
International Nuclear Information System (INIS)
Strnad, J.G.
1980-01-01
While the Beaverlodge area of Northern Saskatchewan became an important uranium-producing district during the 1950s, the Athabasca sandstone basin, located in the immediate vicinity, was considered to be non-prospective in Canada's regional assessment. Twenty years later, with the introduction of the supergene model into the basin's exploration strategy, the favourability of the host-rock for uranium deposits was shown. However, in some instances the search for local targets was enriched by implementing non-supergene models. Most geologists originally favoured the Middle Proterozoic (sub-Helikian) unconformity as a unique ore-controlling feature. Later, the concept of Lower Proterozoic (Aphebian) syngenetic protore, as represented by graphite-bearing strata in Archaean proximity, was added. In the author's view the combination of these factors is productive only within specialized segments of Archaean-Lower Proterozoic (Archaean-Aphebian) contact zones. (author)
The first 800 million years of earth's history
Smith, J. V.
1981-01-01
It is pointed out that there is no direct geological information on the first 750 Ma of earth history. Consequently the reported study is based on controversial inferences drawn from the moon, other planets and meteorites, coupled with backward extrapolation from surviving terrestrial rocks, especially those of Archaean age. Aspects of accretion are considered, taking into account cosmochemical and cosmophysical evidence, a new earth model, and convection systems. Attention is given to phase-equilibrium constraints, estimates of heat production, the bombardment history of the moon and implications for the earth, and the nature of the early crust. From a combination of physical, chemical, and petrological arguments, it is concluded that the earth's surface underwent intense volcanism in the pre-Archaean era, and that the rock types were chemically similar to those found in the early Archaean era.
The development of continental crust through geological time: the South African case
International Nuclear Information System (INIS)
Dia, A.; Allegre, C.J.; Erlank, A.J.
1990-01-01
Nd isotopic compositions and 147 Sm/ 144 Nd ratios were measured in fifty-eight South African shales and greywackes with depositional ages ranging from 0.2 to 3.3 b.y. Elements such as the rare earths, which are poorly soluble in water and not fractionated during exogeneous processes, preserve the signature of the original crustal source. The 147 Sm/ 144 Nd ratios appear to be approximately constant throughout the time interval sampled. We calculated Nd model ages of crustal differentiation. Knowing that the shales represent a true blend of different continental areas we consider these model ages representative of the mean ages of their primitive continental sources. Then, using the inverse technique developed by Allegre and Rousseau in 1984, we computed a growth curve for the continental crust in South Africa. Two periods of important crustal genesis (Archaean and around 1.5 b.y.) can be compared with the observed geology and with other continental crust growth curves obtained in previous studies in southern Africa and in Australia. The observation of large variations in the MgO content and Ni, Cr, U and Th concentrations between Archaean South African shales and post-Archaean samples compared to the constancy of the 147 Sm/ 144 Nd ratios leads us to propose that the Archaean crust was composed of both granite (70.5%) and a mafic component (29.5%) which could have been komatiite. The small dispersion of 147 Sm/ 144 Nd ratios suggests that erosion and sedimentation processes yielded homogeneous Archaean shales. The present-day continental crust is much more heterogeneous, because it has undergone several episodes of recycling. Thus recent shales are characterized by more variable 147 Sm/ 144 Nd ratios. (orig.)
Computational Modeling of Fluctuations in Energy and Metabolic Pathways of Methanogenic Archaea
Energy Technology Data Exchange (ETDEWEB)
Luthey-Schulten, Zaida [Univ. of Illinois, Urbana-Champaign, IL (United States). Dept. of Chemistry; Carl R. Woese Inst. for Genomic Biology
2017-01-04
investigations of the methanogen Methanosarcina acetivorans. By integrating an unprecedented transcriptomics dataset for growth of the methanogen on many substrates with an in silico model, heterogeneity in metabolic pathway usage and methane production were examined. This lent insight into the physiological requirements of the organism under different environmental conditions and uncovered the unique regulatory role that mRNA half-life has in shaping metabolic flux distributions in this organism.
Fossil Microorganisms in Archaean
Astafleva, Marina; Hoover, Richard; Rozanov, Alexei; Vrevskiy, A.
2006-01-01
Ancient Archean and Proterozoic rocks are the model objects for investigation of rocks comprising astromaterials. The first of Archean fossil microorganisms from Baltic shield have been reported at the last SPIE Conference in 2005. Since this confeence biomorphic structures have been revealed in Archean rocks of Karelia. It was determined that there are 3 types of such bion structures: 1. structures found in situ, in other words microorganisms even-aged with rock matrix, that is real Archean fossils biomorphic structures, that is to say forms inhabited early formed rocks, and 3. younger than Archean-Protherozoic minerali microorganisms, that is later contamination. We made attempt to differentiate these 3 types of findings and tried to understand of burial of microorganisms. The structures belongs (from our point of view) to the first type, or real Archean, forms were under examination. Practical investigation of ancient microorganisms from Green-Stone-Belt of Northern Karelia turns to be very perspective. It shows that even in such ancient time as Archean ancient diverse world existed. Moreover probably such relatively highly organized cyanobacteria and perhaps eukaryotic formes existed in Archean world.
Directory of Open Access Journals (Sweden)
Caifeng Li
2015-11-01
Full Text Available The correlation between the North China Craton (NCC and the Indian Shield (IND has been a hot topic in recent years. On the basis of ore deposit databases, the NCC and IND have shown broad similarity in metallogenesis from the middle Archaean to the Mesoproterozoic. The two blocks both have three major metallogenic systems: (1 the Archaean BIF metallogenic system; (2 the Paleoproterozoic Cu-Pb-Zn metallogenic system; and (3 the Mesoproterozoic Fe-Pb-Zn system. In the north margin of the NCC and the west margin of the IND, the Archaean BIF-Au-Cu-Pb-Zn deposits had the same petrogenesis and host rocks, the Paleoproterozoic Cu-Pb-Zn deposits were controlled by active belts, and the Mesoproterozoic Fe-Pb-Zn deposits were mainly related to multi-stage rifting. Matching regional mineralization patterns and geological features has established the continental assembly referred to as “NCWI”, an acronym for the north margin of the NCC (NC and the west margin of the IND (WI during the middle Archaean to the Mesoproterozoic. In this assembly, the available geological and metallogenic data from the Eastern Block and active belts of NC fit those from the Dharwar craton and the Aravalli–Delhi–Vindhyan belt of WI, respectively. Moreover, the depositional model and environment of Paleoproterozoic metasedimentary manganese deposits in NCWI implied that the assembly may be located at low latitudes, where the conditions were favorable for dissolving ice and precipitating manganese deposits.
Tera, F.
2011-12-01
other rocks from Isua Greenstone Belt (1) and Amîtsoq gneiss (4) fall inside the TULIP triangle of SOI, suggesting potential derivation of these Archaean rocks from the same homogeneous source.
Palaeomagnetism and the continental crust
Energy Technology Data Exchange (ETDEWEB)
Piper, J.D.A.
1987-01-01
This book is an introduction to palaeomagnetism offering treatment of theory and practice. It analyzes the palaeomagnetic record over the whole of geological time, from the Archaean to the Cenozoic, and goes on to examine the impact of past geometries and movements of the continental crust at each geological stage. Topics covered include theory of rock and mineral magnetism, field and laboratory methods, growth and consolidation of the continental crust in Archaean and Proterozoic times, Palaeozoic palaeomagnetism and the formation of Pangaea, the geomagnetic fields, continental movements, configurations and mantle convection.
ORF Alignment: NC_003901 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Methanosarcina mazei Goe1] ... Length = 532 ... Query: 5 ... EDSLGKYFEKQVAVDPNHEFIIYPDRNLRFTYGQFN...ERVNNLAKGLLAIGIKKGDHVGIW 64 ... EDSLGKYFEKQVAVDPNHEFIIYPDRNLRFTYGQFNERVNNL...AKGLLAIGIKKGDHVGIW Sbjct: 1 ... EDSLGKYFEKQVAVDPNHEFIIYPDRNLRFTYGQFNERVNNLAKGLLAIGIKKGDHVGIW 60 ... Query: 125 NG
International Nuclear Information System (INIS)
Sarkar, G.; Gupta, S.N.; Bishui, P.K.
1994-01-01
Deformed gneisses from the southern Bastar craton yield Rb-Sr whole-rock ages of 2560 Ma and 2659 Ma with initial Sr ratios ranging between 0.70899 and 0.70726 respectively. The isotopic data are found to be scattered even at the outcrop scale which possibly indicate large-scale reworking of the gneisses during the period. The high initial Sr ratios that associate with scattering of the isotopic data reflect reworking of older gneisses. Geochemically, these gneisses are considered to be derived from an amphibolitic or basaltic protolith. The 2095 Ma (initial Sr ratio of 0.74312) old leucocratic granite intrusive into these gneisses represent early Proterozoic magmatic activity. Based on the available isotopic and geochemical data, it is suggested that the Bastar craton represents a polyphase, multicomponent terrain developed by repeated magmatism at a much earlier, probably during mid-Archaean, time and was extensively reworked during the time span between end-Archaean and early Proterozoic period. This reworking may be synchronous with coalescing of smaller crustal components possibly during the end-Archaean time. (author). 21 refs., 5 figs., 2 tabs
[Conversion of acetic acid to methane by thermophiles
Energy Technology Data Exchange (ETDEWEB)
Zinder, S.H.
1993-01-01
The primary goal of this project is to obtain a better understanding of thermophilic microorganisms which convert acetic acid to CH[sub 4]. The previous funding period represents a departure from earlier research in this laboratory, which was more physiological and ecological. The present work is centered on the biochemistry of the thermophile Methanothrix sp. strain CALS-1. this organism presents a unique opportunity, with its purity and relatively rapid growth, to do comparative biochemical studies with the other major acetotrophic genus Methanosarcina. We previously found that Methanothrix is capable of using acetate at concentrations 100 fold lower than Methanosarcina. This finding suggests that there are significant differences in the pathways of methanogenesis from acetate in the two genera.
[Conversion of acetic acid to methane by thermophiles]. Progress report, May 15, 1989--May 14, 1993
Energy Technology Data Exchange (ETDEWEB)
Zinder, S.H.
1993-06-01
The primary goal of this project is to obtain a better understanding of thermophilic microorganisms which convert acetic acid to CH{sub 4}. The previous funding period represents a departure from earlier research in this laboratory, which was more physiological and ecological. The present work is centered on the biochemistry of the thermophile Methanothrix sp. strain CALS-1. this organism presents a unique opportunity, with its purity and relatively rapid growth, to do comparative biochemical studies with the other major acetotrophic genus Methanosarcina. We previously found that Methanothrix is capable of using acetate at concentrations 100 fold lower than Methanosarcina. This finding suggests that there are significant differences in the pathways of methanogenesis from acetate in the two genera.
International Nuclear Information System (INIS)
Xia Yuliang; Rong Jiashu; Lin Jinrong; Zheng Maogong; Wen Xiyuan
1993-05-01
Based on the systematic studies of petrology, geochemistry and isotope geochronology, the Early Precambrian metamorphic complex in Northern Hebei province of China can be divided into three different series, i.e. granulite series, khondalite series and amphibolitic-felsic rock series. The so called 'magmatic granitoids' in that area are actually some magmagranites with different ages and different geneses, and they are not formed by migmatization. Up to now, the discovered Huaian complex which was formed in 3.5 Ga ago is the oldest nuclear area in the northern margin of North-China Platform. The granulite series, khondalite series and amphibolitic-felsic rock series belong to Early Archaean (>3.0 +- 0.1 Ga), Middle Archaean (>2.7 +- 0.1 Ga) and Later Archaean (>2.4 +- 0.1 Ga) respectively. The geological time scale of the Early Precambrian for Northern Hebei Province has been built. According to the synthetic analyses of various factors there is no prospect of uranium mineralization in the ancient terrain. However, the Mesozoic volcanic basins covering over the Hercynian Period granites would be main goal for looking for large uranium deposits in north part in that area
Vanreenen, D. D.; Barton, J. M., Jr.; Roering, C.; Vanschalkwyk, J. C.; Smit, C. A.; Debeer, J. D.; Stettler, E. H.
1986-01-01
High-grade gneiss terranes and low-grade granite-greenstone terranes are well known in several Archaean domains. The geological relationship between these different crustal regions, however, is still controversial. One school of thought favors fundamental genetic differences between high-grade and low-grade terranes while others argue for a depth-controlled crustal evolution. The detailed examination of well-exposed Archaean terranes at different metamorphic grades, therefore, is not only an important source of information about the crustal levels exposed, but also is critical to the understanding of the possible tectonic and metamorphic evolution of greenstone belts with time. Three South African greenstone belts are compared.
International Nuclear Information System (INIS)
Needham, R.S.; Ewers, G.R.; Ferguson, J.
1988-01-01
The Pine Creek Geosyncline is a 66,000 km 2 inlier of Early Proterozoic metasediments, mafic and felsic intrusives and minor extrusives, surrounding small late Archaean granitic domes. Economic uranium occurrences cluster into three fields, with the Alligator Rivers field being the most significant. The metasediments are alluvial and reduced shallow-water pelites and psammites. Evaporitic carbonate developed on shallow shelves around Archaean islands. Basin development and sedimentation (c. 2000-1870 Ma) were related to gradual subsidence induced by crustal extension. Facies variations and volcanism were in places controlled by the extensional faults. The rocks were metamorphosed to lower the high grade, complexly folded, and intruded by numerous granitoids from c. 1870 to 1730 Ma. Late orogenic felsic volcanics accumulated in local rift systems. Middle Proterozoic sandstone was deposited on a peneplaned and deeply weathered surface from about 1650 Ma. Uranium is enriched in some Archaean and Proterozoic igneous rocks, but there is no local or regional enrichment of the metasedimentary hosts or of the unconformably overlying sandstone. There is no regional gravity, magnetic or radiometric character attributable to the region's significance as a uranium province; contrasts with surrounding sedimentary basins reflect expected differences in rock properties between a heterogeneous igneous/metamorphic region and relatively homogeneous undeformed and unmineralized sediments. Uranium-enriched Archaean and Proterozoic granitoids and felsic volcanics with labile U are likely though not exclusive source rocks. U was probably transported in oxidized low temperature solutions as uranyl complexes and precipitated in reduced, structurally controlled, low-pressure traps. All uranium occurrences are broadly classified as 'Proterozoic unconformity related'. Greatest potential for further discovery is offered in the Alligator Rivers field, where perhaps at least 3 to 5.5 times the
Earth's first stable continents did not form by subduction.
Johnson, Tim E; Brown, Michael; Gardiner, Nicholas J; Kirkland, Christopher L; Smithies, R Hugh
2017-03-09
The geodynamic environment in which Earth's first continents formed and were stabilized remains controversial. Most exposed continental crust that can be dated back to the Archaean eon (4 billion to 2.5 billion years ago) comprises tonalite-trondhjemite-granodiorite rocks (TTGs) that were formed through partial melting of hydrated low-magnesium basaltic rocks; notably, these TTGs have 'arc-like' signatures of trace elements and thus resemble the continental crust produced in modern subduction settings. In the East Pilbara Terrane, Western Australia, low-magnesium basalts of the Coucal Formation at the base of the Pilbara Supergroup have trace-element compositions that are consistent with these being source rocks for TTGs. These basalts may be the remnants of a thick (more than 35 kilometres thick), ancient (more than 3.5 billion years old) basaltic crust that is predicted to have existed if Archaean mantle temperatures were much hotter than today's. Here, using phase equilibria modelling of the Coucal basalts, we confirm their suitability as TTG 'parents', and suggest that TTGs were produced by around 20 per cent to 30 per cent melting of the Coucal basalts along high geothermal gradients (of more than 700 degrees Celsius per gigapascal). We also analyse the trace-element composition of the Coucal basalts, and propose that these rocks were themselves derived from an earlier generation of high-magnesium basaltic rocks, suggesting that the arc-like signature in Archaean TTGs was inherited from an ancestral source lineage. This protracted, multistage process for the production and stabilization of the first continents-coupled with the high geothermal gradients-is incompatible with modern-style plate tectonics, and favours instead the formation of TTGs near the base of thick, plateau-like basaltic crust. Thus subduction was not required to produce TTGs in the early Archaean eon.
International Nuclear Information System (INIS)
Artur, A.C.; Wernick, E.; Kawashita, K.
1990-01-01
The geology of the southern part of the State of Minas Gerais and adjacent parts of the State of Sao Paulo (SE Brazil) is built up by gray gneisses (Barbacena and Amparo Complexes), pink gneisses (Pinhal Complex) and granulites (Guaxupe Complex) areas, the oldest of them of Archaean ages. Structural, petrographic, geochronological and geologic data indicate that in fact each of those complexes is the result of a long evolution including successive phases of deformation, anatexis and intrusions. The extensive migmatization of the Archaean rocks during the Lower and Upper Proterozoic combined with the intrusion of huge granitoid bodies suggest that the considered region has been involved in successively continental approaches by subduction/collision processes. (author)
Climbing ripple structure and associated storm-lamination from a ...
Indian Academy of Sciences (India)
Pranhita–Godavari Valley, south India, displays well developed climbing ripple lamination and ... sedimentary environments, such as river flood .... Sediment, sequence and facies ..... tic Archaean Witwatersrand Supergroup, South Africa;.
In search of Archean basement from Rio Maria region, southeastern of Para State
International Nuclear Information System (INIS)
Macambira, M.B.; Lancelot, J.
1991-01-01
The Rio Maria Region, southeastern part of the Amazonian craton (Brazil), displays a typical Archaean granite-greenstone association intruded by Proterozoic granites. The greenstone is crosscut by Archaean granitoids, such as the Rio Maria granodiorite. Clear field contacts between the Xingu gneisses and the granodiorite are lacking, making it difficult to determine the stratigraphic sequence. U-Pb data for zircons from the Xingu gneiss and the Rio Maria granodiorite provide upper intercept ages of 2971 +30/ -28 Ma and 2874 +9/ -10 Ma respectively on the Concordia diagram. 2.97 Ga is the most ancient age ever obtained on zircons from gneisses of the Amazonian craton. It provides an upper limit for the beginning of the continental crust formation in this part of the craton. (author)
Isolation and characterization of new strains of methanogens from cold terrestrial habitats.
Simankova, Maria V; Kotsyurbenko, Oleg R; Lueders, Tillmann; Nozhevnikova, Alla N; Wagner, Bianca; Conrad, Ralf; Friedrich, Michael W
2003-06-01
Five strains of methanogenic archaea (MT, MS, MM, MSP, ZB) were isolated from permanently and periodically cold terrestrial habitats. Physiological and morphological studies, as well as phylogenetic analyses of the new isolates were performed. Based on sequences of the 16S rRNA and methyl-coenzyme M reductase a-subunit (mcrA) genes all new isolates are closely related to known mesophilic and psychrotolerant methanogens. Both, phylogenetic analyses and phenotypic properties allow to classify strains MT, MS, and MM as members of the genus Methanosarcina. Strain MT is a new ecotype of Methanosarcina mazei, whereas strains MM and MS are very similar to each other and can be assigned to the recently described psychrotolerant species Methanosarcina lacustris. The hydrogenotrophic strain MSP is a new ecotype of the genus Methanocorpusculum. The obligately methylotrophic strain ZB is closely related to Methanomethylovorans hollandica and can be classified as new ecotype of this species. All new isolates, including the strains from permanently cold environments, are not true psychrophiles according to their growth temperature characteristics. In spite of the ability of all isolates to grow at temperatures as low as 1-5 degrees C, all of them have their growth optima in the range of moderate temperatures (25-35 degrees C). Thus, they can be regarded as psychrotolerant organisms. Psychrotolerant methanogens are thought to play an important role in methane production in both, habitats under seasonal temperature variations or from permanently cold areas.
Yun, Jeonghee; Lee, Sang Don; Cho, Kyung-Suk
2016-05-01
This study aimed to investigate the interaction between methane production performance and active microbial community dynamics at different loading rates by increasing influent substrate concentration. The model system was an upflow anaerobic sludge blanket (UASB) reactor using molasses wastewater. The active microbial community was analyzed using a ribosomal RNA-based approach in order to reflect active members in the UASB system. The methane production rate (MPR) increased with an increase in organic loading rate (OLR) from 3.6 to 5.5 g COD·L(-1)·day(-1) and then it decreased with further OLR addition until 9.7 g COD·L(-1)·day(-1). The UASB reactor achieved a maximum methane production rate of 0.48 L·L(-1)·day(-1) with a chemical oxygen demand (COD) removal efficiency of 91.2 % at an influent molasses concentration of 16 g COD·L(-1) (OLR of 5.5 g COD·L(-1)·day(-1)). In the archaeal community, Methanosarcina was predominant irrespective of loading rate, and the relative abundance of Methanosaeta increased with loading rate. In the bacterial community, Firmicutes and Eubacteriaceae were relatively abundant in the loading conditions tested. The network analysis between operation parameters and microbial community indicated that MPR was positively associated with most methanogenic archaea, including the relatively abundant Methanosarcina and Methanosaeta, except Methanofollis. The most abundant Methanosarcina was negatively associated with Bifidobacterium and Methanosaeta, whereas Methanosaeta was positively associated with Bifidobacterium.
Energy Technology Data Exchange (ETDEWEB)
Zellner, G.; Geveke, M.; Diekmann, H. (Hannover Univ. (Germany). Inst. fuer Mikrobiologie); Conway de Macario, E. (New York State Dept. of Health, Albany, NY (United States). Wadsworth Center for Laboratories and Research)
1991-12-01
Population dynamics during start-up of a fluidized-bed reactor with butyrate or butyrate plus acetate as sole substrates as well as biofilm development on the sand substratum were studied microbiologically, immunologically and by scanning electron microscopy. An adapted syntrophic consortium consisting of Syntrophospora sp., Methanothrix soehngenii, Methanosarcina mazei and Methanobrevibacter arboriphilus or Methanogenium sp. achieved high-rate butyrate degradation to methane and carbon dioxide. Desulfovibrio sp., Methanocorpusculum sp., and Methanobacterium sp. were also present in lower numbers. Immunological analysis demonstrated methanogens antigenically related to Methanobrevibacter ruminantium M1, Methanosarcina mazei S6, M. thermophila TM1, Methanobrevibacter arboriphilus AZ and Methanothrix soehngenii Opfikon in the biofilm. Immunological analysis also showed that the organisms isolated from the butyrate-degrading culture used as a source of inoculum were related to M. soehngenii Opfikon, Methanobacterium formicium MF and Methanospirillum hungatei JF1. (orig.).
Effect of different ammonia sources on aceticlastic and hydrogenotrophic methanogens
DEFF Research Database (Denmark)
Tian, Hailin; Fotidis, Ioannis; Kissas, Konstantinos
2018-01-01
Ammonium chloride (NH4Cl) was usually used as a model ammonia source to simulate ammonia inhibition during anaerobic digestion (AD) of nitrogen-rich feedstocks. However, ammonia in AD originates mainly from degradation of proteins, urea and nucleic acids, which is distinct from NH4Cl. Thus......, in this study, the inhibitory effect of a “natural” ammonia source (urea) and NH4Cl, on four pure methanogenic strains (aceticlastic: Methanosarcina thermophila, Methanosarcina barkeri; hydrogenotrophic: Methanoculleus bourgensis, Methanoculleus thermophilus), was assessed under mesophilic (37 °C......) and thermophilic (55 °C) conditions. The results showed that urea hydrolysis increased pH significantly to unsuitable levels for methanogenic growth, while NH4Cl had a negligible effect on pH. After adjusting initial pH to 7 and 8, urea was significantly stronger inhibitor with longer lag phases to methanogenesis...
Thermophilic anaerobic acetate-utilizing methanogens and their metabolism
DEFF Research Database (Denmark)
Mladenovska, Zuzana
Six strains of thermophilic anaerobic acetate-utilizing methanogens were isolated from different full-scale thermophilic biogas plants in China and Denmark. The strain isolated from the Chinese biogas plant was designated KN-6P and the isolates from the Danish full-scale biogas plants were......, utilizing the substrates acetate, methanol and methylamines but not hydrogen/carbon dioxide. Strain Methanosarcina sp. SO-2P was able to grow mixotrophically on methanol and hydrogen/carbon dioxide with methane formation from hydrogen and carbon dioxide occurring after methanol depletion. All six...... designated HG-1P, LVG-4P R1-1P, SO-2P and V-1P. The isolates were characterized morphologically and physiologically, and their immunological and phylogenetic relatedness to already known isolated strains were established. All isolated strains were identified as organisms belonging to genus Methanosarcina...
High Sr/Y rocks are not all adakites!
Moyen, Jean-François
2010-05-01
The name of "adakite" is used to describe a far too large group of rocks, whose sole common feature is high Sr/Y and La/Yb ratios. Defining adakites only by this criterion is misleading, as the definition of this group of rocks does include many other criteria, including major elements. In itself, high (or commonly moderate!) Sr/Y ratios can be achieved via different processes: melting of a high Sr/Y (and La/Yb) source; deep melting, with abundant residual garnet; fractional crystallization or AFC; or interactions of felsic melts with the mantle, causing selective enrichment in LREE and Sr over HREE. A database of the compositions of "adakitic" rocks - including "high silica" and "low silica" adakites, "continental" adakites and Archaean adakites—was assembled. Geochemical modeling of the potential processes is used to interpret it, and reveals that (1) the genesis of high-silica adakites requires high pressure evolution (be it by melting or fractionation), in equilibrium with large amounts of garnet; (2) low-silica adakites are explained by garnet-present melting of an adakite-metasomatized mantle, i.e at depths greater than 2.5 GPa; (3) "Continental" adakites is a term encompassing a huge range of rocks, with a corresponding diversity of petrogenetic processes, and most of them are different from both low- and high- silica adakites; in fact in many cases it is a complete misnomer and the rocks studied are high-K calc-alkaline granitoids or even S-type granites; (4) Archaean adakites show a bimodal composition range, with some very high Sr/Y examples (similar to part of the TTG suite) reflecting deep melting (> 2.0 GPa) of a basaltic source with a relatively high Sr/Y, while lower Sr/Y rocks formed by shallower (1.0 GPa) melting of similar sources. Comparison with the Archaean TTG suite highlights the heterogeneity of the TTGs, whose composition spreads the whole combined range of HSA and Archaean adakites, pointing to a diversity of sources and processes
Zheng, Shiling; Wang, Bingchen; Liu, Fanghua; Wang, Oumei
2017-11-01
Minerals that contain ferric iron, such as amorphous Fe(III) oxides (A), can inhibit methanogenesis by competitively accepting electrons. In contrast, ferric iron reduced products, such as magnetite (M), can function as electrical conductors to stimulate methanogenesis, however, the processes and effects of magnetite production and transformation in the methanogenic consortia are not yet known. Here we compare the effects on methanogenesis of amorphous Fe (III) oxides (A) and magnetite (M) with ethanol as the electron donor. RNA-based terminal restriction fragment length polymorphism with a clone library was used to analyse both bacterial and archaeal communities. Iron (III)-reducing bacteria including Geobacteraceae and methanogens such as Methanosarcina were enriched in iron oxide-supplemented enrichment cultures for two generations with ethanol as the electron donor. The enrichment cultures with A and non-Fe (N) dominated by the active bacteria belong to Veillonellaceae, and archaea belong to Methanoregulaceae and Methanobacteriaceae, Methanosarcinaceae (Methanosarcina mazei), respectively. While the enrichment cultures with M, dominated by the archaea belong to Methanosarcinaceae (Methanosarcina barkeri). The results also showed that methanogenesis was accelerated in the transferred cultures with ethanol as the electron donor during magnetite production from A reduction. Powder X-ray diffraction analysis indicated that magnetite was generated from microbial reduction of A and M was transformed into siderite and vivianite with ethanol as the electron donor. Our data showed the processes and effects of magnetite production and transformation in the methanogenic consortia, suggesting that significantly different effects of iron minerals on microbial methanogenesis in the iron-rich coastal riverine environment were present.
Novel Functions of an Iron-Sulfur Flavoprotein from Trichomonas vaginalis Hydrogenosomes
Czech Academy of Sciences Publication Activity Database
Smutná, T.; Pilařová, K.; Tarábek, Ján; Tachezy, J.; Hrdý, I.
2014-01-01
Roč. 58, č. 6 (2014), s. 3224-3232 ISSN 0066-4804 Grant - others:GA ČR(CZ) GC13-09208J Institutional support: RVO:61388963 Keywords : Methanosarcina thermophila * nitric oxide * Trichomonas vaginalis Subject RIV: EE - Microbiology, Virology Impact factor: 4.476, year: 2014
Link between capacity for current production and syntrophic growth in Geobacter species
DEFF Research Database (Denmark)
Rotaru, Amelia-Elena; Woodard, Trevor; Nevin, Kelly
2015-01-01
-culture with Methanosarcina barkeri, which is capable of direct interspecies electron transfer (DIET), but not with Methanospirillium hungatei capable only of H2 or formate transfer. Conductive granular activated carbon (GAC) stimulated metabolism of the G. hydrogenophilus - M. barkeri co-culture, consistent with electron...
Jansen, S.; Gonzalez-Gil, G.; Leeuwen, van H.P.
2007-01-01
The speciation of the trace nutrients Co(II) and Ni(II) in sulfide containing media can control the methanogenic activity of Methanosarcina sp., which is of importance for the optimisation of anaerobic treatment of wastewater containing methanol. To obtain more insight in the mechanistic
Involvement of methyltransferases enzymes during the energy ...
African Journals Online (AJOL)
The methyl group transfer from dimethylsulfide (DMS), trimethylamine and methanol to 2-mercaptoethanesulfonic acid (coenzyme M) were investigated from cell extracts of Methanosarcina semesiae sp. nov. to evaluate whether the enzyme systems involved were constitutive or inductive. The extracts from cells grown on ...
Early Planetary Environments and the Origin of
Indian Academy of Sciences (India)
Archaean-Hadean oceans releasing Hz- The solar flux in the. Hadean and ... universe. However, Rikken and Raupach (2000) have demonstrated that static magnetic field can bias .... origin of life is ho~ did such an interdependent system of.
Role of nickel in high rate methanol degradation in anaerobic granular sludge bioreactors
Fermoso, F.G.; Collins, G.; Bartacek, J.; O'Flaherty, V.; Lens, P.N.L.
2008-01-01
The effect of nickel deprivation from the influent of a mesophilic (30 degrees C) methanol fed upflow anaerobic sludge bed (UASB) reactor was investigated by coupling the reactor performance to the evolution of the Methanosarcina population of the bioreactor sludge. The reactor was operated at pH
Ros, M; Franke-Whittle, I H; Morales, A B; Insam, H; Ayuso, M; Pascual, J A
2013-05-01
This study evaluated the feasibility of obtaining methane in anaerobic digestion (AD) from the waste products generated by the processing of fruit and vegetables. During the first phase (0-55 d) of the AD using sludge from fruit and vegetable processing, an average value of 244±88 L kg(-1) dry matter d(-1)of biogas production was obtained, and methane content reached 65% of the biogas. Co-digestion with chopped fresh artichoke wastes in a second phase (55-71 d) enhanced biogas production, and resulted in an average value of 354±68 L kg(-1) dry matter d(-1), with higher methane content (more than 70%). The archaeal community involved in methane production was studied using the ANAEROCHIP microarray and real-time PCR. Results indicated that species of Methanosaeta and Methanosarcina were important during the AD process. Methanosarcina numbers increased after the addition of chopped fresh artichoke, while Methanosaeta numbers decreased. Copyright © 2013 Elsevier Ltd. All rights reserved.
CSIR Research Space (South Africa)
Cornell, DH
1996-07-01
Full Text Available The Ongeluk lavas form part of the Palaeoproterozoic Transvaal-Griqualand West supracrustal sequence of the Archaean Kaapvaal Craton of South Africa. They form a thick shallow-marine volcanic sequence of pillow lava, massive flows and hyaloclastite...
International Nuclear Information System (INIS)
Martini, J.E.J.
1980-04-01
Sporadic molybdenite is found associated with emerald mineralization at the contact of intrusive granite and Archaean basic rocks. The most important occurrence is at Cobra quarry. However, a general investigation and several analyses show that it has probably no economic significance
Necessity of electrically conductive pili for methanogenesis with magnetite stimulation
Directory of Open Access Journals (Sweden)
Oumei Wang
2018-03-01
Full Text Available Background Magnetite-mediated direct interspecies electron transfer (DIET between Geobacter and Methanosarcina species is increasingly being invoked to explain magnetite stimulation of methane production in anaerobic soils and sediments. Although magnetite-mediated DIET has been documented in defined co-cultures reducing fumarate or nitrate as the electron acceptor, the effects of magnetite have only been inferred in methanogenic systems. Methods Concentrations of methane and organic acid were analysed with a gas chromatograph and high-performance liquid chromatography, respectively. The concentration of HCl-extractable Fe(II was determined by the ferrozine method. The association of the defined co-cultures of G. metallireducens and M. barkeri with magnetite was observed with transmission electron micrographs. Results Magnetite stimulated ethanol metabolism and methane production in defined co-cultures of G. metallireducens and M. barkeri; however, magnetite did not promote methane production in co-cultures initiated with a culture of G. metallireducens that could not produce electrically conductive pili (e-pili, unlike the conductive carbon materials that facilitate DIET in the absence of e-pili. Transmission electron microscopy revealed that G. metallireducens and M. barkeri were closely associated when magnetite was present, as previously observed in G. metallireducens/G. sulfurreducens co-cultures. These results show that magnetite can promote DIET between Geobacter and Methanosarcina species, but not as a substitute for e-pili, and probably functions to facilitate electron transfer from the e-pili to Methanosarcina. Conclusion In summary, the e-pili are necessary for the stimulation of not only G. metallireducens/G. sulfurreducens, but also methanogenic G. metallireducens/M. barkeri co-cultures with magnetite.
Natarajan, T.; Seshachalam, S.; Ponniah, J.; Varadhan, R.; M, S.
2008-05-01
Geochemical studies, comprising major elements and trace elements, including the Rare Earth Elements (REE), have been carried out on the modern sediments of inner continental shelf representing nearshore marine environments. Concentrations were normalized with Chondrite and PAAS show LREE enriched and flat HREE patterns with slight positive Eu anomaly which is due to the influence of feldspar rich source materials. The LREE enriched and flat HREE patterns with positive Eu anomaly have been considered as the typical character of post- Archaean Sediments. The La/Th ratio ranges from 1.66 to 8.84 with an average value of 4.09, which indicates a heterogenitic source for the sediments of the study area. The La-Th-Sc ternary plot suggests all the samples fall close to the field dominated by tonalite to granite and away from the basalt and komatiite compositions and appear to be derived from sources enriched in felsic components. The transition metal ratios such as Cr/V, Ni/CO and V/Ni indicate both Archaean and Post-Archaean nature to the sediments indicating that the sediments have been derived from heterogenitic sources. The ternary diagram plot of Th-Hf-Co and La-Th-Sc falls in the field of upper continental crust of post Archaean age. This clearly indicates the terrestrial source for the sediments from the nearby landmass. The data are slightly offset from the upper crustal composition away from the Hf apex. This is probably a result of Zircon concentration. Geochemical data have also helped in ascertaining the weathering trends. The Chemical Index of Alteration (CIA) has been used to quantify the degree of weathering. The calculated CIA values for sediments demonstrate both low CIA values of less than 50 percent (low silicate weathering) and intermediate CIA values (60-70 percent) indicating that the sediments are possibly the product of sedimentary and metasedimentary rocks that have undergone intermediate chemical weathering. On an A—CN—K diagram, the data
The diamondiferous roots of our wandering continent
International Nuclear Information System (INIS)
Gurney, J.J.
1990-01-01
Mantle xenoliths and minerals, including diamonds, found in the mainly Cretaceous kimberlites on the Kalahari craton provide evidence for the stabilization of a thick pool predominantly peridotitic continental nucleus in the Archaean. This was followed by widespread formation of lesser amounts of eclogite added to the lithosphere throughout the Proterozoic. Most diamonds were derived from the Archaean peridotite and Proterozoic eclogite and were liberated into kimberlite by xenolith disaggregation. The mantle lithosphere is heterogeneous and has undergone considerable modification by such processes as intrusive igneous activity, metasomatism of different styles, subsolidus metamorphism, deformation and probably the recycling of oceanic crust throughout much of its history. Diamond formation and preservation is similarly complex. The kimberlite-borne mantle sample provides a unique window of information about continental evolution in which the diamonds and their occasional encapsulated inclusions play a key role. 88 refs., 16 figs., 1 tab
The geology of the Romuvaara area
International Nuclear Information System (INIS)
Anttila, P.; Paulamaeki, S.; Lindberg, A.; Paananen, M.; Pitkaenen, P.; Front, K.
1990-12-01
Teollisuuden Voima Oy (TVO) is preparing for the final disposal of spent uranium fuel from the Olkiluoto nuclear power plant deep in the Finnish bedrock. The report presents a summary of the geological conditions at Romuvaara in Kuhmo, which was one of the five areas selected in 1987 for the preliminary site investigations. The Romuvaara site and its surroundings belong to the Archaean basement complex, the age of the oldest parts of which is over 2800 Ma. The bedrock consists mainly of migmatic banded gneisses (tonalite, leucotonalite and mica gneiss). These rock types are intersected by granodiorite and metadiabase dykes. Proterozoic metadiabases represent the youngest rock unit in the area. Except for the metadiabase, the rocks have undergone a multiphase Archaean deformation. The bedrock structures are interpreted as representing six deformation phases, after which sharp faults developed during at least four further movement phases
Refining Raindrop Paleobarometry: A Satus Report
Zimmerman, J. K.; Som, S. M.
2016-12-01
In the late Archaean eon, a sun that was approximately 20% dimmer than today's was still able to warm the Earth to the point where there was liquid water. This is known as the `Faint Young Sun' paradox. Explanations of this paradox include a denser atmosphere rich in nitrogen1 or higher greenhouse gas concentrations. Recent work has suggested that the partial pressure of nitrogen in the late Archean was less than modern values, up to a maximum of 0.5 bar 2.7 billion years ago2. In the current work, we have compiled several global datasets on modern raindrop size and rainfall rate. Together with existing scaling on how raindrop size affects the size of resultant craters3, we use the full distribution of fossilized raindrop craters found in the Ventersdorp Supergroup, South Africa to draw conclusions about the difference in terminal velocity through the Archaean atmosphere as compared to today, in addition to inferences on rainfall rate that formed the Ventersdorp imprints. The calculated value of the terminal velocity places bounds on the range of possible densities of the Archaean atmosphere during Ventersdorp deposition. 1 Goldblatt, C., et al. "Nitrogen-enhanced greenhouse warming on early Earth." Nature Geoscience 2 (2009): 891-896. 2 Som, S., et al. "Earth's air pressure 2.7 billion years ago constrained to less than half of modern levels." Nature Geoscience (2016). 3 Som, S., et al. "Air density 2.7 billion years ago limited to less than twice modern levels by fossil raindrop imprints." Nature 484.7394 (2012): 359-362.
77 FR 51993 - Western Technical College; Notice of Availability of Environmental Assessment
2012-08-28
... project area (Source: Normandeau Associates, Inc., 2002)... Table 6. Sustained and burst swimming speeds... time, followed by a layer of Potsdam sandstone surface rock. The Potsdam sandstone layer of this... layer is Archaean-age basement rock, namely highly metamorphic gneiss, granite, and schists. The basin...
The Amazonian Craton and its influence on past fluvial systems (Mesozoic-Cenozoic, Amazonia)
Hoorn, C.; Roddaz, M.; Dino, R.; Soares, E.; Uba, C.; Ochoa-Lozano, D.; Mapes, R.; Hoorn, C.; Wesselingh, F.P.
2010-01-01
The Amazonian Craton is an old geological feature of Archaean/Proterozoic age that has determined the character of fluvial systems in Amazonia throughout most of its past. This situation radically changed during the Cenozoic, when uplift of the Andes reshaped the relief and drainage patterns of
Evolution of the Atmosphere and Oceans: Evidence from Geological ...
Indian Academy of Sciences (India)
The Archaean ocean was probably a soda ocean rich in NaZC03 and NaHC0. 3 ... times those of the present to account for an equable climate in the wake of lower ..... attributed these textural changes to a decline in carbonate satu-. Box 2.
Studies on Archaean Dharwar Tectonic Province 433
Indian Academy of Sciences (India)
age data on the geological evolution of southern India; Proc. workshop on deep continental crust of. South India, LPI Tech. Tept. No. 88-06, pp. 181-183. Viswanatha M. N, Ramakrishnan M and Swami Nath J 1982 Angular unconformity between Sargur and. Dharwar supracrustals in Shigegudda, Karnataka cration, South ...
Role of nickel in high rate methanol degradation in anaerobic granular sludge bioreactors
Fermoso, Fernando G.; Collins, Gavin; Bartacek, Jan; O’Flaherty, Vincent
2008-01-01
The effect of nickel deprivation from the influent of a mesophilic (30°C) methanol fed upflow anaerobic sludge bed (UASB) reactor was investigated by coupling the reactor performance to the evolution of the Methanosarcina population of the bioreactor sludge. The reactor was operated at pH 7.0 and an organic loading rate (OLR) of 5–15 g COD l−1 day−1 for 191 days. A clear limitation of the specific methanogenic activity (SMA) on methanol due to the absence of nickel was observed after 129 days of bioreactor operation: the SMA of the sludge in medium with the complete trace metal solution except nickel amounted to 1.164 (±0.167) g CH4-COD g VSS−1 day−1 compared to 2.027 (±0.111) g CH4-COD g VSS−1 day−1 in a medium with the complete (including nickel) trace metal solution. The methanol removal efficiency during these 129 days was 99%, no volatile fatty acid (VFA) accumulation was observed and the size of the Methanosarcina population increased compared to the seed sludge. Continuation of the UASB reactor operation with the nickel limited sludge lead to incomplete methanol removal, and thus methanol accumulation in the reactor effluent from day 142 onwards. This methanol accumulation subsequently induced an increase of the acetogenic activity in the UASB reactor on day 160. On day 165, 77% of the methanol fed to the system was converted to acetate and the Methanosarcina population size had substantially decreased. Inclusion of 0.5 μM Ni (dosed as NiCl2) to the influent from day 165 onwards lead to the recovery of the methanol removal efficiency to 99% without VFA accumulation within 2 days of bioreactor operation. PMID:18247139
Chen, Si; Cheng, Huicai; Liu, Jiang; Hazen, Terry C; Huang, Vicki; He, Qiang
2017-02-01
Acetoclastic methanogenesis is a key metabolic process in anaerobic digestion, a technology with broad applications in biogas production and waste treatment. Acetoclastic methanogenesis is known to be performed by two archaeal genera, Methanosaeta and Methanosarcina. The conventional model posits that Methanosaeta populations are more competitive at low acetate levels (competitiveness of Methanosaeta at elevated acetate was further supported by the enrichment of Methanosaeta with high concentrations of acetate (20 mM). The dominance of Methanosaeta in the methanogen community could be reproduced in anaerobic digesters with the direct addition of acetate to above 20 mM, again supporting the competitiveness of Methanosaeta over Methanosarcina at elevated acetate levels. This study for the first time systematically demonstrated that the dominance of Methanosaeta populations in anaerobic digestion could be linked to the competitiveness of Methanosaeta at elevated acetate concentrations. Given the importance of acetoclastic methanogenesis in biological methane production, findings from this study could have major implications for developing strategies for more effective control of methanogenic treatment processes.
Community and Proteomic Analysis of Anaerobic Consortia Converting Tetramethylammonium to Methane
Directory of Open Access Journals (Sweden)
Wei-Yu Chen
2017-01-01
Full Text Available Tetramethylammonium-degrading methanogenic consortia from a complete-mixing suspended sludge (CMSS and an upflow anaerobic sludge blanket (UASB reactors were studied using multiple PCR-based molecular techniques and shotgun proteomic approach. The prokaryotic 16S rRNA genes of the consortia were analyzed by quantitative PCR, high-throughput sequencing, and DGGE-cloning methods. The results showed that methanogenic archaea were highly predominant in both reactors but differed markedly according to community structure. Community and proteomic analysis revealed that Methanomethylovorans and Methanosarcina were the major players for the demethylation of methylated substrates and methane formation through the reduction pathway of methyl-S-CoM and possibly, acetyl-CoA synthase/decarbonylase-related pathways. Unlike high dominance of one Methanomethylovorans population in the CMSS reactor, diverse methylotrophic Methanosarcina species inhabited in syntrophy-like association with hydrogenotrophic Methanobacterium in the granular sludge of UASB reactor. The overall findings indicated the reactor-dependent community structures of quaternary amines degradation and provided microbial insight for the improved understanding of engineering application.
Community and Proteomic Analysis of Anaerobic Consortia Converting Tetramethylammonium to Methane
Chen, Wei-Yu; Kraková, Lucia; Pangallo, Domenico; Jeszeová, Lenka; Liu, Bing; Yasui, Hidenari
2017-01-01
Tetramethylammonium-degrading methanogenic consortia from a complete-mixing suspended sludge (CMSS) and an upflow anaerobic sludge blanket (UASB) reactors were studied using multiple PCR-based molecular techniques and shotgun proteomic approach. The prokaryotic 16S rRNA genes of the consortia were analyzed by quantitative PCR, high-throughput sequencing, and DGGE-cloning methods. The results showed that methanogenic archaea were highly predominant in both reactors but differed markedly according to community structure. Community and proteomic analysis revealed that Methanomethylovorans and Methanosarcina were the major players for the demethylation of methylated substrates and methane formation through the reduction pathway of methyl-S-CoM and possibly, acetyl-CoA synthase/decarbonylase-related pathways. Unlike high dominance of one Methanomethylovorans population in the CMSS reactor, diverse methylotrophic Methanosarcina species inhabited in syntrophy-like association with hydrogenotrophic Methanobacterium in the granular sludge of UASB reactor. The overall findings indicated the reactor-dependent community structures of quaternary amines degradation and provided microbial insight for the improved understanding of engineering application. PMID:29391857
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
The mafic rocks of east Khasi Hills of the Meghalaya Plateau, northeastern India, occur as an intrusive body which cut across the weakly metamorphosed Shillong Group of rocks. Other than Shillong Group of rocks, high grade Archaean gneissic rocks and younger porphyritic granites are also observed in the study area.
Kerr, A. C.; Marriner, G. F.; Arndt, N. T.; Tarney, J.; Nivia, A.; Saunders, A. D.; Duncan, R. A.
1996-04-01
Gorgona Island, Colombia is remarkable not only because it contains the only Phanerozoic komatiites, but also because it has mafic to ultramafic lavas with a wide range of compositions, from moderately enriched to extremely depleted (relative to Bulk Earth). The komatiite flows are, in many respects similar to Archaean komatiites; they formed from MgO-rich (18%) liquids and have upper spinifex zones and lower cumulate zones. The cumulate zones of Archaean komatiites contain many solid grains, in contrast more than 90% of the olivine in the Gorgona cumulates is highly skeletal. This combined with the fact that the Gorgona cumulate zones are thinner than those in Archaean komatiites, suggests that the komatiite magma became strongly superheated en route to the surface. The komatiites have trace element contents intermediate between those of the basalts and the ultramafic tuffs. Some basalts have isotope compositions indicative of long-term enrichment in incompatible elements, whereas other basalts and ultramafic volcanics have isotopic signatures that imply corresponding depletion. It is apparent that the plume source region of the Gorgona magmas was markedly heterogeneous, with at least two source components contributing to the observed variation in composition. This heterogeneity may have resulted from the incorporation of different components into the plume source, or it may be the result of complex melting and melt extraction processes during the ascent of a heterogeneous plume. Despite earlier suggestions that there may have been a significant age gap between depleted komatiite and basalt flows and the enriched basalts, new 40Ar- 39Ar dating of basalts and gabbros are more consistent with all being generated at 87 Ma during formation of the Caribbean/Colombian plateau, possibly at the Galapagos hotspot.
Noble metal abundances in komatiite suites from Alexo, Ontario and Gorgona Island, Colombia
Brügmann, G. E.; Arndt, N. T.; Hofmann, A. W.; Tobschall, H. J.
1987-08-01
The distribution of the chalcophile and siderophile metals Cu, Ni, Au, Pd, Ir, Os and Ru in an Archaean komatiite flow from Alexo, Ontario and in a Phanerozoic komatiitic suite of Gorgona Island, Colombia, provides new information about the geochemical behaviour of these elements. Copper, Au and Pd behave as incompatible elements during the crystallization of these ultramafic magmas. In contrast, Ni, Ir, Os and Ru concentrations systematically decrease with decreasing MgO contents, a pattern characteristic of compatible elements. These trends are most probably controlled by olivine crystallization, which implies that Ir, Os and Ru are compatible in olivine. Calculated partition coefficients for Ir, Os and Ru between olivine and the melt are about 1.8. Compared to primitive mantle, parental komatiitic liquids are enriched in (incompatible) Cu, Au and Pd and depleted in (compatible) Ir, Os and Ru. Within both Archaean and Phanerozoic komatiites, noble metal ratios such as Au/Pd, Ir/Os, Os/Ru and Ru/Ir and ratios of lithophile and siderophile elements such as Ti/Pd, Ti/Au are constant and similar to primitive mantle values. This implies that Au and Pd are moderately incompatible elements and that there has been no significant fractionation of siderophile and lithophile elements since the Archaean. Platinum-group element abundances of normal MORB are highly variable and always much lower than in komatiites, because MORB magma is saturated with sulfur and a variable but minor amount of sulfide segregated during mantle melting or during the ascent of magma to the surface. Sulfide deposits associated with komatiites display similar chalcophile element patterns to those of komatiites. Noble metal ratios such as Pd/Ir, Au/Ir, Pd/Os and Pd/Ru can be used to determine the composition of the host komatiite at the time of sulfide segregation.
International Nuclear Information System (INIS)
Kale, V.S.
1995-01-01
The disparate Archaean Cratonic Nuclei of the Indian peninsular shield coalesced together through late Archaean - Palaeoproterozoic accretionary tectonic events. The subsequent Mesoproterozoic and Neoproterozoic sequences are preserved either in the Purana basins or in the middle Proterozoic mobile belts (MPMB). The latter contain deformed and metamorphosed supracrustal sequences; and can be ascribed to compressive tectonic regimes. The Purana basins on the other hand represent shallow marine, epicratonic, passive-margin sequences deposited in an extensional tectonic regime. Major deformational events and metamorphism of the MPMB are known to have taken place around 1600 ±200 Ma and 900 ± 100 Ma. These two periods coincide with the ages of initiation and major intrabasinal breaks in the growth of the Purana basins. The contemporary juxtapositioning of these two dissimilar tectonic regimes in peninsular India, is examined within the framework of the available data on them and the current models of Proterozoic tectonics. Its implications on uranium mineralization and possible regions for targeting exploration activities are discussed on this basis. (author). 112 refs., 4 figs
Petrology and geochemistry of REE-rich Mafé banded iron formations (Bafia group, Cameroon)
Nkoumbou, Charles; Gentry, Fuh Calistus; Tchakounte Numbem, Jacqueline; Belle Ekwe Lobé, Yolande Vanessa; Nwagoum Keyamfé, Christin Steve
2017-07-01
Archaean-Paleoproterozoic foliated amphibole-gneisses and migmatites interstratified with amphibolites, pyroxeno-amphibolites and REE-rich banded-iron formations outcrop at Mafé, Ndikinimeki area. The foliation is nearly vertical due to tight folds. Flat-lying quartz-rich mica schists and quartzites, likely of Pan-African age, partly cover the formations. Among the Mafé BIFs, the oxide BIF facies shows white layers of quartz and black layers of magnetite and accessory hematite, whereas the silicate BIF facies is made up of thin discontinuous quartz layers alternating with larger garnet (almandine-spessartine) + chamosite + ilmenite ± Fe-talc layers. REE-rich oxide BIFs compositions are close to the East Pacific Rise (EPR) hydrothermal deposit; silicate BIFs plot midway between EPR and the associated amphibolite, accounting for a contamination by volcanic materials, in addition to the hydrothermal influence during their oceanic deposition. The association of an oceanic setting with alkaline and tholeiitic magmatism is typical of the Algoma-type BIF deposit. The REE-rich BIFs indices recorded at Mafé are interpreted as resulting from an Archaean-Paleoproterozoic mineralization.
Isotope composition and volume of Earth's early oceans.
Pope, Emily C; Bird, Dennis K; Rosing, Minik T
2012-03-20
Oxygen and hydrogen isotope compositions of Earth's seawater are controlled by volatile fluxes among mantle, lithospheric (oceanic and continental crust), and atmospheric reservoirs. Throughout geologic time the oxygen mass budget was likely conserved within these Earth system reservoirs, but hydrogen's was not, as it can escape to space. Isotopic properties of serpentine from the approximately 3.8 Ga Isua Supracrustal Belt in West Greenland are used to characterize hydrogen and oxygen isotope compositions of ancient seawater. Archaean oceans were depleted in deuterium [expressed as δD relative to Vienna standard mean ocean water (VSMOW)] by at most 25 ± 5‰, but oxygen isotope ratios were comparable to modern oceans. Mass balance of the global hydrogen budget constrains the contribution of continental growth and planetary hydrogen loss to the secular evolution of hydrogen isotope ratios in Earth's oceans. Our calculations predict that the oceans of early Earth were up to 26% more voluminous, and atmospheric CH(4) and CO(2) concentrations determined from limits on hydrogen escape to space are consistent with clement conditions on Archaean Earth.
International Nuclear Information System (INIS)
Dunkley, D.J.; Clarke, G.L.; White, R.W.
2002-01-01
Granulite to transitional granulite facies gneisses exposed at Cape Bruce, Rayner Complex, East Antarctica, record three main orogenic/magmatic phases: (1) intrusion of c. 1000-980 Ma felsic orthogneisses into Mid-Proterozoic metasediments, contemporary with the development of north-trending reclined to recumbent folds; (2) extensive c. 980-900 Ma felsic magmatism, including equivalents of the Mawson Charnockite, which accompanied the development of upright, east-northeast-trending folds; and (3) ultramylonite zones of uncertain age. The first two phases are known as the Rayner Structrual Episode, the effects of which are similar in rocks to the east of Cape Bruce, at Mawson, and in the northern Prince Charles Mountains. Archaean rocks immediately to the west of Cape Bruce were tectonically reworked during the Rayner Structural Episode. The first orogenic phase is inferred to represent the collision between a wedge-shaped Proterozoic block comprising rocks of the Mawson Coast and Eastern Ghats Province, with the Archaean Napier Complex. The second orogenic phase included a major period of crustal growth through emplacement of the Mawson Charnockite and equivalents. (author). 41 refs., 6 figs., 1 tab
Graphite-(Mo,W)S2 intergrowth as a palaeoenvironmental proxy in metasedimentary rocks
Cabral, Alexandre Raphael; Zeh, Armin; da Silva Viana, Nívea Cristina; Schirmer, Thomas; Lehmann, Bernd
2017-12-01
Molybdenum enrichment in pristine organic-C-rich sedimentary rocks forms the basis for inferring the presence of dissolved oxygen in seawater. Organic matter removes dissolved hexavalent Mo from seawater where anoxic and euxinic conditions are attained. However, it is unknown whether this Mo-based proxy is retained under metamorphic conditions where organic C is no longer preserved. Here, we describe aggregates of graphite and molybdenite (MoS2) containing up to 21 mass per cent of W as tungstenite (WS2) in solid solution. These aggregates are disseminated in a sulfide-rich Mn-silicate-carbonate rock (queluzite), metamorphosed under amphibolite-facies conditions within the Archaean Barbacena greenstone belt in Minas Gerais, Brazil. Our finding indicates that: (i) W is, like Mo, a palaeoenvironmental proxy; (ii) the W proxy is sensitive to high fS2/fO2 environments; (iii) both Mo and W proxies survive amphibolite-facies overprint as (Mo,W)S2 intergrown with graphite. Archaean greenstones are potential candidates for storing palaeoenvironmental information as (Mo,W)S2-graphite intergrowths.
Isotope composition and volume of Earth´s early oceans
DEFF Research Database (Denmark)
Pope, Emily Catherine; Bird, Dennis K.; Rosing, Minik Thorleif
2012-01-01
Oxygen and hydrogen isotope compositions of Earth´s seawater are controlled by volatile fluxes among mantle, lithospheric (oceanic and continental crust), and atmospheric reservoirs. Throughout geologic time the oxygen mass budget was likely conserved within these Earth system reservoirs, but hyd...... in Earth´s oceans. Our calculations predict that the oceans of early Earth were up to 26% more voluminous, and atmospheric CH4 and CO2 concentrations determined from limits on hydrogen escape to space are consistent with clement conditions on Archaean Earth.......Oxygen and hydrogen isotope compositions of Earth´s seawater are controlled by volatile fluxes among mantle, lithospheric (oceanic and continental crust), and atmospheric reservoirs. Throughout geologic time the oxygen mass budget was likely conserved within these Earth system reservoirs......, but hydrogen´s was not, as it can escape to space. Isotopic properties of serpentine from the approximately 3.8 Ga Isua Supracrustal Belt in West Greenland are used to characterize hydrogen and oxygen isotope compositions of ancient seawater. Archaean oceans were depleted in deuterium [expressed as Î...
Geochemistry of some banded iron-formations of the archean ...
Indian Academy of Sciences (India)
Diagenetic fluids from the sea floor sediments and river water might have played .... (in wt%) of the banded iron-formations of Archaean supracrustal belts (Iron Ore Group) of Jharkhand–Orissa region. Gandhamardan. Deo river section. H/1/1 H/1/2 H/1/3 H/1/4 H/1/5 .... indicate that contamination by pyroclastic debris.
DEFF Research Database (Denmark)
Baserba, Manel Garrido; Angelidaki, Irini; Karakashev, Dimitar Borisov
2012-01-01
bacterial consortium related to functional specialization of the species towards oleate degradation. For the archaeal domain, the sequences were affiliated within Euryarchaeota phylum with three major groups (Methanosarcina, Methanosaeta and Methanobacterium genera). Results obtained in this study deliver...... a comprehensive picture on oleate degrading microbial communities in high organic strength wastewater. The findings might be utilized for development of strategies for biogas production from lipid-riched wastes....
International Nuclear Information System (INIS)
Schmidt, Thomas; Ziganshin, Ayrat M.; Nikolausz, Marcell; Scholwin, Frank; Nelles, Michael; Kleinsteuber, Sabine; Pröter, Jürgen
2014-01-01
The hydraulic retention time (HRT) is one of the key parameters in biogas processes and often it is postulated that a minimum HRT of 10–25 days is obligatory in continuous stirred tank reactors (CSTR) to prevent a washout of slow growing methanogens. In this study the effects of the reduction of the HRT from 6 to 1.5 days on performance and methanogenic community composition in different systems with and without immobilization operated with simulated thin stillage (STS) at mesophilic conditions and constant organic loading rates (OLR) of 10 g L −1 d −1 of volatile solids were investigated. With the reduction of the HRT process instability was first observed in the anaerobic sequencing batch reactor (ASBR) (at HRT of 3 days) followed by the CSTR (at HRT of 2 days). The fixed bed reactor (FBR) was stable until the end of the experiment, but the reduction of the HRT to 1.5 days caused a decrease of the specific biogas production to about 450 L kg −1 of VS compared to about 600 L kg −1 of VS at HRTs of 4–5 days. Methanoculleus and Methanosarcina were the dominant genera under stable process conditions in the CSTR and the ASBR and members of Methanosaeta and Methanospirillum were only present at HRT of 4 days and lower. In the effluent of the FBR Methanosarcina spp. were not detected and Methanosaeta spp. were more abundant then in the other reactors. - Highlights: • A CSTR was operated at high OLR of 10 (g L −1 d −1 VS) and low HRT of 3 days. • Exceeding washout of methanogenic archaea did not take place. • pH and nutrient concentrations influenced the reproduction rate more than HRT. • Methanoculleus and Methanosarcina were the dominant genera in the CSTR
Geochemistry of Archaean supracrustal belts in SW Greenland
DEFF Research Database (Denmark)
Szilas, Kristoffer
This PhD-thesis investigates the geological formation environment of c. 3200-3000 million-year-old volcanic rocks from SW Greenland, using whole-rock geochemical data in combination with U-Pb, Sm-Nd and Lu-Hf isotope data. The following three supracrustal areas were studied: (1) The Tartoq Group ...
Late Archaean mantle metasomatism below eastern Indian craton ...
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
crop NDD display mainly four distinct orientations viz., N-S, NNE-SSW, ...... also be trapped either along the grain boundary ... faster plate movements, high angle subduction would be ..... istry of oxide minerals in polymictic xenoliths from the.
Liégeois, Jean Paul; Latouche, Louis; Boughrara, Mustapha; Navez, Jacques; Guiraud, Michel
2003-10-01
Historically, the Tuareg shield is divided into three parts bordered by mega-shear zones with the centre, the Central Polycyclic Hoggar, characterized by Archaean and Palaeoproterozoic lithologies. Nearly 10 years ago, the Tuareg shield was shown to be composed of 23 displaced terranes [Geology 22 (1994) 641] whose relationships were deciphered in Aı̈r to the SE [Precambr. Res. 67 (1994) 59]. The Polycyclic Central Hoggar terranes were characterized by the presence of well preserved Archaean/Palaeoproterozoic and Neoproterozoic lithologies. We show here that the terranes from Central Hoggar (Laouni, Azrou-n-Fad, Tefedest, Egéré-Aleksod) belonged to a single old passive margin, to which we gave the acronym name LATEA, which behaved as a craton during the Mesoproterozoic and the Early-Middle Neoproterozoic but was partly destabilized and dissected during the Late Neoproterozoic as a consequence of its involvement as a passive margin in the Pan-African orogen. An early Pan-African phase consisted of thrust sheets including garnet-bearing lithologies (eclogite, amphibolite, gneiss) that can be mapped and correlated in three LATEA terranes. In the Tin Begane area, P- T- t paths have been established from >15 kbar--790 °C (eclogite) to 4 kbar--500 °C (greenschist retrogression) through 12 kbar--830 °C (garnet amphibolite) and 8 kbar--700 °C (garnet gneiss), corresponding to the retrograde path of a Franciscan-type loop. Sm-Nd geochronology on minerals and laser ablation ICP-MS on garnet show the mobility of REE, particularly LREE, during the retrograde greenschist facies that affects, although slightly, some of these rocks. The amphibolite-facies metamorphism has been dated at 685 ± 19 Ma and the greenschist facies at 522 ± 27 Ma. During the thrust phase, the Archaean-Palaeoproterozoic basement was only locally affected by the Pan-African tectonics. LATEA behaved as a craton. Other juvenile terranes were also thrust early onto LATEA: the Iskel island arc at
International Nuclear Information System (INIS)
Rex, D.C.; Gledhill, A.R.; Higgins, A.K.
1977-01-01
Several collections of samples were made from crystalline units in inner Forsblads Fjord in 1974. Results of whole rock Rb-Sr analyses on two of these collections are presented, and give an Archaean age for banded gneisses and a middle Proterozoic age for quartzitic metasediments. These ages confirm the occurence of major Precambrian complexes within the East Greenland Caledonian fold belt. (author)
Directory of Open Access Journals (Sweden)
Dang Ho
Full Text Available A combination of acetate oxidation and acetoclastic methanogenesis has been previously identified to enable high-rate methanogenesis at high temperatures (55 to 65°C, but this capability had not been linked to any key organisms. This study combined RNA-stable isotope probing on 13C-labelled acetate and 16S amplicon sequencing to identify the active micro-organisms involved in high-rate methanogenesis. Active biomass was harvested from three bench-scale thermophilic bioreactors treating waste activated sludge at 55, 60 and 65°C, and fed with 13-C labelled and 12C-unlabelled acetate. Acetate uptake and cumulative methane production were determined and kinetic parameters were estimated using model-based analysis. Pyrosequencing performed on 13C- enriched samples indicated that organisms accumulating labelled carbon were Coprothermobacter (all temperatures between 55 and 65°C, acetoclastic Methanosarcina (55 to 60°C and hydrogenotrophic Methanothermobacter (60 to 65°C. The increased relative abundance of Coprothermobacter with increased temperature corresponding with a shift to syntrophic acetate oxidation identified this as a potentially key oxidiser. Methanosarcina likely acts as both a hydrogen utilising and acetoclastic methanogen at 55°C, and is replaced by Methanothermobacter as a hydrogen utiliser at higher temperatures.
Ho, Dang; Jensen, Paul; Gutierrez-Zamora, Maria-Luisa; Beckmann, Sabrina; Manefield, Mike; Batstone, Damien
2016-01-01
A combination of acetate oxidation and acetoclastic methanogenesis has been previously identified to enable high-rate methanogenesis at high temperatures (55 to 65°C), but this capability had not been linked to any key organisms. This study combined RNA-stable isotope probing on 13C-labelled acetate and 16S amplicon sequencing to identify the active micro-organisms involved in high-rate methanogenesis. Active biomass was harvested from three bench-scale thermophilic bioreactors treating waste activated sludge at 55, 60 and 65°C, and fed with 13-C labelled and 12C-unlabelled acetate. Acetate uptake and cumulative methane production were determined and kinetic parameters were estimated using model-based analysis. Pyrosequencing performed on 13C- enriched samples indicated that organisms accumulating labelled carbon were Coprothermobacter (all temperatures between 55 and 65°C), acetoclastic Methanosarcina (55 to 60°C) and hydrogenotrophic Methanothermobacter (60 to 65°C). The increased relative abundance of Coprothermobacter with increased temperature corresponding with a shift to syntrophic acetate oxidation identified this as a potentially key oxidiser. Methanosarcina likely acts as both a hydrogen utilising and acetoclastic methanogen at 55°C, and is replaced by Methanothermobacter as a hydrogen utiliser at higher temperatures.
International Nuclear Information System (INIS)
Dada, S. S.; Briqueu, L.; Birck, J. L.
1998-01-01
The Kaduna Migmatite-Gneiss Complex in the central area of the Northern shield includes variably migmatised granitotrondhjemitic gneisses and amphibolite of hitherto unknown age. The amphibolite enclaves and dykes are metatholeiites with comparatively unfractionated rare-earth patterns. The two main rock units (TTG and amphibolite) exhibit complementary geochemical signatures in the normalised abundance patterns of relatively incompatible elements and suggest possible derivation of the gneisses from subduction related mafic material. Sm-Nd and Rb-Sr isotopic data document early Archaean crustal formation of new crust and its subsequent late Archaean differentiation. These preliminary results form an evidence for a more extended crustal history in the heart of the Pan-African domain (ca. 600 Ma.). They suggest the differentiation of juvenile crustal protolith from a chondritic reservoir about 3.5 Ga. for the gneiss-amphibolite bimodal suite. A tectonothermal event about 3.1-3.0 Ga led to the emplacement of an early gneiss as indicated from Rb-Sr and U-Ph zircon analyses. Subsequent differentiation and/or reworking around 2.8-2.7 Ga is coherent with the Liberian orogeny within the West African- Latino American subregion
Acaiaca Granulite Complex, MG: age, petrogenesis and tectonics implications
International Nuclear Information System (INIS)
Teixeira, W.; Kawashita, K.; Evangelista, H.J.; Taylor, P.N.
1987-01-01
Rb-SR and Pb-Pb geochronological work has been carried out on rocks from the Acaiaca granulite complex (mainly pyribolites, piriclasites and plagiogranulites) in Minas Gerais state. The results are interpreted together with petrographical and geochemical data, in order to delineate the evolution of those rocks. The Rb-Pb whole rock isochrons are concordant in age (around 2.0 b.y.) and they define the Transamazonian orogeny as the main event in the investigated area. In addition, the Sr and Pb evidences suggest a strong reworking of prior continental crust at that time. In turn, the estimation of P-T conditions of regional metamorphism based on geo thermo barometric calculations and on petrology resulted in T ≅ 700-900 O C and P tot =5,6-8 and 8-10 Kbar. The whole group of data is coherent with the development of is Transamazonian mobile zone of ensialic character, along the eastern border of an Archaean fragment. Within an area considered cratonic during the Upper Proterozoic. A model of evolution of the Sao Francisco Craton as well the differences between the Archaean and early Proterozoic domains are discussed. (M.V.M.)
Anaerobic bacteria that dechlorinate perchloroethene.
Fathepure, B Z; Nengu, J P; Boyd, S A
1987-01-01
In this study, we identified specific cultures of anaerobic bacteria that dechlorinate perchlorethene (PCE). The bacteria that significantly dechlorinated PCE were strain DCB-1, an obligate anaerobe previously shown to dechlorinate chlorobenzoate, and two strains of Methanosarcina. The rate of PCE dechlorination by DCB-1 compared favorably with reported rates of trichloroethene bio-oxidation by methanotrophs. Even higher PCE dechlorination rates were achieved when DCB-1 was grown in a methanogenic consortium. PMID:3426224
Early mantle differentiation: constraint from 146Sm-142Nd systematics
International Nuclear Information System (INIS)
Caro, G.
2005-07-01
We present new ultra-high precision 142 Nd/ 144 Nd measurements of early Archaean rocks using the new generation thermal ionization mass spectrometer TRITON. Repeated measurements of the Ames Nd standard demonstrate that the 142 Nd/ 144 Nd ratio can be determined with external precision of 2 ppm (2s), allowing confident resolution of anomalies as small as 5 ppm. A major analytical improvement lies in the elimination of the double normalization procedure required to correct our former measurements from a secondary mass fractionation effect. Our new results indicate that metasediments, meta-basalts and orthogneisses from the 3.6 - 3.8 Ga West Greenland craton display positive 142 Nd anomalies ranging from 8 to 15 ppm. Using a simple two-stage model with initial e 143 Nd value of 1.9 ± 0.6 e-units, coupled 147 Sm- 143 Nd and 146 Sm- 142 Nd chronometry constrains mantle differentiation to 50 to 200 Ma after formation of the solar system. This chronological constraint is consistent with differentiation of the Earth's mantle during the late stage of crystallization of a magma ocean. We have developed a two-box model describing 142 Nd and 143 Nd isotopic evolution of depleted mantle during the subsequent evolution of the crust-mantle system. Our results indicate that early terrestrial proto-crust had a lifetime of ca. 500 Ma in order to produce the observed Nd isotope signature of Archaean rocks. In the context of this two box mantle-crust system, we model the evolution of isotopic and chemical heterogeneity of depleted mantle as a function of the mantle stirring time. Using the dispersion of 142 Nd/ 144 Nd and 143 Nd/ 144 Nd ratios observed in early Archaean rocks, we constrain the stirring time of early Earth's mantle to 100 - 150 Ma, a factor of 5 to 10 shorter than stirring time inferred from modern oceanic basalts. (author)
Energy Technology Data Exchange (ETDEWEB)
Caro, G
2005-07-15
We present new ultra-high precision {sup 142}Nd/{sup 144}Nd measurements of early Archaean rocks using the new generation thermal ionization mass spectrometer TRITON. Repeated measurements of the Ames Nd standard demonstrate that the {sup 142}Nd/{sup 144}Nd ratio can be determined with external precision of 2 ppm (2s), allowing confident resolution of anomalies as small as 5 ppm. A major analytical improvement lies in the elimination of the double normalization procedure required to correct our former measurements from a secondary mass fractionation effect. Our new results indicate that metasediments, meta-basalts and orthogneisses from the 3.6 - 3.8 Ga West Greenland craton display positive {sup 142}Nd anomalies ranging from 8 to 15 ppm. Using a simple two-stage model with initial e{sup 143}Nd value of 1.9 {+-} 0.6 e-units, coupled {sup 147}Sm-{sup 143}Nd and {sup 146}Sm-{sup 142}Nd chronometry constrains mantle differentiation to 50 to 200 Ma after formation of the solar system. This chronological constraint is consistent with differentiation of the Earth's mantle during the late stage of crystallization of a magma ocean. We have developed a two-box model describing {sup 142}Nd and {sup 143}Nd isotopic evolution of depleted mantle during the subsequent evolution of the crust-mantle system. Our results indicate that early terrestrial proto-crust had a lifetime of ca. 500 Ma in order to produce the observed Nd isotope signature of Archaean rocks. In the context of this two box mantle-crust system, we model the evolution of isotopic and chemical heterogeneity of depleted mantle as a function of the mantle stirring time. Using the dispersion of {sup 142}Nd/{sup 144}Nd and {sup 143}Nd/{sup 144}Nd ratios observed in early Archaean rocks, we constrain the stirring time of early Earth's mantle to 100 - 150 Ma, a factor of 5 to 10 shorter than stirring time inferred from modern oceanic basalts. (author)
Czech Academy of Sciences Publication Activity Database
Koubová, Anna; Goberna, M.; Šimek, Miloslav; Chroňáková, Alica; Pižl, Václav; Insam, H.; Elhottová, Dana
2012-01-01
Roč. 48, - (2012), s. 32-40 ISSN 1164-5563 R&D Projects: GA MŠk MEB060814; GA MŠk LC06066; GA AV ČR IAA600200704; GA ČR GA526/09/1570 Grant - others:GAJU(CZ) GAJU142/2010/P; Evropská unie(XE) MEIF-CT-2006-041034 Institutional research plan: CEZ:AV0Z60660521 Keywords : cattle winter pasture * methane emission * Methanosarcina sp. Subject RIV: EH - Ecology, Behaviour Impact factor: 1.838, year: 2012
Oxygen free period in the history of Earth and life in it
Directory of Open Access Journals (Sweden)
Георгій Ілліч Рудько
2016-06-01
Full Text Available The development of Earth in the context of its formation as also emergence of the original atmosphere and hydrosphere are presented in the article. Main stages of the atmosphere evolution have occurred in the Archaean. The mechanisms of life origin, their impact on environmental development and changes are described as well. A brief description of the most ancient sediments composed by the archaebacteria and cyanobacteria is considered.
Siegert, Michael; Cichocka, Danuta; Herrmann, Steffi; Gründger, Friederike; Feisthauer, Stefan; Richnow, Hans-Hermann; Springael, Dirk; Krüger, Martin
2011-02-01
The impact of four electron acceptors on hydrocarbon-induced methanogenesis was studied. Methanogenesis from residual hydrocarbons may enhance the exploitation of oil reservoirs and may improve bioremediation. The conditions to drive the rate-limiting first hydrocarbon-oxidizing steps for the conversion of hydrocarbons into methanogenic substrates are crucial. Thus, the electron acceptors ferrihydrite, manganese dioxide, nitrate or sulfate were added to sediment microcosms acquired from two brackish water locations. Hexadecane, ethylbenzene or 1-(13)C-naphthalene were used as model hydrocarbons. Methane was released most rapidly from incubations amended with ferrihydrite and hexadecane. Ferrihydrite enhanced only hexadecane-dependent methanogenesis. The rates of methanogenesis were negatively affected by sulfate and nitrate at concentrations of more than 5 and 1 mM, respectively. Metal-reducing Geobacteraceae and potential sulfate reducers as well as Methanosarcina were present in situ and in vitro. Ferrihydrite addition triggered the growth of Methanosarcina-related methanogens. Additionally, methane was removed concomitantly by anaerobic methanotrophy. ANME-1 and -2 methyl coenzyme M reductase genes were detected, indicating anaerobic methanotrophy as an accompanying process [Correction added 16 December after online publication: 'methyl coenzyme A' changed to 'methyl coenzyme M' in this sentence]. The experiments presented here demonstrate the feasibility of enhancing methanogenic alkane degradation by ferrihydrite or sulfate addition in different geological settings. © 2010 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.
Emergence of silicic continents as the lower crust peels off on a hot plate-tectonic Earth
Chowdhury, Priyadarshi; Gerya, Taras; Chakraborty, Sumit
2017-09-01
The rock record and geochemical evidence indicate that continental recycling has been occurring since the early history of the Earth. The stabilization of felsic continents in place of Earth's early mafic crust about 3.0 to 2.0 billion years ago, perhaps due to the initiation of plate tectonics, implies widespread destruction of mafic crust during this time interval. However, the physical mechanisms of such intense recycling on a hotter, (late) Archaean and presumably plate-tectonic Earth remain largely unknown. Here we use thermomechanical modelling to show that extensive recycling via lower crustal peeling-off (delamination but not eclogitic dripping) during continent-continent convergence was near ubiquitous during the late Archaean to early Proterozoic. We propose that such destruction of the early mafic crust, together with felsic magmatism, may have caused both the emergence of silicic continents and their subsequent isostatic rise, possibly above the sea level. Such changes in the continental character have been proposed to influence the Great Oxidation Event and, therefore, peeling-off plate tectonics could be the geodynamic trigger for this event. A transition to the slab break-off controlled syn-orogenic recycling occurred as the Earth aged and cooled, leading to reduced recycling and enhanced preservation of the continental crust of present-day composition.
Dymek, R. F.; Boak, J. L.; Gromet, L. P.
1983-01-01
Rare earth element (REE) data is given on a set of clastic metasediments from the 3800 Ma Isua Supracrustal belt, West Greenland. Each of two units from the same sedimentary sequence has a distinctive REE pattern, but the average of these rocks bears a very strong resemblance to the REE pattern for the North American Shale Composite (NASC), and departs considerably from previous estimates of REE patterns in Archaean sediments. The possibility that the source area for the Isua sediments resembled that of the NASC is regarded as highly unlikely. However, REE patterns like that in the NASC may be produced by sedimentary recycling of material yielding patterns such as are found at Isua. The results lead to the following tentative conclusions: (1) The REE patterns for Isua Seq. B MBG indicate the existence of crustal materials with fractionated REE and negative Eu anomalies at 3800 Ma, (2) The average Seq. B REE pattern resembles that of the North American Shale Composite (NASC), (3) If the Seq. B average is truly representative of its crustal sources, then this early crust could have been extensively differentiated. In this regard, a proper understanding of the NASC pattern, and its relationship to post-Archaean crustal REE reservoirs, is essential, (4) The Isua results may represent a local effect.
Earth's oldest stable crust in the Pilbara Craton formed by cyclic gravitational overturns
Wiemer, Daniel; Schrank, Christoph E.; Murphy, David T.; Wenham, Lana; Allen, Charlotte M.
2018-05-01
During the early Archaean, the Earth was too hot to sustain rigid lithospheric plates subject to Wilson Cycle-style plate tectonics. Yet by that time, up to 50% of the present-day continental crust was generated. Preserved continental fragments from the early Archaean have distinct granite-dome/greenstone-keel crust that is interpreted to be the result of a gravitationally unstable stratification of felsic proto-crust overlain by denser mafic volcanic rocks, subject to reorganization by Rayleigh-Taylor flow. Here we provide age constraints on the duration of gravitational overturn in the East Pilbara Terrane. Our U-Pb ages indicate the emplacement of 3,600-3,460-million-year-old granitoid rocks, and their uplift during an overturn event ceasing about 3,413 million years ago. Exhumation and erosion of this felsic proto-crust accompanied crustal reorganization. Petrology and thermodynamic modelling suggest that the early felsic magmas were derived from the base of thick ( 43 km) basaltic proto-crust. Combining our data with regional geochronological studies unveils characteristic growth cycles on the order of 100 million years. We propose that maturation of the early crust over three of these cycles was required before a stable, differentiated continent emerged with sufficient rigidity for plate-like behaviour.
International Nuclear Information System (INIS)
Sieber, T.; Van Reenen, D.D.; Barton, J.M.
1991-01-01
Ductile shear zones associated with the 2700 to 2650 Ma Limpopo Orogeny locally contained gold mineralization. Some of these shear zones were reactivated under brittle conditions and contain zones of hydrothermal alteration that are of potential economic significance. Within the approximately 2670 Ma Matok Complex, two examples of this shear zone controlled alteration are exposed, the Dwars River and Sand River alteration zones. The granitic rocks of this Complex experienced early selective sericitization of plagioclase and the subsequent development of perthitic porphyroblasts. This early regional alteration was overprinted along brittle shear zones by pervasive propylitization and vein controlled quartz-albite alteration. The setting, composition, and the age of the Matok Complex make it a possible source for Archaean gold mineralization. The Dwars River and Sand River alteration zones are characterized by the absence of significant gold mineralization. The pattern of wall-rock alteration indicates that the hydrothermal processes were different from typical Archaean lode gold deposits. P-T conditions during the shear-zone controlled alteration were less than 400 degrees C and 1,9 - 2,8 kb. The shear zone hosted alteration could have taken place anytime between emplacement of the Matok Complex and about 1315 Ma ago. 35 refs., 10 figs., 4 tabs
Dating method by fission tracks: some Brazilian examples
International Nuclear Information System (INIS)
Fonseca, Ariadne do Carmo
1996-01-01
The Fission Track method (TF) complements the dating of a interval of tectonic events occurred in low temperatures not detected by another radiometric methods. In the South part of Craton of Sao Francisco the dating of apatites of archaean rocks produced ages TF between 900 and 500 Ma, reflecting the progressive acting of the Brazilian margin mobile belts in the archaean craton areas. Apatite of some igneous and metamorphic rocks of the Braziliana age, in the Faixa Ribeira segment, between the Rio de Janeiro and Salvador cities, produced TF ages between 140 and 80 Ma. The basaltic and alkaline volcanism related to the Atlantic Ocean opening dated from this interval. The TF dating in apatites of the continental margin rocks allowed to date the event. In the Cabo Frio region (Southeastern part of Rio de Janeiro State), titanite and apatite of the Transamazonic orthognaisses produced TF dates between 190 and 80 to 40 Ma. The age around 190 Ma date previously the rift formation precursor of the South Atlantic Ocean opening, while the ages between 80 and 40 Ma were related to the alkaline rocks intrusion. The examples mentioned demonstrate the event diversity which may be dated by the Fission Tracks method, mainly in the craton area and margin belts study
Geochemical aspects of mineralization in the Sabie-Pilgrim's Rest goldfield, eastern Transvaal
International Nuclear Information System (INIS)
Boer, R.H.; Meyer, F.M.; Robb, L.J.
1990-01-01
The Sabie-Pilgim's Rest goldfield in the eastern Transvaal constitutes the third biggest gold source in South Africa. Mineralization is vein controlled and extends from the Archaean granite basement, through the pre-Transvaal Godwan and Wolkeberg sequences into the Transvaal Supergroup comprising the Chuniespoort and Pretoria Groups. Gold occurs predominantly in three styles, as stratiform quartz-gold lodes, as transgressive veins, and as structurally controlled quartz blows. The flat reefs which host the majority of gold and sulphide ores are dominated by quartz although calcite becomes an important constituent towards the edges of the deposits. δ 18 O values obtained on quartz associated with a variety of different styles of gold mineralization are typically enriched in δ 18 O relative to SMOW. A progressive increase in δ 18 O is apparent from the underlying Archaean granite basement through the vertical reefs to the horizontal reefs. The trend towards heavier δ 18 O is accompanied by an increase in fluid salinity. The trend towards heavier δ 18 O and the increased salinity upwards in the stratigraphy is explained by the mixing of low salinity magmatic water from the granitic basement, with formation waters of the Transvaal basin. 3 refs., 2 figs
Chemical methods for Sm-Nd separation and its application in isotopic geological dating
International Nuclear Information System (INIS)
Guo Qifeng.
1990-01-01
Three chemical methods for Sm-Nd separation are mainly desribed: low chromatography of butamone-ammonium thiocyanate for hight concentration Sm and Nd separation, P 240 column chromatography for medium concentration Sm-Nd separation, and pressure ion exchange for low concentration Sm-Nd. The first Sm-Nd synchrone obtained in China with Sm-Nd methods is introduced and Sm-Nd isotopic geological dating in Early Archaean rocks in eastern Hebei has been determined
DEFF Research Database (Denmark)
Schmidt, Jens Ejbye; Ahring, Birgitte Kiær
1999-01-01
Sterile granular sludge was inoculated with either Methanosarcina mazeii S-6, Methanosaeta concilii GP-6, or both species in acetate-fea upflow anaerobic sludge blanket (UASB) reactors to investigate the immobilization patterns and dynamics of aceticlastic methanogens in granular sludge. After......, but where the acetate concentration was low this strain was immobilized on support material as single cells or small clumps, The data clearly show that the two aceticlastic methanogens immobilize differently in UASB systems, depending on the conditions found throughout the UASB reactor....
DEFF Research Database (Denmark)
Schmidt, Jens Ejbye; Ahring, Birgitte Kiær
1999-01-01
Sterile granular sludge was inoculated with either Methanosarcina mazeii S-6, Methanosaeta concilii GP-6, or both species in acetate-fea upflow anaerobic sludge blanket (UASB) reactors to investigate the immobilization patterns and dynamics of aceticlastic methanogens in granular sludge. After......, but where the acetate concentration was low this strain was immobilized on support material as single cells or small clumps, The data clearly show that the two aceticlastic methanogens immobilize differently in UASB systems, depending on the conditions found throughout the UASB reactor....
Barnes, S. J.
2004-11-01
The Black Swan district, 70 km north east of Kalgoorlie in the Archaean Yilgarn Craton of Western Australia, hosts massive and disseminated nickel sulfide orebodies associated with komatiites. The host rocks and ores preserve some remarkable primary igneous features, which provide important clues as to the origin of komatiite-hosted nickel ores. The series of papers that follow report an extremely detailed study of the petrology, volcanology and geochemistry of these unusually well-preserved orebodies and their host rocks.
Directory of Open Access Journals (Sweden)
Rosana Filomena Vazoller
2001-06-01
Full Text Available Solid wastes anaerobic biodegradability, methane production potential and microbiological composition of two experimental sanitary landfills in Brazil, running for one year, were evaluated. The two landfills showed a similar organic matter stabilization during the methane production phase, despite the high heterogeneity of the solid wastes. Both landfills presented the same level of methane (around 91.5 L CH4 / kg Volatile Total Solids and organic acids, mainly acetic and butyric acids, in the leachate. Bacterial isolates belonged to genera Megasphaera, Selenomonas, Methanobacterium, Methanobrevibacter and Methanosarcina.Durante um ano foi realizado o monitoramento da biodegradabilidade anaeróbia de resíduos sólidos, do potencial de geração de metano e da composição microbiológica de dois aterros sanitários experimentais. Observou-se que, apesar da grande heterogeneidade dos resíduos sólidos, os resultados em termos de estabilização de matéria orgânica durante a fase de produção de metano foram similares para os dois aterros. Ambos os sistemas apresentaram as mesmas faixas de produção de metano (91.5 L CH4 / kg STV - sólidos totais voláteis e de ácidos orgânicos, principalmente ácidos acético e butírico. Isolou-se ainda, culturas bacterianas dos gêneros Megasphaera, Selenomonas, Methanobacterium, Methanobrevibacter and Methanosarcina.
Energy Technology Data Exchange (ETDEWEB)
Sato, K.; Siga Junior, Oswaldo; McReath, Ian; Sproesser, Walter; Basei, Miguel Angelo Stipp [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Geociencias. Centro de Pesquisas Geocronologicas], e-mail: keisato@usp.br, e-mail: osigajr@usp.br, e-mail: ianmcr@usp.br, e-mail: wmspres@usp.br, e-mail: baseimas@usp.br; Silva, Josiane Aline da [Universidade de Sao Paulo (USP), SP (Brazil). Programa de Pos-graduacao em Geoquimica e Geotectonica; Dunyi, Liu [Institute of Geology, Beijing (China); Iizuka, Takafumi; Rino, Shuji; Hirata, Takafumi [Tokyo Institute of Technology, Tokyo (Japan)
2009-10-15
Remotely-operated SHRIMP dating of zircon is an interesting alternative for dating of zircon crystals. Although it does not represent any technical progress of the geochronological method using the U-Pb system in zircon it is a very useful and cheap facility. The procedure was first used for mass spectrometric analyses involving two international laboratories in Sao Paulo, Brazil and Beijing, China. It was applied to samples of three gneiss-migmatitic rocks from the Ita quarry in the Atuba Complex (located between the Luis Alves and the Apiai Domain) to test previous controversial hypotheses about its evolution. The presence of important archaean and paleo proterozoic components in the complex is confirmed by analyses of zircon found in probably neo proterozoic leucosomes. Diorite intrusion also occurred during the neo proterozoic, associated with the 0.6Ga continental collisions involved in the assembly of Gondwana. The determination of Hf isotope ratios by LA-ICP/MS represents a new option for checking the relative importance of mantle ({epsilon}{sub Hf} > 0) and crustal contributions (({epsilon}{sub Hf} < 0) during the growth of the zircon crystals. While the archaean component in the complex was derived from the mantle ({epsilon}{sub Hf} + 1.5 to + 8.7) the paleo proterozoic component had a crustal contribution ({epsilon}{sub Hf} - 9.1 to -10.1). (author)
Bindeman, I N; Zakharov, D O; Palandri, J; Greber, N D; Dauphas, N; Retallack, G J; Hofmann, A; Lackey, J S; Bekker, A
2018-05-01
The history of the growth of continental crust is uncertain, and several different models that involve a gradual, decelerating, or stepwise process have been proposed 1-4 . Even more uncertain is the timing and the secular trend of the emergence of most landmasses above the sea (subaerial landmasses), with estimates ranging from about one billion to three billion years ago 5-7 . The area of emerged crust influences global climate feedbacks and the supply of nutrients to the oceans 8 , and therefore connects Earth's crustal evolution to surface environmental conditions 9-11 . Here we use the triple-oxygen-isotope composition of shales from all continents, spanning 3.7 billion years, to provide constraints on the emergence of continents over time. Our measurements show a stepwise total decrease of 0.08 per mille in the average triple-oxygen-isotope value of shales across the Archaean-Proterozoic boundary. We suggest that our data are best explained by a shift in the nature of water-rock interactions, from near-coastal in the Archaean era to predominantly continental in the Proterozoic, accompanied by a decrease in average surface temperatures. We propose that this shift may have coincided with the onset of a modern hydrological cycle owing to the rapid emergence of continental crust with near-modern average elevation and aerial extent roughly 2.5 billion years ago.
A proterozoic tectonic model for northern Australia and its economic implications
International Nuclear Information System (INIS)
Rossiter, A.G.; Ferguson, J.
1980-01-01
It is argued that at the end of Archaean time the Australian continent was confined to the area now occupied by the Yilgarn, Pilbara, Gawler, and Musgrave Blocks, and the southern part of the Arunta Block. During the Early Proterozoic, sedimentary and volcanic rocks were laid down in an extensive depositional zone trending roughly east-west along the northern margin of the Archaean continent. Copper and gold mineralization, commonly showing stratigraphic control, is widespread in this belt. Following deformation and metamorphism of the Early Proterozoic rocks, felsic and mafic igneous activity, and accumulation of platform sediments on the newly stabilized crust, a predominantly north-south depositional zone developed along the eastern margin of the continent during the Middle Proterozoic. Lead and zinc assume much more importance in the mineral deposits of this belt. It is postulated that the present positions of rocks of the Pine Creek and Georgetown regions are due to horizontal displacements of several hundred kilometres along major fault zones. Apparent rifting of these blocks away from palaeo-continental margins may be related to the occurrence of uraniferous granitic rocks and uranium mineralization within them via a mantle plume mechanism. Although current data are limited, tectonic environments suggested for Proterozoic mafic igneous rocks of northern Australia by their geochemistry are compatible with the geological settings of these rocks and with the tectonic model put forward. (author)
Spreading continents kick-started plate tectonics.
Rey, Patrice F; Coltice, Nicolas; Flament, Nicolas
2014-09-18
Stresses acting on cold, thick and negatively buoyant oceanic lithosphere are thought to be crucial to the initiation of subduction and the operation of plate tectonics, which characterizes the present-day geodynamics of the Earth. Because the Earth's interior was hotter in the Archaean eon, the oceanic crust may have been thicker, thereby making the oceanic lithosphere more buoyant than at present, and whether subduction and plate tectonics occurred during this time is ambiguous, both in the geological record and in geodynamic models. Here we show that because the oceanic crust was thick and buoyant, early continents may have produced intra-lithospheric gravitational stresses large enough to drive their gravitational spreading, to initiate subduction at their margins and to trigger episodes of subduction. Our model predicts the co-occurrence of deep to progressively shallower mafic volcanics and arc magmatism within continents in a self-consistent geodynamic framework, explaining the enigmatic multimodal volcanism and tectonic record of Archaean cratons. Moreover, our model predicts a petrological stratification and tectonic structure of the sub-continental lithospheric mantle, two predictions that are consistent with xenolith and seismic studies, respectively, and consistent with the existence of a mid-lithospheric seismic discontinuity. The slow gravitational collapse of early continents could have kick-started transient episodes of plate tectonics until, as the Earth's interior cooled and oceanic lithosphere became heavier, plate tectonics became self-sustaining.
De Waele, B.; Thomas, Ronald J.; Macey, P.H.; Horstwood, M.S.A.; Tucker, R.D.; Pitfield, P.E.J.; Schofield, D.I.; Goodenough, K.M.; Bauer, W.; Key, R.M.; Potter, C.J.; Armstrong, R.A.; Miller, J.A.; Randriamananjara, T.; Ralison, V.; Rafahatelo, J.-M.; Rabarimanana, M.; Bejoma, M.
2011-01-01
New detrital zircon U–Pb age data obtained from various quartzite units of three spatially separated supracrustal packages in central and northern Madagascar, show that these units were deposited between 1.8 and 0.8 Ga and have similar aged provenances. The distribution of detrital zircon ages indicates an overwhelming contribution of sources with ages between 2.5 and 1.8 Ga. Possible source rocks with an age of 2.5 Ga are present in abundance in the crustal segments (Antananarivo, Antongil and Masora Domains) either side of a purported Neoproterozoic suture ("Betsimisaraka Suture Zone"). Recently, possible source rocks for the 1.8 Ga age peak have been recognised in southern Madagascar. All three supracrustal successions, as well as the Archaean blocks onto which they were emplaced, are intruded by mid-Neoproterozoic magmatic suites placing a minimum age on their deposition. The similarities in detrital pattern, maximum and minimum age of deposition in the three successions, lend some support to a model in which all of Madagascar's Archaean blocks form a coherent crustal entity (the Greater Dharwar Craton), rather than an amalgamate of disparate crustal blocks brought together only during Neoproterozoic convergence. However, potential source terranes exist outside Madagascar and on either side of the Neoproterozoic sutures, so that a model including a Neoproterozoic suture in Madagascar cannot be dispelled outright.
Pb–Pb zircon ages of Archaean metasediments and gneisses from ...
Indian Academy of Sciences (India)
eastern parts of the Dharwar craton took place over similar time interval starting in the Mesoarchaean at ca. .... the age of the Bababudan Group between 2.91 and. 2.72 Ga. ..... All the samples were processed using a standard technique to ...
Gas-charged sediments on the inner continental shelf off western India
Digital Repository Service at National Institute of Oceanography (India)
Karisiddaiah, S.M.; Veerayya, M.; Vora, K.H.; Wagle, B.G.
the enormous reserves of methane hydrates in the Arctic (Nisbet, 1989) and elsewhere. Owens et al. (1991) observed that the northern Arabian Sea is an oceanic region of unusually high methane concentrations and fluxes to the atmo- sphere. In view... The western continental shelf of India between IO°N and 22°N is bordered by the Deccan Traps (volcanic rocks) of Cretaceous age towards the north of Goa, whereas Peninsular gneisses, char- nockites and various schistose formations of Archaean age...
Heesakkers, V.; Murphy, S.; Reches, Z.
2011-12-01
We analyze the structure of the Archaean Pretorius fault in TauTona mine, South Africa, as well as the rupture-zone that recently reactivated it. The analysis is part of the Natural Earthquake Laboratory in South African Mines (NELSAM) project that utilizes the access to 3.6 km depth provided by the mining operations. The Pretorius fault is a ~10 km long, oblique-strike-slip fault with displacement of up to 200 m that crosscuts fine to very coarse grain quartzitic rocks in TauTona mine. We identify here three structural zones within the fault-zone: (1) an outer damage zone, ~100 m wide, of brittle deformation manifested by multiple, widely spaced fractures and faults with slip up to 3 m; (2) an inner damage zone, 25-30 m wide, with high density of anastomosing conjugate sets of fault segments and fractures, many of which carry cataclasite zones; and (3) a dominant segment, with a cataclasite zone up to 50 cm thick that accommodated most of the Archaean slip of the Pretorius fault, and is regarded as the `principal slip zone' (PSZ). This fault-zone structure indicates that during its Archaean activity, the Pretorius fault entered the mature fault stage in which many slip events were localized along a single, PSZ. The mining operations continuously induce earthquakes, including the 2004, M2.2 event that rejuvenated the Pretorius fault in the NELSAM project area. Our analysis of the M2.2 rupture-zone shows that (1) slip occurred exclusively along four, pre-existing large, quasi-planer segments of the ancient fault-zone; (2) the slipping segments contain brittle cataclasite zones up to 0.5 m thick; (3) these segments are not parallel to each other; (4) gouge zones, 1-5 mm thick, composed of white `rock-flour' formed almost exclusively along the cataclasite-host rock contacts of the slipping segments; (5) locally, new, fresh fractures branched from the slipping segments and propagated in mixed shear-tensile mode; (6) the maximum observed shear displacement is 25 mm in
International Nuclear Information System (INIS)
Sinha-Roy, S.
2004-01-01
Evolution of the Precambrian terrain in Rajasthan has taken place via crustal consolidation of the basement at ca. 2.9 Ga, its cratonisation at ca. 2.5 Ga, through protracted tectonostratigraphic evolution of the Proterozoic cover sequences, following repeated rifting and Wilson cycles in the Aravalli and Delhi foldbelts. Consequently, the Proterozoic rift basins are characterised by growth faults and pull-aparts, and multitier volcanose dimentary sequences that contain a number of unconformities and stratigraphic breaks. The Archaean basement of the Mewar terrain that witnessed end-Archaean K-magmatism and ductile shearing, led to the creation of a possible uranium province, namely uranium enriched basement. This province acted as the source of remobilised uranium and its concentration at suitable multilevel structural and stratigraphic traps within the Proterozoic rift basins to give rise to unconformity-related syngenetic uranium mineralisation. Late Neoproterozoic to Pan-African tectonothermal reworking of the basement rocks produced fracture zones and caused Na-metasomatism giving rise to albitite-related uranium mineralisation. Based on an analysis of Proterozoic rift kinematics and lithofacies characteristics, five possible uranium-enriched stratigraphic horizons have been identified in the Aravalli and its equivalent sequences as well as in the North Delhi foldbelt sequences. From a regional synthesis, ten possible uranium metallogenic events, spanning ca. 2.5-0.5 Ga, are recognised in Rajasthan. These uranium events have predictive value for delineation of target areas for exploration. (author)
Geology and exploration of the Rum Jungle Uranium Field
International Nuclear Information System (INIS)
Fraser, W.J.
1980-01-01
The Rum Jungle Uranium Field was discovered by a private prospector in 1949. A total of 3530 tonnes of uranium oxide was mined and treated from four ore-bodies by Territory Enterprises Pty. Limited who managed the Rum Jungle Project on behalf of the Australian Atomic Energy Commission until the closure of operations in 1971. One small low grade uranium orebody remains to be developed. Lead, zinc, copper, cobalt and nickel were found zoned sub vertically with uranium at one deposit. One medium sized lead, zinc, copper, cobalt and nickel deposit remains to be developed and one small copper deposit with minor uranium was mined. The basemetal deposits show a regional zoning relationship with the known uranium mineralization. Uranium and basemetal mineralization is hosted by graphitic or chloritic, pyritic shales at the contact with a magnesite. These rocks are in the lower part of a sequence of Lower Proterozoic sediments which unconformably overlie Archaean basement complexes. The sediments and complexes are displaced by Giants Reef Fault and sub-parallel shears and linears may further control mineralization. Nearly 50km of the prospective shale/magnesite contact was tested by total count radiometric surveys, various electrical methods, auger, rotary percussion and diamond drilling. The source for the uranium mineralization was probably the Archaean basement complexes from which uranium was initially deposited as protore by either chemical precipitation or clay adsorption in the shale units or as detrital placers in quartz pebble conglomerates immediately overlying the basement complexes. (author)
DEFF Research Database (Denmark)
Kongjan, Prawit; O-Thong, Sompong; Angelidaki, Irini
2011-01-01
The two-stage process for extreme thermophilic hydrogen and thermophilic methane production from wheat straw hydrolysate was investigated in up-flow anaerobic sludge bed (UASB) reactors. Specific hydrogen and methane yields of 89ml-H2/g-VS (190ml-H2/g-sugars) and 307ml-CH4/g-VS, respectively were...... energy of 13.4kJ/g-VS. Dominant hydrogen-producing bacteria in the H2-UASB reactor were Thermoanaerobacter wiegelii, Caldanaerobacter subteraneus, and Caloramator fervidus. Meanwhile, the CH4-UASB reactor was dominated with methanogens of Methanosarcina mazei and Methanothermobacter defluvii. The results...
Archaean wrench-fault tectonics in the Abitibi greenstone belt of Canada
Hubert, C.
1986-01-01
A tectonic model is proposed in which the southern Abitibi belt formed in a series of rift basins which dissected an earlier formed volcanic arc. Comparisons can be made with Phanerozoic areas such as, the Hokuroko basin of Japan, the Taupo volcanic zone of new Zealand and the Sumatra and Nicaragua volcanic arcs. In addition the identification of the major E - W thrust shears make it possible to speculate that the southern Abitibi belt comprises a collage of blocks of terrane which have been accreted against a more stable continental margin or microcontinent. If this interpretation is correct analogies can be made with the SW margin of the U.S.A. in which recently formed blocks of volcanic terrane are being accreted against its western margin.
Influence of hexavalent chromium on lactate-enriched Hanford groundwater microbial communities.
Energy Technology Data Exchange (ETDEWEB)
Somenahally, Anil C [ORNL; Mosher, Jennifer J [ORNL; Yuan, Tong [University of Oklahoma; Podar, Mircea [ORNL; Phelps, Tommy Joe [ORNL; Brown, Steven D [ORNL; Yang, Zamin Koo [ORNL; Hazen, Terry C [ORNL; Arkin, Adam [Lawrence Berkeley National Laboratory (LBNL); Palumbo, Anthony Vito [ORNL; Zhou, Jizhong [University of Oklahoma; Elias, Dwayne A [ORNL
2013-01-01
Microbial reduction and immobilization of chromate (Cr(VI)) is a plausible bioremediation strategy. However, higher Cr(VI) concentrations may impose stress on native Cr-reducing communities. We sought to determine if Cr(VI) would influence the lactate enriched native microbial community structure and function in groundwater from the Cr contaminated site at Hanford, WA. Steady state continuous flow bioreactors were amended with lactate and Cr(VI) (0.0, 0.1 and 3.0 mg/L). Microbial growth, metabolites, Cr(VI) concentrations, 16S rRNA gene sequences and GeoChip based functional gene composition in bioreactors were monitored for 15 weeks. Temporal trends and some differences in growth, metabolite profiles, and community composition were observed, largely between Low-Cr and High-Cr bioreactors. In both High-Cr and Low-Cr bioreactors, Cr(VI) was reduced in the bioreactors. With lactate enrichment, the native communities did not significantly differ between Cr concentrations. Native bacterial communities were diverse, whereas after lactate enrichment, Pelosinus spp., and Sporotalea spp., were the most predominant groups in all bioreactors. Similarly, the Archaea diversity significantly decreased from Methanosaeta (35%), Methanosarcina (17%), Halobacteriales (12%), Methanoregula (8%) and others, to mostly Methanosarcina spp. (95%) after lactate enrichment. Composition of several key functional genes was distinct in Low-Cr bioreactors compared to High-Cr. Among the Cr resistant probes (chrA), Burkholderia vietnamiensis, Comamonas testosterone and Ralstonia pickettii proliferated in Cr amended bioreactors. In-situ fermentative conditions facilitated Cr(VI) reduction, and as a result the 3.0 mg/L Cr(VI) did not appear to give chromate reducing strains a competitive advantage for proliferation or for increasing Cr-reduction.
International Nuclear Information System (INIS)
Piirainen, T.; Gehoer, S.; Iljina, M.; Kaerki, A.; Paakkola, J.; Vuollo, J.
1992-10-01
Basic igneous rocks, containing less than 52% SiO 2 , constitute an important part of the Finnish Archaean and Proterozoic crust. In the Archaean crust exist two units which contain the majority of the basic rocks. The Arcaean basic rocks are metavolcanics and situated in the Greenstone Belts of Eastern Finland. They are divided into two units. The greenstones of the lower one are tholeiites, komatiites and basaltic komatiites. The upper consists of bimodal series of volcanics and the basic rocks of which are Fe-tholeiites, basaltic komatiites and komatiites. Proterozoic basic rocks are divided into seven groups according to their ages. The Proterozoic igneous activity started by the volominous basic magmatism 2.44 Ga ago. During this stage formed the layered intrusions and related dykes in the Northern Finland. 2.2 Ga old basic rocks are situated at the margins of Karelian formations. 2.1 Ga aged Fe-tholeiitic magmatic activity is widespread in Eastern and Northern Finland. The basic rocks of 1.97 Ga age group are met within the Karelian Schist Belts as obducted ophiolite complexes but they occur also as tholeiitic diabase dykes cutting the Karelian schists and Archean basement. The intrusions and the volcanics of the 1.9 Ga old basic igneous activity are mostly encountered around the Granitoid Complex of Central Finland. Subjotnian, 1.6 Ga aged tholeiitic diabases are situated around the Rapakivi massifs of Southern Finland, and postjotnian, 1.2 Ga diabases in Western Finland where they form dykes cutting Svecofennian rocks
International Nuclear Information System (INIS)
Guo Zhitian.
1986-01-01
According to the evolution history of the crust the region is divided into three Precambrian structural structural units: (1) Archaean craton; (2) Early Proterozoic zone of fold; (3) Middle-late Proterozoic depression zone. The Archaean-craton mainly consists of granite complex and metasediments. They form the first generation of uranium sources. Proterozoic is characterized by the obvious cycle of sedimentation which consists of the second generation of uranium source. There were multiplestage and congenetic nature in the formation of uranium deposit. The mineralization of uranium coincides with geotectonicdeveloping stage -- igneous activity -- metamorphism in their time. The formation of uranium deposits generally underwent the weathering and erosion of original uraniferous bodies-the migration, redeposition and reformed concentration by metamorphism and metamorphosed hydrothermal solution, and the mineralization was not only of intermittence, but also of inheritance. The evolutional process of forming uranium deposits undergoing various geological function of a structural cycle in the uranium geochemical anomalous area is called uranium mineralizational cycle. The Northeast of Northern China Platform had undergone multiple times structural movements causing migration and concentration of uranium and having mutiple cycle mineralizational character. Corresponding to the three main developing stages of the crustal evolution the Precambrian uranium mineralization in the Northeast of northern China platform area may be divided into three cycles: Late Archaeozoic mineralizational cycle, Early Proterozoic mineralizational cycle, and Middle Proterozoic mineralizational cycle. It is possible to search for potential uranium metallogenetic provinces to study the crustal evolution and the multiple cycle characters of uranium minerogenetic process in the Northern China platform
Evolution of the Pine Creek Geosyncline
International Nuclear Information System (INIS)
Stuart-Smith, P.G.; Crick, I.H.; Needham, R.S.; Wills, K.
1980-01-01
An interpretation of the evolution of the geosyncline is described in four main stages. Stage 1. The geosyncline began to develop in the Early Proterozoic probably during incipient rifting and subsidence of Archaean basement. Continental and shallow marine sediments were deposited at the margins of the geosyncline while in its centre a thicker sequence of fine clastic and chemical sediments, and volcanics accumulated. Stage 2. Uplift of Archaean basement resulted in partial erosion of Stage 1 sediments and an influx of clastic material into the geosyncline. Sandstone and conglomerate formed extensive alluvial fans flanking the uplifted areas and graded distally into littoral and subtidal deposits which later transgressed over them. Stage 3. The third stage started with a tectonic event which caused uplift, folding and subsequent peneplanation of Stage 1 and 2 sediments. A new phase of sedimentation, dominated by chemical and organic sediments and felsic volcanics, accompanied a shallow marine transgression. A major shift in the locus of tectonic activity within the geosyncline from the centre to the west resulted in faulting and volcanism on the western margin and caused an influx of flysch-type sediment into the geosyncline to form an eastwards-thickening wedge. At the close of sedimentation sills of tholeiitic basalt were emplaced into the Early Proterozoic sediments. Stage 4. Continued subsidence of the geosyncline resulted in deformation, metamorphism and partial anatexis of the Early Proterozoic sediments, and some subsequent igneous activity. The sediments were uplifted, eroded and overlain by flat-lying Middle Proterozoic, younger Proterozoic, Palaeozoic and Mesozoic rocks, indicating continued tectonic stability since early Middle Proterozoic times
A detailed phylogeny for the Methanomicrobiales
Rouviere, P.; Mandelco, L.; Winker, S.; Woese, C. R.
1992-01-01
The small subunit rRNA sequence of twenty archaea, members of the Methanomicrobiales, permits a detailed phylogenetic tree to be inferred for the group. The tree confirms earlier studies, based on far fewer sequences, in showing the group to be divided into two major clusters, temporarily designated the "methanosarcina" group and the "methanogenium" group. The tree also defines phylogenetic relationships within these two groups, which in some cases do not agree with the phylogenetic relationships implied by current taxonomic names--a problem most acute for the genus Methanogenium and its relatives. The present phylogenetic characterization provides the basis for a consistent taxonomic restructuring of this major methanogenic taxon.
Mallik, Ananya; Li, Yuan; Wiedenbeck, Michael
2018-01-01
Understanding the evolution of nitrogen (N) across Earth's history requires a comprehensive understanding of N's behaviour in the Earth's mantle - a massive reservoir of this volatile element. Investigation of terrestrial N systematics also requires assessment of its evolution in the Earth's atmosphere, especially to constrain the N content of the Archaean atmosphere, which potentially impacted water retention on the post-accretion Earth, potentially causing enough warming of surface temperatures for liquid water to exist. We estimated the proportion of recycled N in the Earth's mantle today, the isotopic composition of the primitive mantle, and the N content of the Archaean atmosphere based on the recycling rates of N in modern-day subduction zones. We have constrained recycling rates in modern-day subduction zones by focusing on the mechanism and efficiency of N transfer from the subducting slab to the sub-arc mantle by both aqueous fluids and slab partial melts. We also address the transfer of N by aqueous fluids as per the model of Li and Keppler (2014). For slab partial melts, we constrained the transfer of N in two ways - firstly, by an experimental study of the solubility limit of N in melt (which provides an upper estimate of N uptake by slab partial melts) and, secondly, by the partitioning of N between the slab and its partial melt. Globally, 45-74% of N introduced into the mantle by subduction enters the deep mantle past the arc magmatism filter, after taking into account the loss of N from the mantle by degassing at mid-ocean ridges, ocean islands and back-arcs. Although the majority of the N in the present-day mantle remains of primordial origin, our results point to a significant, albeit minor proportion of mantle N that is of recycled origin (17 ± 8% or 12 ± 5% of N in the present-day mantle has undergone recycling assuming that modern-style subduction was initiated 4 or 3 billion years ago, respectively). This proportion of recycled N is enough to
Geological evolution of the Neoproterozoic Bemarivo Belt, northern Madagascar
Thomas, Ronald J.; De Waele, B.; Schofield, D.I.; Goodenough, K.M.; Horstwood, M.; Tucker, R.; Bauer, W.; Annells, R.; Howard, K. J.; Walsh, G.; Rabarimanana, M.; Rafahatelo, J.-M.; Ralison, A.V.; Randriamananjara, T.
2009-01-01
The broadly east-west trending, Late Neoproterozoic Bemarivo Belt in northern Madagascar has been re-surveyed at 1:100 000 scale as part of a large multi-disciplinary World Bank-sponsored project. The work included acquisition of 14 U-Pb zircon dates and whole-rock major and trace element geochemical data of representative rocks. The belt has previously been modelled as a juvenile Neoproterozoic arc and our findings broadly support that model. The integrated datasets indicate that the Bemarivo Belt is separated by a major ductile shear zone into northern and southern "terranes", each with different lithostratigraphy and ages. However, both formed as Neoproterozoic arc/marginal basin assemblages that were translated southwards over the north-south trending domains of "cratonic" Madagascar, during the main collisional phase of the East African Orogeny at ca. 540 Ma. The older, southern terrane consists of a sequence of high-grade paragneisses (Sahantaha Group), which were derived from a Palaeoproterozoic source and formed a marginal sequence to the Archaean cratons to the south. These rocks are intruded by an extensive suite of arc-generated metamorphosed plutonic rocks, known as the Antsirabe Nord Suite. Four samples from this suite yielded U-Pb SHRIMP ages at ca. 750 Ma. The northern terrane consists of three groups of metamorphosed supracrustal rocks, including a possible Archaean sequence (Betsiaka Group: maximum depositional age approximately 2477 Ma) and two volcano-sedimentary sequences (high-grade Milanoa Group: maximum depositional age approximately 750 Ma; low grade Daraina Group: extrusive age = 720-740 Ma). These supracrustal rocks are intruded by another suite of arc-generated metamorphosed plutonic rocks, known as the Manambato Suite, 4 samples of which gave U-Pb SHRIMP ages between 705 and 718 Ma. Whole-rock geochemical data confirm the calc-alkaline, arc-related nature of the plutonic rocks. The volcanic rocks of the Daraina and Milanoa groups also
Late Archaean tectonics and sedimentation of the South Rand area, Witwatersrand basin
International Nuclear Information System (INIS)
Spencer, R.M.
1992-01-01
The sedimentary fill of the southern part of the northeastern Witwatersrand basin consists of four unconformity bounded mega sequences. Early sedimentation took place in a stable, epi continental basin characterized by amphidromic flow. Gradual transgression to distal shelf facies was followed by gradual emergence to intertidal facies. Unconformity Bounded Mega sequence 2 shows that the basin underwent regression, in which discrete uplifts provided a source of granite-greenstone-derived sediment to associated braid plain aprons. Thereafter the basin subsided into a system almost identical to that in which Unconformity Bounded Mega sequence 1 developed. Unconformity Bounded Mega sequence 3 was deposited in a similar marine environment, on an angular unconformity in the east. Regional uplift occurred to the northwest of the basin. Unconformity Bounded Mega sequence 4 records progradation of a perennial braid plain controlled by uplift in the east, and by the minor influence of an uplift to the northwest. Rapid transgression resulted in submarine fan facies development, after which rapid emergence was controlled by uplift in the east, and to a lesser extent, the north. The braid plain was the site of extrusion of komatiitic lavas of the lower Ventersdorp Supergroup and was subsequently smothered by the sustained outpouring of a two kilometer-thick pile of basalts. Crustal extension climaxed after extrusion of felsic volcanics. This extension is antithetic to regional down-to-the-northwest, lower Ventersdorp Supergroup rifting. The last conspicuous phase of Precambrian tectonics is the superposition of a right-lateral wrench system on the early structural framework, after deposition of the lower Transvaal Sequence. Analysis of the samples was carried out by X-ray fluorescence spectrometry. 243 refs., 119 figs., 8 tabs
Direct interspecies electron transfer between Geobacter metallireducens and Methanosarcina barkeri
DEFF Research Database (Denmark)
Rotaru, Amelia-Elena; Shrestha, Pravin Malla; Liu, Fanghua
2014-01-01
of granular activated carbon permitted the pilin-deficient G. metallireducens to share electrons with M. barkeri, demonstrating that this conductive material could substitute for pili in promoting DIET. When M. barkeri was grown in co-culture with the H2-producing Pelobacter carbinolicus, incapable of DIET, M...
Somenahally, Anil C; Mosher, Jennifer J; Yuan, Tong; Podar, Mircea; Phelps, Tommy J; Brown, Steven D; Yang, Zamin K; Hazen, Terry C; Arkin, Adam P; Palumbo, Anthony V; Van Nostrand, Joy D; Zhou, Jizhong; Elias, Dwayne A
2013-01-01
Microbial reduction of toxic hexavalent chromium (Cr(VI)) in-situ is a plausible bioremediation strategy in electron-acceptor limited environments. However, higher [Cr(VI)] may impose stress on syntrophic communities and impact community structure and function. The study objectives were to understand the impacts of Cr(VI) concentrations on community structure and on the Cr(VI)-reduction potential of groundwater communities at Hanford, WA. Steady state continuous flow bioreactors were used to grow native communities enriched with lactate (30 mM) and continuously amended with Cr(VI) at 0.0 (No-Cr), 0.1 (Low-Cr) and 3.0 (High-Cr) mg/L. Microbial growth, metabolites, Cr(VI), 16S rRNA gene sequences and GeoChip based functional gene composition were monitored for 15 weeks. Temporal trends and differences in growth, metabolite profiles, and community composition were observed, largely between Low-Cr and High-Cr bioreactors. In both High-Cr and Low-Cr bioreactors, Cr(VI) levels were below detection from week 1 until week 15. With lactate enrichment, native bacterial diversity substantially decreased as Pelosinus spp., and Sporotalea spp., became the dominant groups, but did not significantly differ between Cr concentrations. The Archaea diversity also substantially decreased after lactate enrichment from Methanosaeta (35%), Methanosarcina (17%) and others, to mostly Methanosarcina spp. (95%). Methane production was lower in High-Cr reactors suggesting some inhibition of methanogens. Several key functional genes were distinct in Low-Cr bioreactors compared to High-Cr. Among the Cr resistant microbes, Burkholderia vietnamiensis, Comamonas testosterone and Ralstonia pickettii proliferated in Cr amended bioreactors. In-situ fermentative conditions facilitated Cr(VI) reduction, and as a result 3.0 mg/L Cr(VI) did not impact the overall bacterial community structure.
Directory of Open Access Journals (Sweden)
Anil C Somenahally
Full Text Available Microbial reduction of toxic hexavalent chromium (Cr(VI in-situ is a plausible bioremediation strategy in electron-acceptor limited environments. However, higher [Cr(VI] may impose stress on syntrophic communities and impact community structure and function. The study objectives were to understand the impacts of Cr(VI concentrations on community structure and on the Cr(VI-reduction potential of groundwater communities at Hanford, WA. Steady state continuous flow bioreactors were used to grow native communities enriched with lactate (30 mM and continuously amended with Cr(VI at 0.0 (No-Cr, 0.1 (Low-Cr and 3.0 (High-Cr mg/L. Microbial growth, metabolites, Cr(VI, 16S rRNA gene sequences and GeoChip based functional gene composition were monitored for 15 weeks. Temporal trends and differences in growth, metabolite profiles, and community composition were observed, largely between Low-Cr and High-Cr bioreactors. In both High-Cr and Low-Cr bioreactors, Cr(VI levels were below detection from week 1 until week 15. With lactate enrichment, native bacterial diversity substantially decreased as Pelosinus spp., and Sporotalea spp., became the dominant groups, but did not significantly differ between Cr concentrations. The Archaea diversity also substantially decreased after lactate enrichment from Methanosaeta (35%, Methanosarcina (17% and others, to mostly Methanosarcina spp. (95%. Methane production was lower in High-Cr reactors suggesting some inhibition of methanogens. Several key functional genes were distinct in Low-Cr bioreactors compared to High-Cr. Among the Cr resistant microbes, Burkholderia vietnamiensis, Comamonas testosterone and Ralstonia pickettii proliferated in Cr amended bioreactors. In-situ fermentative conditions facilitated Cr(VI reduction, and as a result 3.0 mg/L Cr(VI did not impact the overall bacterial community structure.
Directory of Open Access Journals (Sweden)
Katrin eAschenbach
2013-12-01
Full Text Available Methanogens typically occur in reduced anoxic environments. However, in recent studies it has been shown that many aerated upland soils, including desert soils also host active methanogens. Here we show that soil samples from high–altitude cold deserts in the western Himalayas (Ladakh, India produce CH4 after incubation as slurry under anoxic conditions at rates comparable to those of hot desert soils. Samples of matured soil from three different vegetation belts (arid, steppe, and subnival were compared with younger soils originating from frontal and lateral moraines of receding glaciers. While methanogenic rates were higher in the samples from matured soils, CH4 was also produced in the samples from the recently deglaciated moraines. In both young and matured soils, those covered by a biological soil crust (biocrust were more active than their bare counterparts. Isotopic analysis showed that in both cases CH4 was initially produced from H2/CO2 but later mostly from acetate. Analysis of the archaeal community in the in situ soil samples revealed a clear dominance of sequences related to Thaumarchaeota, while the methanogenic community comprised only a minor fraction of the archaeal community. Similar to other aerated soils, the methanogenic community was comprised almost solely of the genera Methanosarcina and Methanocella, and possibly also Methanobacterium in some cases. Nevertheless, approximately 103 gdw-1 soil methanogens were already present in the young moraine soil together with cyanobacteria. Our results demonstrate that Methanosarcina and Methanocella not only tolerate atmospheric oxygen but are also able to survive in these harsh cold environments. Their occurrence in newly deglaciated soils shows that they are early colonisers of desert soils, similar to cyanobacteria, and may play a role in the development of desert biocrusts.
Energy Technology Data Exchange (ETDEWEB)
Somenahally, Anil C [ORNL; Mosher, Jennifer J [ORNL; Yuan, Tong [University of Oklahoma; Phelps, Tommy Joe [ORNL; Brown, Steven D [ORNL; Yang, Zamin Koo [ORNL; Hazen, Terry C [ORNL; Arkin, Adam [Lawrence Berkeley National Laboratory (LBNL); Palumbo, Anthony Vito [ORNL; Van Nostrand, Dr. Joy D. [Oklahoma University; Zhou, Jizhong [University of Oklahoma; Elias, Dwayne A [ORNL
2013-01-01
Microbial reduction of toxic hexavalent chromium (Cr(VI)) in-situ is a plausible bioremediation strategy in electron-acceptor limited environments. However, higher [Cr(VI)] may impose stress on syntrophic communities and impact community structure and function. The study objectives were to understand the impacts of Cr(VI) concentrations on community structure and on the Cr(VI)-reduction potential of groundwater communities at Hanford, WA. Steady state continuous flow bioreactors were used to grow native communities enriched with lactate (30 mM) and continuously amended with Cr(VI) at 0.0 (No-Cr), 0.1 (Low-Cr) and 3.0 (High-Cr) mg/L. Microbial growth, metabolites, Cr(VI), 16S rRNA gene sequences and GeoChip based functional gene composition were monitored for 15 weeks. Temporal trends and differences in growth, metabolite profiles, and community composition were observed, largely between Low-Cr and High-Cr bioreactors. In both High-Cr and Low-Cr bioreactors, Cr(VI) levels were below detection from week 1 until week 15. With lactate enrichment, native bacterial diversity substantially decreased as Pelosinus spp., and Sporotalea spp., became the dominant groups, but did not significantly differ between Cr concentrations. The Archaea diversity also substantially decreased after lactate enrichment from Methanosaeta (35%), Methanosarcina (17%) and others, to mostly Methanosarcina spp. (95%). Methane production was lower in High-Cr reactors suggesting some inhibition of methanogens. Several key functional genes were distinct in Low-Cr bioreactors compared to High-Cr. Among the Cr resistant microbes, Burkholderia vietnamiensis, Comamonas testosterone and Ralstonia pickettii proliferated in Cr amended bioreactors. In-situ fermentative conditions facilitated Cr(VI) reduction, and as a result 3.0 mg/L Cr(VI) did not impact the overall bacterial community structure.
International Nuclear Information System (INIS)
Kroener, A.
1987-01-01
Ion microprobe zircon ages, a Nd model age and Rb-Sr whole-rock dates are reported from the high-grade gneiss terrain at Sabaloka on the River Nile north of Khartoum, formally considered to be part of the Archaean/early Proterozoic Nile craton. The granulites, which are of both sedimentary and igneous derivation, occur as remnants in migmatites. Detrital zircon ages range from ≅ 1000 to ≅ 2650 Ma and prove the existence of Archaean to late Proterozoic continental crust in the sedimentary source region. The Nd model age for one sedimentary granulite is between 1.26 (T CHUR ) and 1.70 (T DM ) Ga and provides a mean crustal residence age for the sedimentary precursor. Igneous zircons in enderbitic gneiss crystallized at 719±81 Ma ago, an age that also corresponds to severe Pb loss in the detrital zircons and whic probably reflects the granulite event at Sabaloka. The Rb-Sr data indicate isotropic homogenization at about 700 Ma ago in the granulites and severe post-granulite disturbance at ≅ 570 Ma in the migmatites. We associate this disturbance with hydration, retrograde metamorphism and anatexis that produced undeformed granites ≅ 540 Ma ago. The ≅ 700 Ma granulite event at Sabaloka suggests that this part of the Sudan belongs to the Pan-African Mozambique belt while the ancient Nile craton lay farther west. The gneisses studied here may represent the infrastructure of the ancient African continental margin onto which the juvenile arc assemblage of the Arabian-Nubian shield was accreted during intense horizontal shortening and crustal interstacking of a major collision event. (orig.)
Translation termination in pyrrolysine-utilizing archaea.
Alkalaeva, Elena; Eliseev, Boris; Ambrogelly, Alexandre; Vlasov, Peter; Kondrashov, Fyodor A; Gundllapalli, Sharath; Frolova, Lyudmila; Söll, Dieter; Kisselev, Lev
2009-11-03
Although some data link archaeal and eukaryotic translation, the overall mechanism of protein synthesis in archaea remains largely obscure. Both archaeal (aRF1) and eukaryotic (eRF1) single release factors recognize all three stop codons. The archaeal genus Methanosarcinaceae contains two aRF1 homologs, and also uses the UAG stop to encode the 22nd amino acid, pyrrolysine. Here we provide an analysis of the last stage of archaeal translation in pyrrolysine-utilizing species. We demonstrated that only one of two Methanosarcina barkeri aRF1 homologs possesses activity and recognizes all three stop codons. The second aRF1 homolog may have another unknown function. The mechanism of pyrrolysine incorporation in the Methanosarcinaceae is discussed.
The contribution of remote sensing to an understanding of the geology of Gabon
International Nuclear Information System (INIS)
Bassot, J.P.
1988-01-01
A major remote-sensing operation involving radar imagery and airbone magnetism and spectrometry has been successfully conducted in Gabon. The three methods used give complementary results. Lateral radar imagery and radiometry (U, K, Th) have supplied much new information on the Upper and Lower Proterozoic, but in areas affected by intense peneplanation and lateritisation they are less effective. Conversely, Airbone magnetism gives a deeper vision into the ground: particularly it revealed that the extent of greenstone belts had been significantly underestimated on existing geological maps. In addition, the trends in these belts have given a new insight into late Archaean tectonics in northern Gabon [fr
In search of the noble gas 3.52 Ga atmospheric signatures
Pujol, M.; Marty, B.; Philippot, P.
2008-12-01
The isotopic signatures of noble gases in the Present-day mantle and in the atmosphere permit exceptional insight into the evolution of these reservoirs through time ([1]). However, related exchange models are under- constrained and would require direct measurements of the atmospheric composition long ago, e.g., in the Archaean. Drilling in the the 3.52 Ga chert-barite ([2]) of the Dresser formation(Pilbara Drilling Project) , North Pole, Pilbara craton (Western Australia), led to recovery of exceptionally fresh samples preserving primary fluid inclusions unaffected by surface weathering. The whole formation is considered to be an already established basin when hydrothermal processes started. The chemical composition of primary fluid inclusions trapped in hydrothermal quartz from vacuolar komatiitic basalt from 110 m depth were determined by synchrotron X-ray microfluorescence (ESRF, Grenoble,France). Data show that fluids are relatively homogenous, consisting of a Ba-rich fluid and a Fe (+Ba)-rich fluid of hydrothermal origin as concluded by Foriel et al.([3]). The isotopic compositions of xenon and argon trapped in these fluids were measured by mass spectrometry following vacuum crushing. The three argon isotopes show a homogeneous signature quite different from present-day Earth atmosphere but we cannot exclude the possibility that secondary nuclear reactions produced these anomalies. Despite this, the Xe isotopic trends indicate a less radiogenic signature than the Present-day atmosphere, and probably represent a remnant of the Archaean atmosphere. If this xenon composition is primitive then it implies that there is no cosmogenic production through time. However, argon ratios could be explained by cosmogenic production which implies significant surface exposure times. Cosmogenic production will produce correlated argon and xenon isotope signatures. Therefore it is necessary to differentiate primary from secondary composition. To investigate the effects of these
Directory of Open Access Journals (Sweden)
Paterno R Castillo
2014-09-01
Full Text Available The recently discovered high, plume-like 3He/4He ratios at Rungwe Volcanic Province (RVP in southern Tanzania, similar to those at the Main Ethiopian Rift in Ethiopia, strongly suggest that magmatism associated with continental rifting along the entire East African Rift System (EARS has a deep mantle contribution (Hilton et al., 2011. New trace element and Sr-Nd-Pb isotopic data for high 3He/4He lavas and tephras from RVP can be explained by binary mixing relationships involving Early Proterozoic (+/- Archaean lithospheric mantle, present beneath the southern EARS, and a volatile-rich carbonatitic plume with a limited range of compositions and best represented by recent Nyiragongo lavas from the Virunga Volcanic Province also in the Western Rift. Other lavas from the Western Rift and from the southern Kenya Rift can also be explained through mixing between the same endmember components. In contrast, lavas from the northern Kenya and Main Ethiopian rifts can be explained through variable mixing between the same mantle plume material and the Middle to Late Proterozoic lithospheric mantle, present beneath the northern EARS. Thus, we propose that the bulk of EARS magmatism is sourced from mixing among three endmember sources: Early Proterozoic (+/- Archaean lithospheric mantle, Middle to Late Proterozoic lithospheric mantle and a volatile-rich carbonatitic plume with a limited range of compositions. We propose further that the African Superplume, a large, seismically anomalous feature originating in the lower mantle beneath southern Africa, influences magmatism throughout eastern Africa with magmatism at RVP and Main Ethiopian Rift representing two different heads of a single mantle plume source. This is consistent with a single mantle plume origin of the coupled He-Ne isotopic signatures of mantle-derived xenoliths and/or lavas from all segments of the EARS (Halldorsson et al., 2014.
Generation of TTG rocks in the Archean: insight from numerical simulations
Rozel, Antoine; Golabek, Gregor; Gerya, Taras; Jain, Charitra; Tackley, Paul
2017-04-01
We study the creation of primordial continental crust (TTG rocks) for the first time employing fully self-consistent numerical models of thermochemical convection on a global scale. Starting from a pyrolytic bulk composition and an initially hot core, we first generate oceanic crust and depleted mantle. In our model, the basaltic material is both erupted at the surface and intruded at the base of the crust following a predefined partitioning. Second, we track the pressure-temperature conditions of the newly formed hydrated basalt and check if it matches the conditions necessary for the formation of primordial continental crust. We show that the "heat-pipe" model (assuming 100% eruption and no intrusion) proposed to be the main heat loss mechanism during the Archean epoch (Moore & Webb 2013) is not able to produce continental crust since it forms a cold and thick lithosphere. We systematically test various mechanical properties of the brittle domain (friction coefficients). Using our parameter study, we are also able to show that an intrusion fraction close to 70% (in agreement with [Crisp 1984]) combined with a friction coefficient of 0.2 products the expected amount of the three main petrological TTG compositions previously reported (Moyen 2011). This study represents a major step towards the production of self-consistent convection models able to generate the continental crust of the Earth. REFERENCES Crisp, J. A. (1984), Rates of magma emplacement and volcanic output. Journal of Volcanology and Geothermal Research, 20(3-4), 177-211. Moore, W., and A. Webb (2013), Heat-pipe earth. Nature, 501, 501-505, doi:10.1038/nature12473. Moyen, J. (2011), The composite archaean grey gneisses: Petrological significance, and evidence for a non-unique tectonic setting for archaean crustal growth. Lithos, 123, 21-36, doi: 10.1016/j.lithos.2010.09.015.
International Nuclear Information System (INIS)
Pereira, Edilea Dutra.
1992-01-01
This work deals with a Rb/Sr geochronological study carried on granitoids and granulites of the Carajas Mineral Province (Rio Maria, Serra dos Gradaus and Serra do Pium regions) and Sao Felix do Xingu regions. The Manelao and Ourilandia granitoids of the Sao Felix do Xingu region are associated with the greenstone terrains of the Tucuma Group, and yield an age of 2749 ± 24 Ma with an initial ratio of 0.07028 ± 19, and 2677 ± 50 Ma with an initial ratio of 0.07016 ± 22, respectively. In the Rio Maria region, an age of 2541 ± 74 Ma with an initial ratio of 0.7104 ± 343 was obtained on the Mata Surrao Granite located near the Marajoara Village. This age confirms an archaean monzogranitic magmatism in this region. In the Gradaus area, the Cumaru Granodiorite give an mineral age of 2577 ± 27 Ma similar to the age obtained by whole rock method. Finally, Rb/Sr ages were obtained from granulitic rocks of the Pium Complex located at the Serra do Pium and near the Catete River. Samples of the Serra do Pium yielded ages of 2325 ± 71 Ma (whole rock) and 1857 ± 48 (minerals). Samples from the Catete River area give a whole rock age of 2018 ± 25 Ma with an initial ratio of 0.7039 ± 25. These data show that the Rb/Sr system in these granulitic rocks suffered changes during the Early Proterozoic times. The geochronological data here obtained confirm promptly an Archaean evolution in the studied regions, besides give rise the discussion about the problem related to the Transamazonian Event inside them. (author). 92 refs., 32 figs., 10 tabs
Deep origin and hot melting of an Archaean orogenic peridotite massif in Norway
Spengler, D.; Van Roermund, H.L.M.; Drury, M.R.; Ottolini, L.; Mason, P.R.D.; Davies, G.R.
2006-01-01
The buoyancy and strength of sub-continental lithospheric mantle is thought to protect the oldest continental crust (cratons) from destruction by plate tectonic processes. The exact origin of the lithosphere below cratons is controversial, but seems clearly to be a residue remaining after the
International Nuclear Information System (INIS)
Coolen, J.J.M.M.M.
1982-01-01
Four zircon fractions of garnet-bearing two-pyroxene granulite, from the Furua granulite complex of southern Tanzania, plot very close to concordia. A discordia yields a lower intercept at 652 +- 10 Ma, an age slightly higher than the Rb-Sr whole-rock and mineral ages reported from the surrounding amphibolite-facies rocks. The U-Pb systematics indicate the presence of a very small amount of older (2-3 Ga) radiogenic lead. The zircon data may be interpreted as indicating an event of granulite-facies metamorphism during the Pan-African thermotectonic episode. This interpretation is at variance with current models postulating that the granulite complexes in the Mozambique belt are relicts of older, possibly Archaean events of metamorphism. (Auth.)
Gupta, Mohan L.; Sharma, S. R.; Sundar, A.
Heat flow values and heat generation data calculated from the concentration of heat producing radioactive elements, U, Th and K in surface rocks were analyzed. The South Indian Craton according to Drury et al., can be divided into various blocks, separated by late Proterozoic shear belts. The northern block comprises Eastern and Western Dharwar Cratons of Rogers (1986), Naqvi and Rogers (1987) and a part of the South Indian granulite terrain up to a shear system occupying the Palghat-Cauvery low lands. The geothermal data analysis clearly demonstrates that the present thermal characteristics of the above two Archaean terrains of the Indian and Australian Shields are quite similar. Their crustal thermal structures are likely to be similar also.
Gupta, Mohan L.; Sharma, S. R.; Sundar, A.
1988-01-01
Heat flow values and heat generation data calculated from the concentration of heat producing radioactive elements, U, Th and K in surface rocks were analyzed. The South Indian Craton according to Drury et al., can be divided into various blocks, separated by late Proterozoic shear belts. The northern block comprises Eastern and Western Dharwar Cratons of Rogers (1986), Naqvi and Rogers (1987) and a part of the South Indian granulite terrain up to a shear system occupying the Palghat-Cauvery low lands. The geothermal data analysis clearly demonstrates that the present thermal characteristics of the above two Archaean terrains of the Indian and Australian Shields are quite similar. Their crustal thermal structures are likely to be similar also.
International Nuclear Information System (INIS)
Rios, Debora Correia; Conceicao, Herbet; Rosa, Maria de Lourdes da Silva; Marinho, Moacyr Moura; Davis, Donaldo Wayne
2005-01-01
The Pedra Vermelha Granitic Massif, located at the North area of Serrinha Nucleus, presents a circular shape, being intrusive at the Archaean geoscience-magmatic basement rocks and the Paleoproterozoic volcano sedimentary sequences. The single zircon U-Pb dating yield a crystallization age of 2080 ± 8 Ma. The geological, petrographic al and litogeochemical characteristics of the studied rocks are similar to those of the Morro do Lopes granitic magmatism (2076 ± 6 a 2071 ± 6 Ma), which is located at the South area of this nucleus. These allow us to infer that those post-orogenic alkaline bodies are widespread throughout the Serrinha Nucleus and constitute its last Paleoproterozoic magmatic expression. (author)
Reducing gas content of coal deposits by means of bacteria
Energy Technology Data Exchange (ETDEWEB)
Godlewska-Lipowa, A A; Kozlowski, B
1981-07-01
This paper discusses the results of experiments carried out in Poland under laboratory conditions on efficiency of methane control using bacteria from Methanosarcina and Methanomonas groups. Malashenko and Whittenburry culture mediums were used. Bacteria growth in an atmosphere of air and methane (48.2%, 8.6% and 5.21%) was observed. Temperature ranged from 19 to 20 C. Investigations show that the bacteria are characterized by high oxidation activity. Depending on methane concentration in the air the bacteria consume from 75% to 100% of methane during biosynthesis. The bacteria reduce methane and oxygen content and increase carbon dioxide content in the air. Using bacteria methane concentration in the air was reduced from 48.2% to 12.3%, from 8.6% to 0.0% and from 5.21% to 0.01%. (7 refs.) (In Polish)
Crustal evolution in north-east and east Africa from model Nd ages
International Nuclear Information System (INIS)
Harris, N.B.W.; Hawkesworth, C.J.; Ries, A.C.
1984-01-01
The authors present the results of an Nd isotope study on the major rock units of the Pan-African (1,100-500 Myr BP) terrane. Charnockites from Jabel Uweinat, a basement inlier at the junction of Egypt, Libya and the Sudan, yield middle Archaean model Nd ages, whilst model ages of < 1,200 Myr have been obtained in a belt from the Eastern Desert of Egypt to north-west Kenya. Overall, the Pan-African rocks from north-east and east Africa and those from the Damara of Namibia exhibit a wide range of epsilonsub(Nd)(T) from +7.5 to -18.0 which reflects regional changes in tectonic style and is not readily reconciled with simple models for the evolution of average continental crust. (author)
International Nuclear Information System (INIS)
Foy, N.F.; Miezitis, Y.
1977-01-01
A weak airborne anomaly was examined in the field and the presence of uranium confirmed. Rotary-percussion drilling showed the presence of uranium but a subsequent programme of diamond and rotary-percussion drilling indicated that the concentration of uranium was uneconomic. Within the tuffs and volcanics of the prospect the uranium existed as uranyl phosphates within the oxidized zone. Geological mapping and the diamond drill core showed that the Stag Creek Volcanics are part of the Lower Proterozoic Masson Formation, probably with member status, rather than the expression of an Archaean basement ridge. This change in the interpretation of the fundamental structure of the Pine Creek Geosyncline has led to a re-examination of the stratigraphy and to suggestions which differ from the current concept. (author)
Gold deposit styles and placer gold characterisation in northern and east-central Madagascar
Pitfield, Peter E. J; Styles, Michael T.; Taylor, Cliff D.; Key, Roger M.; Bauer,; Ralison, A
2009-01-01
Microchemical characterisation of bedrock and placer gold grains from six gold districts within the Archaean domains and intervening Neoproterozoic Anaboriana-Manampotsy belt of northern and east-central Madagascar show few opaque inclusions (e.g pyrrhotite, Bi tellurides) but wide range of Ag contents (40wt%). Some districts exhibit multiple source populations of grains. The ‘greenstone belt’ terranes have an orogenic gold signature locally with an intrusion-related to epithermal overprint. Proterozoic metasediments with felsic to ultramafic bodies yield dominantly intrusion-related gold. A high proportion of secondary gold (<0.5wt% Ag) is related to recycling of paleoplacers and erosion of post-Gondwana planation surfaces and indicates that some mesothermal gold systems were already partially to wholly removed by erosion by the PermoTriassic.
Szilas, K.; Cruz, M. F.; Grove, M.; Morishita, T.; Pearson, D. G.
2016-12-01
Field observations and preliminary geochemical data are presented for large (>500x1000m) peridotite enclaves from the Fiskefjord region of SW Greenland. These ultramafic complexes are dominated by dunite, amphibole-harzburgite, lesser amounts of norite and horizons of stratiform chromitite and are therefore interpreted as cumulate rocks[1]. The ultramafic enclaves are hosted by intrusive tonalitic orthogneiss, which provide U-Pb zircon minimum age constraints of ca. 2980 Ma, whereas preliminary Re-Os isotope data on the dunite and chromitite yield TRD ages of ca. 3300 Ma[2]. Dunite has highly forsteritic olivine compositions with Mg# mostly around 92 to 93, which is uncorrelated with the bulk-rock mg# or modal chromite contents. This indicates that the primary olivine records equilibration with a highly magnesian parental magma, which may have been responsible for the strong depletion of the SCLM in this region. Amphibole and phlogopite is mostly associated with granitoid sheets or infiltrating veins in the dunite and appear to replace chromite. Argon dating (40Ar/39Ar) of the phlogopite yields ages ranging from ca. 3400 Ma to ca. 1750 Ma, with most ages clustering around 3000 Ma. This is consistent with formation of the phlogopite and amphibole by metasomatic processes involving reaction between granitoid-derived siliceous fluids and the ultramafic rocks. The older 40Ar/39Ar age plateaus most plausibly represent excess Ar, potentially inherited from the nearby Itsaq Gneiss Complex (3900 to 3600 Ga) based on its proximity. The youngest 40Ar/39Ar age plateaus on the other hand may potentially signify the closure-age for this system, which could have important implications for determining the exhumation history of the North Atlantic craton. References [1] Szilas, K., Kelemen, P. B., & Bernstein, S. (2015). Peridotite enclaves hosted by Mesoarchaean TTG-suite orthogneisses in the Fiskefjord region of southern West Greenland. GeoResJ, 7, 22-34. [2] Szilas, K., van Hinsberg, V. J., McDonald, I., Morishita, T., Pearson, D. G. (2016). Highly depleted peridotites within Mesoarchaean orthogneiss at the Seqi Olivine Mine, SW Greenland - Potential implications for the formation of cratonic keels. Goldschmidt Conference Abstract #3009, Yokohama.
U, Th and K contents and metamorphism of Archaean rocks from South-West Greenland
International Nuclear Information System (INIS)
Kalsbeek, F.
1974-01-01
Granulite facies rocks, from the Nordland area, West Greenland, contain six times less U than the amphibolite facies rocks of the Frederikshaab area, and half of the amount of K. The rocks of the Frederikshaab area did not form by retrogression of granulite facies rocks. This study is based on analyses of sand samples which adequately represent the inhomogeneous bed rock. (author)
Strik, G.H.M.A.
2004-01-01
Palaeomagnetic studies are e.g. important for demonstrating and quantifying horizontal movement and rotation of pieces of the Earth's crust. The constant movement and recycling of plates, in other words plate tectonics, is an important mechanism for the Earth to lose its heat. It is generally
Promoting Interspecies Electron Transfer with Biochar
Chen, Shanshan; Rotaru, Amelia-Elena; Shrestha, Pravin Malla; Malvankar, Nikhil S.; Liu, Fanghua; Fan, Wei; Nevin, Kelly P.; Lovley, Derek R.
2014-01-01
Biochar, a charcoal-like product of the incomplete combustion of organic materials, is an increasingly popular soil amendment designed to improve soil fertility. We investigated the possibility that biochar could promote direct interspecies electron transfer (DIET) in a manner similar to that previously reported for granular activated carbon (GAC). Although the biochars investigated were 1000 times less conductive than GAC, they stimulated DIET in co-cultures of Geobacter metallireducens with Geobacter sulfurreducens or Methanosarcina barkeri in which ethanol was the electron donor. Cells were attached to the biochar, yet not in close contact, suggesting that electrons were likely conducted through the biochar, rather than biological electrical connections. The finding that biochar can stimulate DIET may be an important consideration when amending soils with biochar and can help explain why biochar may enhance methane production from organic wastes under anaerobic conditions. PMID:24846283
Flux networks in metabolic graphs
International Nuclear Information System (INIS)
Warren, P B; Queiros, S M Duarte; Jones, J L
2009-01-01
A metabolic model can be represented as a bipartite graph comprising linked reaction and metabolite nodes. Here it is shown how a network of conserved fluxes can be assigned to the edges of such a graph by combining the reaction fluxes with a conserved metabolite property such as molecular weight. A similar flux network can be constructed by combining the primal and dual solutions to the linear programming problem that typically arises in constraint-based modelling. Such constructions may help with the visualization of flux distributions in complex metabolic networks. The analysis also explains the strong correlation observed between metabolite shadow prices (the dual linear programming variables) and conserved metabolite properties. The methods were applied to recent metabolic models for Escherichia coli, Saccharomyces cerevisiae and Methanosarcina barkeri. Detailed results are reported for E. coli; similar results were found for other organisms
Intraplate mafic magmatism: New insights from Africa and N. America
Ebinger, C. J.; van der Lee, S.; Tepp, G.; Pierre, S.
2017-12-01
Plate tectonic concepts consider that continental interiors are stable, with magmatism and strain localized to plate boundaries. We re-evaluate the role of pre-existing and evolving lithospheric heterogeneities in light of perspectives afforded by surface to mantle results from active and ancient rift zones in Africa and N. America. Our process-oriented approach addresses the localization of strain and magmatism and stability of continental plate interiors. In both Africa and N. America, geophysical imaging and xenolith studies reveal that thick, buoyant, and chemically distinct Archaean cratons with deep roots may deflect mantle flow, and localize magmatism and strain over many tectonic cycles. Studies of the Colorado Plateau and East African rift reveal widespread mantle metasomatism, and high levels of magma degassing along faults and at active volcanoes. The volcanoes and magmatic systems show a strong dependence on pre-existing heterogeneities in plate structure. Syntheses of the EarthScope program ishow that lateral density contrasts and migration of volatiles that accumulated during subduction can refertilize mantle lithosphere, and enable volatile-rich magmatism beneath relatively thick continental lithosphere. For example, the passive margin of eastern N. America shows uplift and magmatism long after the onset of seafloor spreading, demonstrating the dynamic nature of coupling between the lithosphere, asthenosphere, and deeper mantle. As demonstrated by the East African Rift, the Mid-Continent Rift, and other active and ancient rift zones, the interiors of continents, including thick, cold Archaean cratons are not immune to mafic magmatism and tectonism. Recent studies in N. America and Africa reveal ca. 1000 km-wide zones of dynamic uplift, low upper mantle velocities, and broadly distributed strain. The distribution of magmatism and volatile release, in combination with geophysical signals, indicates a potentially convective origin for widespread
Bolhar, Robert; Hofmann, Axel; Kemp, Anthony I. S.; Whitehouse, Martin J.; Wind, Sandra; Kamber, Balz S.
2017-10-01
Hafnium and oxygen isotopic compositions measured in-situ on U-Pb dated zircon from Archaean sedimentary successions belonging to the 2.9-2.8 Ga Belingwean/Bulawayan groups and previously undated Sebakwian Group are used to characterize the crustal evolution of the Zimbabwe Craton prior to 3.0 Ga. Microstructural and compositional criteria were used to minimize effects arising from Pb loss due to metamorphic overprinting and interaction with low-temperature fluids. 207Pb/206Pb age spectra (concordance >90%) reveal prominent peaks at 3.8, 3.6, 3.5, and 3.35 Ga, corresponding to documented geological events, both globally and within the Zimbabwe Craton. Zircon δ18O values from +4 to +10‰ point to both derivation from magmas in equilibrium with mantle oxygen and the incorporation of material that had previously interacted with water in near-surface environments. In εHf-time space, 3.8-3.6 Ga grains define an array consistent with reworking of a mafic reservoir (176Lu/177Hf ∼0.015) that separated from chondritic mantle at ∼3.9 Ga. Crustal domains formed after 3.6 Ga depict a more complex evolution, involving contribution from chondritic mantle sources and, to a lesser extent, reworking of pre-existing crust. Protracted remelting was not accompanied by significant mantle depletion prior to 3.35 Ga. This implies that early crust production in the Zimbabwe Craton did not cause complementary enriched and depleted reservoirs that were tapped by later magmas, possibly because the volume of crust extracted and stabilised was too small to influence (asthenospheric) mantle isotopic evolution. Growth of continental crust through pulsed emplacement of juvenile (chondritic mantle-derived) melts, into and onto the existing cratonic nucleus, however, involved formation of complementary depleted subcontinental lithospheric mantle since the early Archaean, indicative of strongly coupled evolutionary histories of both reservoirs, with limited evidence for recycling and lateral
Cover sequences at the northern margin of the Antongil Craton, NE Madagascar
Bauer, W.; Walsh, G.J.; De Waele, B.; Thomas, Ronald J.; Horstwood, M.S.A.; Bracciali, L.; Schofield, D.I.; Wollenberg, U.; Lidke, D.J.; Rasaona, I.T.; Rabarimanana, M.H.
2011-01-01
The island of Madagascar is a collage of Precambrian, generally high-grade metamorphic basement domains, that are locally overlain by unmetamorphosed sedimentary rocks and poorly understood low-grade metasediments. In the Antalaha area of NE Madagascar, two distinct cover sequences rest on high-grade metamorphic and igneous basement rocks of the Archaean Antongil craton and the Neoproterozoic Bemarivo belt. The older of these two cover sequences, the Andrarona Group, consists of low-grade metasedimentary rocks. The younger sequence, the newly defined Ampohafana Formation, consists of unmetamorphosed sedimentary rocks. The Andrarona Group rests on Neoarchaean granites and monzogranites of the Antongil craton and consists of a basal metagreywacke, thick quartzites and an upper sequence of sericite-chlorite meta-mudstones, meta-sandstones and a volcaniclastic meta-sandstone. The depositional age of the volcaniclastic meta-sandstone is constrained in age by U–Pb laser-ablation ICP-MS analyses of euhedral zircons to 1875 ± 8 Ma (2σ). Detrital zircons of Archaean and Palaeoproterozoic age represent an input from the Antongil craton and a newly defined Palaeoproterozoic igneous unit, the Masindray tonalite, which underlies the Andrarona Group, and yielded a U–Pb zircon age of 2355 ± 11 Ma (2σ), thus constraining the maximum age of deposition of the basal part of the Andrarona Group. The Andrarona Group shows a low-grade metamorphic overprint in the area near Antalaha; illite crystallinity values scatter around 0.17°Δ2Θ CuKα, which is within the epizone. The Ampohafana Formation consists of undeformed, polymict conglomerate, cross-bedded sandstone, and red mudstone. An illite crystallinity value of >0.25°Δ2Θ CuKα obtained from the rocks is typical of the diagenetic zone. Occurrences of rhyodacite pebbles in the Ampohafana Formation and the intrusion of a basaltic dyke suggest a deposition in a WSW-ENE-trending graben system during the opening of the Indian
Shcherbakova, V. V.; Lubnina, N. V.; Shcherbakov, V. P.; Zhidkov, G. V.; Tsel'movich, V. A.
2017-09-01
The results of paleomagnetic studies and paleointensity determinations from two Neoarchaean Shala dikes with an age of 2504 Ma, located within the Vodlozerskii terrane of the Karelian craton, are presented. The characteristic components of primary magnetization with shallow inclinations I = -5.7 and 1.9 are revealed; the reliability of the determinations is supported by two contact tests. High paleointensity values are obtained by the Thellier-Coe and Wilson techniques. The calculated values of the virtual dipole moment (11.5 and 13.8) × 1022 A m2 are noticeably higher than the present value of 7.8 × 1022 A m2. Our results, in combination with the previous data presented in the world database, support the hypothesized existence of a period of high paleointensity in the Late Archaean-Early Proterozoic.
Jiménez, Janet; Theuerl, Susanne; Bergmann, Ingo; Klocke, Michael; Guerra, Gilda; Romero-Romero, Osvaldo
The aim of this study was to analyze the effect of the addition of rice straw and clay residuals on the prokaryote methane-producing community structure in a semi-continuously stirred tank reactor fed with swine manure. Molecular techniques, including terminal restriction fragment length polymorphism and a comparative nucleotide sequence analyses of the prokaryotic 16S rRNA genes, were performed. The results showed a positive effect of clay addition on methane yield during the co-digestion of swine manure and rice straw. At the digestion of swine manure, the bacterial phylum Firmicutes and the archaeal family Methanosarcinaceae, particularly Methanosarcina species, were predominant. During the co-digestion of swine manure and rice straw the microbial community changed, and with the addition of clay residual, the phylum Bacteroidetes predominated. The new nutritional conditions resulted in a shift in the archaeal family Methanosarcinaceae community as acetoclastic Methanosaeta species became dominant.
Isotope and trace element models of crustal evolution
International Nuclear Information System (INIS)
O'Nions, R.K.; Hamilton, P.J.
1981-01-01
Some of the isotopic constraints on the development of continental crust from about 3.8 Ga ago are reviewed. Particularly it is noted that Archaean granitic (sensu lato) rocks have initial 143 Nd/ 144 Nd ratios close to predicted values for the bulk Earth at the time before emplacement, whereas those Phanerozoic granites investigated so far diverge considerably from the bulk Earth and betray the existence of later continental crust in their provenance. Geochemical evidence for recycling of some continent-derived elements into the mantle is examined and the important distinction between selected element recycling and bulk return of continental material is emphasized. Various transport models that have been proposed to model the development of continental crust are examined and some of their differences and similarities, particularly with respect to implications for continental recycling, are highlighted. (author)
Energy Technology Data Exchange (ETDEWEB)
Abraham, Kathrin
2010-05-28
regarded as the most likely source of silica for the silicification process. Calculations show that classical water-rock interaction can not influence the silicon isotope variation due to the very low concentration of Si in seawater (49 ppm). The data are consistent with a two end-member component mixture between basalt and chert. The secular increase in chert isotope composition through time is confirmed by the present data. Possible factors that could account for different gradients of δ{sup 30}Si vs. δ{sup 18}O are changes of seawater isotope signature, the water temperature or secondary alteration. The last section describes potential changes in the source of Granitoids in the Archaean: the Si isotope perspective. Sodic tonalite-trondhjemite-granodiorite (TTG) intrusive units make up large components of the Archaean crust. In contrast, today's continental crust is more potassic in composition (GMS group: granite-monzonite-syenite). Processes that lead to this changeover from ''sodic'' to ''potassic'' crust are the subject of this section. Silicon isotope measurements were combined with major and trace element analyses on different generations of TTG and GMS group intrusive units from 3.55 to 3.10 Ga from the study area. δ{sup 30}Si-values show a slight temporal increase during different pluton generations, with sodic intrusive units demonstrating the lowest Si-isotope composition. The small increase in silicon isotope composition with time might be due to different temperature conditions in the source of granitoids, with Na-rich, light δ{sup 30}Si granitoids emerging at higher temperatures. A similarity in δ{sup 30}Si between Archaean K-rich plutons and Phanerozoic K-rich plutons is confirmed.
International Nuclear Information System (INIS)
Abraham, Kathrin
2010-01-01
likely source of silica for the silicification process. Calculations show that classical water-rock interaction can not influence the silicon isotope variation due to the very low concentration of Si in seawater (49 ppm). The data are consistent with a two end-member component mixture between basalt and chert. The secular increase in chert isotope composition through time is confirmed by the present data. Possible factors that could account for different gradients of δ 30 Si vs. δ 18 O are changes of seawater isotope signature, the water temperature or secondary alteration. The last section describes potential changes in the source of Granitoids in the Archaean: the Si isotope perspective. Sodic tonalite-trondhjemite-granodiorite (TTG) intrusive units make up large components of the Archaean crust. In contrast, today's continental crust is more potassic in composition (GMS group: granite-monzonite-syenite). Processes that lead to this changeover from ''sodic'' to ''potassic'' crust are the subject of this section. Silicon isotope measurements were combined with major and trace element analyses on different generations of TTG and GMS group intrusive units from 3.55 to 3.10 Ga from the study area. δ 30 Si-values show a slight temporal increase during different pluton generations, with sodic intrusive units demonstrating the lowest Si-isotope composition. The small increase in silicon isotope composition with time might be due to different temperature conditions in the source of granitoids, with Na-rich, light δ 30 Si granitoids emerging at higher temperatures. A similarity in δ 30 Si between Archaean K-rich plutons and Phanerozoic K-rich plutons is confirmed.
Yu, Miao; Wu, Chuanfu; Wang, Qunhui; Sun, Xiaohong; Ren, Yuanyuan; Li, Yu-You
2018-01-01
This study investigates the effects of ethanol prefermentation (EP) on methane fermentation. Yeast was added to the substrate for EP in the sequencing batch methane fermentation of food waste. An Illumina MiSeq high-throughput sequencing system was used to analyze changes in the microbial community. Methane production in the EP group (254mL/g VS) was higher than in the control group (35mL/g VS) because EP not only increased the buffering capacity of the system, but also increased hydrolytic acidification. More carbon source was converted to ethanol in the EP group than in the control group, and neutral ethanol could be converted continuously to acetic acid, which promoted the growth of Methanobacterium and Methanosarcina. As a result, the relative abundance of methane-producing bacteria was significantly higher than that of the control group. Kinetic modeling indicated that the EP group had a higher hydrolysis efficiency and shorter lag phase. Copyright © 2017 Elsevier Ltd. All rights reserved.
Park, Jeong-Hoon; Park, Jong-Hun; Je Seong, Hoon; Sul, Woo Jun; Jin, Kang-Hyun; Park, Hee-Deung
2018-07-01
To provide insight into direct interspecies electron transfer via granular activated carbon (GAC), the effect of GAC supplementation on anaerobic digestion was evaluated. Compared to control samples, the GAC supplementation increased the total amount of methane production and its production rate by 31% and 72%, respectively. 16S rDNA sequencing analysis revealed a shift in the archaeal community composition; the Methanosarcina proportion decreased 17%, while the Methanosaeta proportion increased 5.6%. Metagenomic analyses based on shotgun sequencing demonstrated that the abundance of pilA and omcS genes belonging to Geobacter species decreased 69.4% and 29.4%, respectively. Furthermore, the analyses suggested a carbon dioxide reduction pathway rather than an acetate decarboxylation pathway for methane formation. Taken together, these results suggest that GAC improved methane production performance by shifting the microbial community and altering functional genes associated with direct interspecies electron transfer via conductive materials. Copyright © 2018 Elsevier Ltd. All rights reserved.
Ziganshin, Ayrat M; Schmidt, Thomas; Lv, Zuopeng; Liebetrau, Jan; Richnow, Hans Hermann; Kleinsteuber, Sabine; Nikolausz, Marcell
2016-10-01
The effects of hydraulic retention time (HRT) reduction at constant high organic loading rate on the activity of hydrogen-producing bacteria and methanogens were investigated in reactors digesting thin stillage. Stable isotope fingerprinting was additionally applied to assess methanogenic pathways. Based on hydA gene transcripts, Clostridiales was the most active hydrogen-producing order in continuous stirred tank reactor (CSTR), fixed-bed reactor (FBR) and anaerobic sequencing batch reactor (ASBR), but shorter HRT stimulated the activity of Spirochaetales. Further decreasing HRT diminished Spirochaetales activity in systems with biomass retention. Based on mcrA gene transcripts, Methanoculleus and Methanosarcina were the predominantly active in CSTR and ASBR, whereas Methanosaeta and Methanospirillum activity was more significant in stably performing FBR. Isotope values indicated the predominance of aceticlastic pathway in FBR. Interestingly, an increased activity of Methanosaeta was observed during shortening HRT in CSTR and ASBR despite high organic acids concentrations, what was supported by stable isotope data. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Schink, B.; Lupton, F.S.; Zeikus, J.G.
1983-01-01
An isotopic tracer assay based on the hydrogenase-dependent formation of tritiated water from tritium gas was developed for in life analysis of microbial hydrogen transformation. This method allowed detection of bacterial hydrogen metabolism in pure cultures or in natural samples obtained from aquatic ecosystems. A differentiation between chemical-biological and aerobic-anaerobic hydrogen metabolism was established by variation of the experimental incubation temperature or by addition of selective inhibitors. Hydrogenase activity was shown to be proportional to the consumption or production of hydrogen by cultures of Desulfovibrio vulgaris, Clostridium pasteurianum, and Methanosarcina barkeri. This method was applied, in connection with measurements of free hydrogen and most-probable-number enumerations, in aerobic natural source waters to establish the activity and document the ecology of hydrogen-consuming bacteria in extreme acid, thermal, or saline environments. The utility of the assay is based in part on the ability to quantify bacterial hydrogen transformation at natural hydrogen partial pressures, without the use of artificial electron acceptors
Zhang, Jingxin; Zhang, Yaobin; Quan, Xie; Chen, Shuo
2015-03-01
In this study, an acidogenic reactor packed with a pair of Fe-carbon electrodes (R1) was developed to enhance anaerobic acidogenesis of organic wastewater at short hydraulic retention times. The results indicated that the acidogenic efficiency was improved by settling a bio-electrochemical system. When hydraulic retention times decreased from 12 to 3h, R1 showed 18.9% more chemical oxygen demand removal and 13.8% more acidification efficiency. After cutting off the voltage of R1, the COD removal decreased by about 5%. Coupling of Fe(2+) leaching and electric field accelerated the hydrolysis of polysaccharide, relieving its accumulation in the sludge phase. Several acidophilic methanogenic Archaea such as Methanosarcina sp. were enriched in R1, which was favorable for consuming organic acids and preventing excessive pH decline. Thus, the developed acidogenic reactor with Fe-carbon electrodes is expected to be potentially effective and useful for wastewater treatment. Copyright © 2014 Elsevier Ltd. All rights reserved.
Palatsi, J; Viñas, M; Guivernau, M; Fernandez, B; Flotats, X
2011-02-01
Fresh pig/cattle slaughterhouse waste mixtures, with different lipid-protein ratios, were characterized and their anaerobic biodegradability assessed in batch tests. The resultant methane potentials were high (270-300 L(CH4) kg(-1)(COD)) making them interesting substrates for the anaerobic digestion process. However, when increasing substrate concentrations in consecutive batch tests, up to 15 g(COD) kg(-1), a clear inhibitory process was monitored. Despite the reported severe inhibition, related to lipid content, the system was able to recover activity and successfully degrade the substrate. Furthermore, 16SrRNA gene-based DGGE results showed an enrichment of specialized microbial populations, such as β-oxidizing/proteolitic bacteria (Syntrophomonas sp., Coprothermobacter sp. and Anaerobaculum sp.), and syntrophic methanogens (Methanosarcina sp.). Consequently, the lipid concentration of substrate and the structure of the microbial community are the main limiting factors for a successful anaerobic treatment of fresh slaughterhouse waste. Copyright © 2010 Elsevier Ltd. All rights reserved.
Anaerobic Transformation of Furfural by Methanococcus deltae (Delta)LH
Belay, N.; Boopathy, R.; Voskuilen, G.
1997-01-01
Methanococcus deltae (Delta)LH was grown on H(inf2)-CO(inf2) in the presence of various concentrations of furfural. Furfural at higher concentrations, namely, 20 and 25 mM, inhibited growth of this organism. At concentration of 5 and 10 mM, no inhibition of growth was observed. The other methanogens in this study were not inhibited by 10 mM furfural. Among the methanogens tested, M. deltae was capable of transforming furfural, whereas Methanobacterium thermoautotrophicum Marburg, Methanosarcina barkeri 227, Methanococcus thermolithotrophicus, and Methanobrevibacter ruminantium lacked this capability. One hundred percent removal of furfural was observed within 48 h of incubation in M. deltae cultures. The end product observed during furfural metabolism was furfuryl alcohol. An almost stoichiometric amount of furfuryl alcohol was produced by M. deltae. This transformation is likely to be of value in the detoxification of furfural and in its ultimate conversion to methane and CO(inf2) by anaerobic digestion. PMID:16535618
Ye, Jie; Hu, Andong; Ren, Guoping; Zhou, Ting; Zhang, Guangming; Zhou, Shungui
2018-01-01
The role of red mud in the improvement of methanogenesis during sludge anaerobic digestion was innovatively investigated in this study. The results demonstrated that the addition of 20g/L red mud resulted in a 35.5% increase in methane accumulation. Red mud effectively promoted the hydrolysis-acidification of organic compounds in the sludge, which resulted in the increase of protein, polysaccharide, and VFAs by 5.1-94.5%. The activities of key enzymes were improved by 41.4-257.3%. Electrochemical measurements presented direct evidence that the electrical conductivity was significantly improved with red mud. More conductive magnetite was formed during the secondary mineralization after Fe(III) reduction by Fe (III)-reducing genes such as Clostridiaceae and Ruminococcaceae. The higher conductivity enhanced the electron transfer between the syntrophic bacteria (Geobacteraceae) and methanogens (Methanosaeta and Methanosarcina), and then improved the methanogenesis. This research provides a novel perspective on the synergism between sludge and red mud for methane production. Copyright © 2017 Elsevier Ltd. All rights reserved.
Razaviarani, Vahid; Buchanan, Ian D
2014-11-01
Linkage between reactor performance and microbial community dynamics was investigated during mesophilic anaerobic co-digestion of restaurant grease waste (GTW) with municipal wastewater sludge (MWS) using 10L completely mixed reactors and a 20day SRT. Test reactors received a mixture of GTW and MWS while control reactors received only MWS. Addition of GTW to the test reactors enhanced the biogas production and methane yield by up to 65% and 120%, respectively. Pyrosequencing revealed that Methanosaeta and Methanomicrobium were the dominant acetoclastic and hydrogenotrophic methanogen genera, respectively, during stable reactor operation. The number of Methanosarcina and Methanomicrobium sequences increased and that of Methanosaeta declined when the proportion of GTW in the feed was increased to cause an overload condition. Under this overload condition, the pH, alkalinity and methane production decreased and VFA concentrations increased dramatically. Candidatus cloacamonas, affiliated within phylum Spirochaetes, were the dominant bacterial genus at all reactor loadings. Copyright © 2014 Elsevier Ltd. All rights reserved.
Global Carbon Cycle of the Precambrian Earth
DEFF Research Database (Denmark)
Wiewióra, Justyna
The carbon isotopic composition of distinct Archaean geological records provides information about the global carbon cycle and emergence of life on early Earth. We utilized carbon isotopic records of Greenlandic carbonatites, diamonds, graphites, marbles, metacarbonates and ultramafic rocks...... in the surface environment and recycled back into the mantle In the third manuscript we investigate the carbon cycle components, which have maintained the carbon isotope composition of the mantle constant through time. Assuming constant organic ratio of the total carbon burial (f), we show that increased.......1‰) and metacarbonate ( -6.1 ± 0.1‰ to +1.5 ± 0.0‰) rocks from the ~3.8 Ga Isua Supracrustal Belt as resulting from the Rayleigh distillation process, which affected the ultramafic reservoir with initial δ13C between -2‰ and 0‰. Due to its high primary δ13C signature, carbon in the Isuan magnesite was most likely...
International Nuclear Information System (INIS)
Maibam, Bidyananda; Gerdes, Axel; Srinivasan, R.; Goswami, J.N.
2017-01-01
A study of U-Pb and Lu-Hf-Yb isotope data in zircons from metamorphosed psammopelite and quartzite from the type area of Archaean Sargur Group, Dharwar Craton, India is carried out. Two age populations are observed: an older population with concordant U-Pb ages between 2.7 and 2.8 Ga, and a younger population with ages in the 2.4 - 2.6 Ga age range. The εHf values of 0 to + 2.0 for the older zircon population suggest that they were derived from juvenile crust formed at 2.7- 2.8 Ga. Sub-chondritic εHf values for the younger population indicate metamorphism and/or crustal reworking at ∼2.5 Ga. Meta-sedimentary enclaves in the Sargur type area are therefore part of the gneiss-supracrustal complex of different antiquities and may not have an independent stratigraphic status. (author)
Brazil Geologic Basic Survey Program - Limoeiro - Sheet SB.25-Y-C-V -Pernambuco State
International Nuclear Information System (INIS)
Barbosa, A.G.
1991-01-01
The Limoeiro map-sheet (SB.25-Y-C-V;1:100,000 scale), State of Pernambuco is delimited by the meridians 35 0 00'W to 35 0 30' W and parallels 7 0 30' S to 8 0 00' S. The sheet covers an area of about 3,000 km 2 . The basement rocks probable Archaean age consist of gneiss and migmatite. The basement rocks are overlain by Lower Proterozoic metasediments (schist and para gneiss), locally with flows (amphibolite), metamorphosed in the middle to high amphibolite facies. Geochemical surveys including stream sediment sampling and rock chip sampling were carried out. Ground geophysics included magnetometer, gravity and radiometric (scintillometer) surveys. A provisional metallogenetic map at 1:100,000 scale was prepared on which areas with potential for economic deposits of gold, apatite, barium copper, nickel, cobalt, zinc, niobium, iron, titanium and vanadium are shown. (author)
Carbonatite magmatism in northeast India
Kumar, D.; Mamallan, R.; Dwivedy, K. K.
The Shillong Plateau of northeast India is identified as an alkaline province in view of the development of several carbonatite complexes e.g. the Sung Valley (Jaintia Hills), Jasra (Karbi-Anglong), Samchampi and Barpung (Mikir Hills) and lamprophyre dyke swarms (Swangkre, Garo-Khasi Hills). On the basis of limited KAr data, magmatic activity appears to have taken place over a protracted period, ranging from the Late Jurassic to the Early Cretaceous. The carbonatite complexes of the Shillong Plateau share several common traits: they are emplaced along rift zones, either within Archaean gneisses or Proterozoic metasediments and granites, and exhibit enrichment in the light rare-earth elements, U, Th, Nb, Zr, Ti, K and Na. The enrichment in incompatible trace elements can best be accounted for if the parental magmas were of alkali basaltic type (e.g. mela-nephelinite or carbonate-rich alkali picrite).
International Nuclear Information System (INIS)
Robb, L.J.; Barton, J.M. Jr.; Kable, E.J.D.; Wallace, R.C.
1984-01-01
The Kaap Valley pluton consists predominantly of a homogeneous weakly foliated, hornblende-bearing tonalite. It is among the oldest granitoid bodies yet recognized in the environs of the Barberton greenstone belt, yielding 207 Pb/ 206 Pb mineral ages of about 3300 Ma and a Rb-Sr whole rock isochron age of about 3500 Ma. The Kaap Valley pluton is distinctive in many respects. Whereas all other gneiss plutons in the area are characterized by a trondhjemitic bulk composition with mafic mineralogies dominated by biotite, the Kaap Valley pluton is tonalitic in bulk composition with hornblende (plus minus minor biotite) as its major mafic phase. In this paper, the results of a detailed geological, geochemical and Pb-isotopic study of the Kaap Valley pluton are presented. Questions relating to the origin of the body are considered, with an emphasis on the formation of a tonalitic magma which is more mafic than those typically encountered in the region. Although exposure does not permit a detailed structural study of the gneiss pluton consideration is given to its mode of emplacement
Granites petrology, structure, geological setting, and metallogeny
Nédélec, Anne; Bowden, Peter
2015-01-01
Granites are emblematic rocks developed from a magma that crystallized in the Earth’s crust. They ultimately outcrop at the surface worldwide. This book, translated and updated from the original French edition Pétrologie des Granites (2011) is a modern presentation of granitic rocks from magma genesis to their crystallization at a higher level into the crust. Segregation from the source, magma ascent and shapes of granitic intrusions are also discussed, as well as the eventual formation of hybrid rocks by mingling/mixing processes and the thermomechanical aspects in country rocks around granite plutons. Modern techniques for structural studies of granites are detailed extensively. Granites are considered in their geological spatial and temporal frame, in relation with plate tectonics and Earth history from the Archaean eon. A chapter on granite metallogeny explains how elements of economic interest are concentrated during magma crystallization, and examples of Sn, Cu, F and U ore deposits are presented. Mi...
International Nuclear Information System (INIS)
Gibson, I.L.; Roberts, R.G.; Reading, D.J.R.
1984-01-01
The ankerite, gold ore bodies of the Dome Mine, Timmins, Ontario are interflow units, 1 to 3 m thick in a sequence of tholeiitic basalts. The units consist of discontinuous layers of ferroan dolomite, chert and pyroclastic material, and laminations of iron sulfides, tourmaline, and graphite. They have been interpreted as sediments on the basis of their internal structure. Seven Rare Earth elements (REE) (Ce, Nd, Sm, Eu, Gd, Tb, Tm, Yb) were determined by instrumental neutron activation analysis, on 10 samples of carbonate material from the ankerite units. The chondrite normalized REE plots have relatively flat patterns with, in some cases, positive Europium anomalies. The flat patterns suggest that the fluids from which the carbonate precipitated was in equilibrium with volcanic rocks of tholeiitic and komatiitic composition. The positive Europium anomalies imply that the fluids were reducing at times. Such patterns are characteristic of Archaean sediments and also the precipitates associated with the discharge of hydrothermal solutions from vents on the East Pacific Rise
Landscape inheritance: Report of Working Group Number 2
Twidale, C. R.
1985-01-01
The conventional wisdom is, or until recently has been, that the earth's scenery is essentially youthful, much of it being of pleistocene age. The validity of this assertion was questioned, surfaces and forms of much greater antiquity being cited from several cratonic regions, and also from the older orogens. Exhumed forms, some of them of great age (one inselberg landscape of Archaean age was noted), are more common and extensive than has previously been supposed. Epigene forms of Mesozoic ate are increasingly being demonstrated from the world's cratons and orogens. Etch features also are more widely eveloped than has been realized. It was recommended that studies of denudation chronology be undertaken, possible in relation to contrasted cratonic regions. The nature and age range of surfaces that make up the shields ought to be analysed, the processes responsible for shaping the surfaces, and, in the case of the ancien epigene forms, the reasons for their survival.
Maas, Roland; Kinny, Peter D.; Williams, Ian S.; Froude, Derek O.; Compston, William
1992-03-01
Trace element characteristics were analyzed and inclusions were identified within a suite of pre-3.9 Ga detritral zircons from western Australia representing the earth's oldest-known minerals. A diversity of trace-element compositions was found, particularly in the REE compositions of the old Mt. Narryer zircons, implying a variety of source-rock compositions and hence, the presence of a differentiated crust in the earth 4.15-4.20 Ga ago. Comparisons drawn with data obtained from younger detrital zircons occurring within the same deposits indicate nothing unique about the chemical compositions of the old grains. A number of interelement covariations were observed among the analyzed grains which were independent of age and isotopic characteristics, most notably that occurring between Lu and Hf. A general positive correlation between total LREE and the U + Th contents is also apparent. The findings indicate an origin in felsic igneous rocks, which has implications for early-Archaean crustal evolution.
Chromium isotope fractionation during coprecipitation with calcium carbonate
DEFF Research Database (Denmark)
Rodler, Alexandra; Sánchez-Pastor, Nuria; Fernández-Díaz, Lurdes
The chromium (Cr) isotopic composition of carbonates can potentially be used as a paleoclimate proxy to elucidate past fluctuations of oxygen contents in atmosphere and hydrosphere. The use of Cr isotopes to track paleoenvironmental changes, for example related to the rise of oxygen during the Ar...... et al., 2007, Water Air Soil Poll. 179, 381-390. [2] Sánchez-Pastor et al., 2011, Cryst. Growth Des. 11, 3081-3089.......The chromium (Cr) isotopic composition of carbonates can potentially be used as a paleoclimate proxy to elucidate past fluctuations of oxygen contents in atmosphere and hydrosphere. The use of Cr isotopes to track paleoenvironmental changes, for example related to the rise of oxygen during...... the Archaean and Protoerozoic, needs careful assessment of the signal robustness and necessitates a thorough understanding of the Cr cycle in Earth system processes. We conducted experiments testing the incorporation and isotopic fractionation of chromate into the calcite lattice. Our experiments indicate...
Carbonatite ring-complexes explained by caldera-style volcanism.
Andersson, Magnus; Malehmir, Alireza; Troll, Valentin R; Dehghannejad, Mahdieh; Juhlin, Christopher; Ask, Maria
2013-01-01
Carbonatites are rare, carbonate-rich magmatic rocks that make up a minute portion of the crust only, yet they are of great relevance for our understanding of crustal and mantle processes. Although they occur in all continents and from Archaean to present, the deeper plumbing system of carbonatite ring-complexes is usually poorly constrained. Here, we show that carbonatite ring-complexes can be explained by caldera-style volcanism. Our geophysical investigation of the Alnö carbonatite ring-complex in central Sweden identifies a solidified saucer-shaped magma chamber at ~3 km depth that links to surface exposures through a ring fault system. Caldera subsidence during final stages of activity caused carbonatite eruptions north of the main complex, providing the crucial element to connect plutonic and eruptive features of carbonatite magmatism. The way carbonatite magmas are stored, transported and erupt at the surface is thus comparable to known emplacement styles from silicic calderas.
The stratigraphy of the Steep Rock Group, N.W. Ontario, with evidence of a major unconformity
Wilks, M. E.; Nisbet, E. G.
1986-01-01
The Steep Rock Group is exposed 6 km north of Atikokan, 200 km west of Thunder Bay. It is situated on the southern margin of the Wabigoon Belt of the Archaean Superior Province, N. W. Ontario. Reinvestigation of the geology of the Group has shown that the Group lies unconformably on the Tonalite Complex to the east. This unconformity has been previously suspected, from regional and ine mapping but no conclusive outcrop evidence for its existence has as yet been published. The strike of the group, comprised of Basal Conglomerate, Carbonate Member, Ore Zone and Ashrock is generally north-northwest dipping steeply to the southwest. Of the 7 contacts between the Steep Rock Group and the Tonalite Complex, 3 expose the unconformity (The Headland, S. Roberts Pit, Trueman Point), and 4 are faulted. These three outcrops demonstrate unequivocally that the Steep Rock group was laid down unconformably on the underlying Tonalite Complex, which is circa 3 Ga old.
Characterization of Halophilic Bacterial Communities in Turda Salt Mine (Romania)
Carpa, Rahela; Keul, Anca; Muntean, Vasile; Dobrotă, Cristina
2014-09-01
Halophilic organisms are having adaptations to extreme salinity, the majority of them being Archaean, which have the ability to grow at extremely high salt concentrations, (from 3 % to 35 %). Level of salinity causes natural fluctuations in the halophilic populations that inhabit this particular habitat, raising problems in maintaining homeostasis of the osmotic pressure. Samples such as salt and water taken from Turda Salt Mine were analyzed in order to identify the eco-physiological bacterial groups. Considering the number of bacteria of each eco-physiological group, the bacterial indicators of salt quality (BISQ) were calculated and studied for each sample. The phosphatase, catalase and dehydrogenases enzymatic activities were quantitatively determined and the enzymatic indicators of salt quality (EISQ) were calculated. Bacterial isolates were analyzed using 16S rRNA gene sequence analysis. Universal bacterial primers, targeting the consensus region of the bacterial 16S rRNA gene were used. Analysis of a large fragment, of 1499 bp was performed to improve discrimination at the species level.
Detrital U-Pb zircon analysis of an Eocene McMurdo Erratic sandstone, McMurdo Sound, Antarctica
International Nuclear Information System (INIS)
Paulsen, T.; Encarnacion, J.; Valencia, V.A.; Roti Roti, J.M.; Rasoazanamparany, C.
2011-01-01
Some of the most important Cenozoic sedimentary rocks in Antarctica are glacial erratics of fossiliferous Palaeogene to Neogene siliclastic rocks known as the McMurdo Erratics. Detrital zircon U-Pb isotopic data reported herein provide new information on the provenance of these siliciclastic rocks. The U-Pb age data from a sandstone glacial erratic that is likely of Eocene age show a dominant age cluster that ranges from 488 to 635 Ma, accompanied by subsidiary Neoproterozoic-Archaean peaks. The dominant Neoproterozoic-Ordovician age cluster, in conjunction with the arkosic lithologies of some erratics and the local presence of granitic and metasedimentary clasts, indicates that the Neoproterozoic-Ordovician basement complex of the Transantarctic Mountains likely served as a major source for the Eocene siliciclastic sediments. This is consistent with derivation of the McMurdo Erratics from locations proximal to the Transantarctic Mountains such as the Discovery Deep and/or major mountain outlet glacier areas. (author). 19 refs., 3 figs., 1 tab.
On the valency state of radiogenic lead in zircon and its consequences
DEFF Research Database (Denmark)
Kramers, J.; Frei, Robert; Newville, M.
2009-01-01
nucleus comes to rest. Further, a zircon grain, being small, should remain highly oxidizing in its interior by the constant loss of ß-particles, maintaining the 4+ state of radiogenic Pb. From its effective ion radius, similar to that of Zr4+, and its charge, Pb4+ has to be compatible in the zircon...... not resemble that of PbO2. The arguments why radiogenic Pb should be tetravalent are based on analogies with studies relating to the tetravalent state of 234Th and the hexavalent state of 234U, which show that a-recoil in silicates generates a strongly oxidizing environment at the site where the recoiling......-recoil damaged sites could be leached out by any electrolyte solution that reduces it to the divalent state, making it both incompatible and soluble. Thus, discordia can be generated in weathering. The curious observation that discordant Archaean zircon suites generally define trends to lower intercepts at up...
Niu, Qigui; Qiao, Wei; Qiang, Hong; Li, Yu-You
2013-10-01
The thermophilic methane fermentation of chicken manure (10% TS) was investigated within a wide range of ammonia. Microbiological analysis showed significant shifts in Archaeal and Bacterial proportions with VFA accmulation and CH4 formation before and after inhibition. VFA accumulated sharply with lower methane production, 0.29 L/g VS, than during the steady stage, 0.32 L/g VS. Biogas production almost ceased with the synergy inhibition of TAN (8000 mg/L) and VFA (25,000 mg/L). Hydrogenotrophic Methanothermobacter thermautotrophicus str. was the dominate archaea with 95% in the inhibition stage and 100% after 40 days recovery compared to 9.3% in the steady stage. Aceticlastic Methanosarcina was not encountered with coincided phenomenal of high VFA in the inhibition stage as well as recovery stage. Evaluation of the microbial diversity and functional bacteria indicated the dominate phylum of Firmicutes were 94.74% and 84.4% with and without inhibition. The microbial community shifted significantly with elevated ammonia concentration affecting the performance. Copyright © 2013 Elsevier Ltd. All rights reserved.
Tauber, T; Berta, Brigitta; Székely, Anna J; Gyarmati, I; Kékesi, Katalin; Márialigeti, K; Tóth, Erika M
2007-03-01
The aim of the present work was to compare the microbial communities of a mesophilic and a thermophilic pilot scale anaerobe sludge digester. For studying the communities cultivation independent chemotaxonomical methods (RQ and PLFA analyses) and T-RFLP were applied. Microbial communities of the mesophilic and thermophilic pilot digesters showed considerable differences, both concerning the species present, and their abundance. A Methanosarcina sp. dominated the thermophilic, while a Methanosaeta sp. the mesophilic digester among Archaea. Species diversity of Bacteria was reduced in the thermophilic digester. Based on the quinone patterns in both digesters the dominance of sulphate reducing respiratory bacteria could be detected. The PLFA profiles of the digester communities were similar though in minor components characteristic differences were shown. Level of branched chain fatty acids is slightly lower in the thermophilic digester that reports less Gram positive bacteria. The relative ratio of fatty acids characteristic to Enterobacteriaceae, Bacteroidetes and Clostridia shows differences between the two digesters: their importance generally decreased under thermophilic conditions. The sulphate reducer marker (15:1 and 17:1) fatty acids are present in low quantity in both digesters.
Directory of Open Access Journals (Sweden)
Andreas eKlingl
2014-11-01
Full Text Available The common idea of typical cell wall architecture in archaea consists of a pseudo-crystalline proteinaceous surface layer (S-layer, situated upon the cytoplasmic membrane. This is true for the majority of described archaea, hitherto. Within the crenarchaea, the S-layer often represents the only cell wall component, but there are various exceptions from this wall architecture. Beside (glycosylated S-layers in (hyperthermophilic cren- and euryarchaea as well as halophilic archaea, one can find a great variety of other cell wall structures like proteoglycan-like S-layers (Halobacteria, glutaminylglycan (Natronococci, methanochondroitin (Methanosarcina or double layered cell walls with pseudomurein (Methanothermus and Methanopyrus. The presence of an outermost cellular membrane in the crenarchaeal species Ignicoccus hospitalis already gave indications for an outer membrane similar to Gram-negative bacteria. Although there is just limited data concerning their biochemistry and ultrastructure, recent studies on the euryarchaeal methanogen Methanomassiliicoccus luminyensis, cells of the ARMAN group, and the SM1 euryarchaeon delivered further examples for this exceptional cell envelope type consisting of two membranes.
Ramos, Débora Toledo; da Silva, Márcio Luís Busi; Nossa, Carlos Wolfgang; Alvarez, Pedro J J; Corseuil, Henry Xavier
2014-09-01
A controlled field experiment was conducted to assess the potential for fermentative-methanogenic biostimulation (by ammonium-acetate injection) to enhance biodegradation of benzene, toluene, ethylbenzene and xylenes (BTEX) as well as polycyclic aromatic hydrocarbons (PAHs) in groundwater contaminated with biodiesel B20 (20:80 v/v soybean biodiesel and diesel). Changes in microbial community structure were assessed by pyrosequencing 16S rRNA analyses. BTEX and PAH removal began 0.7 year following the release, concomitantly with the increase in the relative abundance of Desulfitobacterium and Geobacter spp. (from 5 to 52.7 % and 15.8 to 37.3 % of total Bacteria 16S rRNA, respectively), which are known to anaerobically degrade hydrocarbons. The accumulation of anaerobic metabolites acetate and hydrogen that could hinder the thermodynamic feasibility of BTEX and PAH biotransformations under fermentative/methanogenic conditions was apparently alleviated by the growing predominance of Methanosarcina. This suggests the importance of microbial population shifts that enrich microorganisms capable of interacting syntrophically to enhance the feasibility of fermentative-methanogenic bioremediation of biodiesel blend releases.
Microbial ecology of anaerobic digesters: the key players of anaerobiosis.
Ali Shah, Fayyaz; Mahmood, Qaisar; Maroof Shah, Mohammad; Pervez, Arshid; Ahmad Asad, Saeed
2014-01-01
Anaerobic digestion is the method of wastes treatment aimed at a reduction of their hazardous effects on the biosphere. The mutualistic behavior of various anaerobic microorganisms results in the decomposition of complex organic substances into simple, chemically stabilized compounds, mainly methane and CO2. The conversions of complex organic compounds to CH4 and CO2 are possible due to the cooperation of four different groups of microorganisms, that is, fermentative, syntrophic, acetogenic, and methanogenic bacteria. Microbes adopt various pathways to evade from the unfavorable conditions in the anaerobic digester like competition between sulfate reducing bacteria (SRB) and methane forming bacteria for the same substrate. Methanosarcina are able to use both acetoclastic and hydrogenotrophic pathways for methane production. This review highlights the cellulosic microorganisms, structure of cellulose, inoculum to substrate ratio, and source of inoculum and its effect on methanogenesis. The molecular techniques such as DGGE (denaturing gradient gel electrophoresis) utilized for dynamic changes in microbial communities and FISH (fluorescent in situ hybridization) that deal with taxonomy and interaction and distribution of tropic groups used are also discussed.
Habe, Hiroshi; Kobuna, Akinori; Hosoda, Akifumi; Kouzuma, Atsushi; Yamane, Hisakazu; Nojiri, Hideaki; Omori, Toshio; Watanabe, Kazuya
2008-05-01
Subtractive hybridization (SH) and random arbitrarily primed PCR (RAP-PCR) were used to detect genes involved in anaerobic benzoate degradation by Desulfotignum balticum. Through SH, we obtained 121 DNA sequences specific for D. balticum but not for D. phosphitoxidans (a non-benzoate-assimilating species). Furthermore, RAP-PCR analysis showed that a 651-bp DNA fragment, having 55% homology with the solute-binding protein of the ABC transporter system in Methanosarcina barkeri, was expressed when D. balticum was grown on benzoate, but not on pyruvate. By shotgun sequencing of the fosmid clone (38,071 bp) containing the DNA fragment, 33 open reading frames (ORFs) and two incomplete ORFs were annotated, and several genes within this region corresponded to the DNA fragments obtained by SH. An 11.3-kb gene cluster (ORF10-17) revealed through reverse transcription-PCR showed homology with the ABC transporter system and TonB-dependent receptors, both of which are presumably involved in the uptake of siderophore/heme/vitamin B(12), and was expressed in response to growth on benzoate.
Kim, Jaai; Yu, Youngseob; Lee, Changsoo
2013-09-01
Low-temperature thermo-alkaline pretreatment of waste activated sludge (WAS) was studied, within the region of 0-0.2 M NaOH and 60-90°C, for the effects of NaOH concentration and temperature on sludge degradability in anaerobic digestion (AD). Significant disintegration of sludge solids (up to 75.6%) and an increase in methane production (up to 70.6%) were observed in the pretreatment trials. Two quadratic models were successfully generated by response surface analysis (R(2)>0.9, pdisintegration (SD) and methane production (MP) respond to changes in the pretreatment conditions. The maximum responses of SD (77.8%) and MP (73.9% increase over the control) were shown at [0.16 M NaOH, 90°C] and [0.10 M NaOH, 73.7°C], respectively. NaOH addition showed a significant influence on the evolution of methanogen community structure during AD, whereas temperature did not. Aceticlastic Methanosaeta and Methanosarcina speceies were likely the major methanogens. Copyright © 2013 Elsevier Ltd. All rights reserved.
Yu, Hongguang; Wang, Zhiwei; Wu, Zhichao; Zhu, Chaowei
2016-02-01
Anaerobic digestion (AD) plays an important role in waste activated sludge (WAS) treatment; however, conventional AD (CAD) process needs substantial improvements, especially for the treatment of WAS with low solids content and poor anaerobic biodegradability. Herein, we propose a submerged anaerobic dynamic membrane bioreactor (AnDMBR) for simultaneous WAS thickening and digestion without any pretreatment. During the long-term operation, the AnDMBR exhibited an enhanced sludge reduction and improved methane production over CAD process. Moreover, the biogas generated in the AnDMBR contained higher methane content than CAD process. Stable carbon isotopic signatures elucidated the occurrence of combined methanogenic pathways in the AnDMBR process, in which hydrogenotrophic methanogenic pathway made a larger contribution to the total methane production. It was also found that organic matter degradation was enhanced in the AnDMBR, thus providing more favorable substrates for microorganisms. Pyrosequencing revealed that Proteobacteria and Bacteroidetes were abundant in bacterial communities and Methanosarcina and Methanosaeta in archaeal communities, which played an important role in the AnDMBR system. This study shed light on the enhanced digestion of WAS using AnDMBR technology.
Microbial Ecology of Anaerobic Digesters: The Key Players of Anaerobiosis
Ali Shah, Fayyaz; Mahmood, Qaisar; Maroof Shah, Mohammad; Pervez, Arshid; Ahmad Asad, Saeed
2014-01-01
Anaerobic digestion is the method of wastes treatment aimed at a reduction of their hazardous effects on the biosphere. The mutualistic behavior of various anaerobic microorganisms results in the decomposition of complex organic substances into simple, chemically stabilized compounds, mainly methane and CO2. The conversions of complex organic compounds to CH4 and CO2 are possible due to the cooperation of four different groups of microorganisms, that is, fermentative, syntrophic, acetogenic, and methanogenic bacteria. Microbes adopt various pathways to evade from the unfavorable conditions in the anaerobic digester like competition between sulfate reducing bacteria (SRB) and methane forming bacteria for the same substrate. Methanosarcina are able to use both acetoclastic and hydrogenotrophic pathways for methane production. This review highlights the cellulosic microorganisms, structure of cellulose, inoculum to substrate ratio, and source of inoculum and its effect on methanogenesis. The molecular techniques such as DGGE (denaturing gradient gel electrophoresis) utilized for dynamic changes in microbial communities and FISH (fluorescent in situ hybridization) that deal with taxonomy and interaction and distribution of tropic groups used are also discussed. PMID:24701142
Capson-Tojo, Gabriel; Trably, Eric; Rouez, Maxime; Crest, Marion; Steyer, Jean-Philippe; Delgenès, Jean-Philippe; Escudié, Renaud
2017-06-01
The increasing food waste production calls for developing efficient technologies for its treatment. Anaerobic processes provide an effective waste valorization. The influence of the initial substrate load on the performance of batch dry anaerobic co-digestion reactors treating food waste and cardboard was investigated. The load was varied by modifying the substrate to inoculum ratio (S/X), the total solids content and the co-digestion proportions. The results showed that the S/X was a crucial parameter. Within the tested values (0.25, 1 and 4gVS·gVS -1 ), only the reactors working at 0.25 produced methane. Methanosarcina was the main archaea, indicating its importance for efficient methanogenesis. Acidogenic fermentation was predominant at higher S/X, producing hydrogen and other metabolites. Higher substrate conversions (≤48%) and hydrogen yields (≤62mL·gVS -1 ) were achieved at low loads. This study suggests that different value-added compounds can be produced in dry conditions, with the initial substrate load as easy-to-control operational parameter. Copyright © 2017 Elsevier Ltd. All rights reserved.
Yan, Li; Ye, Jie; Zhang, Panyue; Xu, Dong; Wu, Yan; Liu, Jianbo; Zhang, Haibo; Fang, Wei; Wang, Bei; Zeng, Guangming
2018-07-01
High sulfur content in excess sludge impacts the production of biomethane during anaerobic digestion, meanwhile leads to hydrogen sulfide (H 2 S) formation in biogas. Effect of initial sludge pH on H 2 S formation during batch mesophilic anaerobic digestion of slaughterhouse wastewater sludge was studied in this paper. The results demonstrated that when the initial sludge pH increased from 6.5 to 8.0, the biogas production increased by 10.1%, the methane production increased by 64.1%, while the H 2 S content in biogas decreased by 44.7%. The higher initial sludge pH inhibited the competition of sulfate-reducing bacteria with methane-producing bacteria, and thus benefitted the growth of methanogens. Positive correlation was found between the relative abundance of Desulfomicrobium and H 2 S production, as well as the relative abundance of Methanosarcina and methane production. More sulfates and organic sulfur were transferred to solid and liquid rather than H 2 S formation at a high initial pH. Copyright © 2018 Elsevier Ltd. All rights reserved.
Zeppilli, Marco; Villano, Marianna; Aulenta, Federico; Lampis, Silvia; Vallini, Giovanni; Majone, Mauro
2015-05-01
A methane-producing microbial electrolysis cell (MEC) was continuously fed at the anode with a synthetic solution of soluble organic compounds simulating the composition of the soluble fraction of a municipal wastewater. The MEC performance was assessed at different anode potentials in terms of chemical oxygen demand (COD) removal efficiency, methane production, and energy efficiency. As a main result, about 72-80% of the removed substrate was converted into current at the anode, and about 84-86% of the current was converted into methane at the cathode. Moreover, even though both COD removed and methane production slightly decreased as the applied anode potential decreased, the energy efficiency (i.e., the energy recovered as methane with respect to the energy input into the system) increased from 54 to 63%. Denaturing gradient gel electrophoresis (DGGE) analyses revealed a high diversity in the anodic bacterial community with the presence of both fermentative (Proteiniphilum acetatigenes and Petrimonas sulphurifila) and aerobic (Rhodococcus qingshengii) microorganisms, whereas only two microorganisms (Methanobrevibacter arboriphilus and Methanosarcina mazei), both assignable to methanogens, were observed in the cathodic community.
Directory of Open Access Journals (Sweden)
Drasko Boko
2010-01-01
Full Text Available Methanogenic archaea possess unusual seryl-tRNA synthetases (SerRS, evolutionarily distinct from the SerRSs found in other archaea, eucaryotes and bacteria. Our recent X-ray structural analysis of Methanosarcina barkeri SerRS revealed an idiosyncratic N-terminal domain and catalytic zinc ion in the active site. To shed further light on substrate discrimination by methanogenic-type SerRS, we set up to explore in vivo the interaction of methanogenic-type SerRSs with their cognate tRNAs in Escherichia coli or Saccharomyces cerevisiae. The expression of various methanogenic-type SerRSs was toxic for E. coli, resulting in the synthesis of erroneous proteins, as revealed by β-galactosidase stability assay. Although SerRSs from methanogenic archaea recognize tRNAsSer from all three domains of life in vitro, the toxicity presumably precluded the complementation of endogenous SerRS function in both, E. coli and S. cerevisiae. However, despite the observed toxicity, coexpression of methanogenic-type SerRS with its cognate tRNA suppressed bacterial amber mutation.
Tian, Zhe; Zhang, Yu; Li, Yuyou; Chi, Yongzhi; Yang, Min
2015-02-01
The purpose of this study was to explore how fast the thermophilic anaerobic microbial community could be established during the one-step startup of thermophilic anaerobic digestion from a mesophilic digester. Stable thermophilic anaerobic digestion was achieved within 20 days from a mesophilic digester treating sewage sludge by adopting the one-step startup strategy. The succession of archaeal and bacterial populations over a period of 60 days after the temperature increment was followed by using 454-pyrosequencing and quantitative PCR. After the increase of temperature, thermophilic methanogenic community was established within 11 days, which was characterized by the fast colonization of Methanosarcina thermophila and two hydrogenotrophic methanogens (Methanothermobacter spp. and Methanoculleus spp.). At the same time, the bacterial community was dominated by Fervidobacterium, whose relative abundance rapidly increased from 0 to 28.52 % in 18 days, followed by other potential thermophilic genera, such as Clostridium, Coprothermobacter, Anaerobaculum and EM3. The above result demonstrated that the one-step startup strategy could allow the rapid establishment of the thermophilic anaerobic microbial community. Copyright © 2014 Elsevier Ltd. All rights reserved.
Cardinali-Rezende, Juliana; Colturato, Luís F D B; Colturato, Thiago D B; Chartone-Souza, Edmar; Nascimento, Andréa M A; Sanz, José L
2012-09-01
The prokaryotic diversity of an anaerobic reactor for the treatment of municipal solid waste was investigated over the course of 2 years with the use of 16S rDNA-targeted molecular approaches. The fermentative Bacteroidetes and Firmicutes predominated, and Proteobacteria, Actinobacteria, Tenericutes and the candidate division WWE1 were also identified. Methane production was dominated by the hydrogenotrophic Methanomicrobiales (Methanoculleus sp.) and their syntrophic association with acetate-utilizing and propionate-oxidizing bacteria. qPCR demonstrated the predominance of the hydrogenotrophic over aceticlastic Methanosarcinaceae (Methanosarcina sp. and Methanimicrococcus sp.), and Methanosaetaceae (Methanosaeta sp.) were measured in low numbers in the reactor. According to the FISH and CARD-FISH analyses, Bacteria and Archaea accounted for 85% and 15% of the cells, respectively. Different cell counts for these domains were obtained by qPCR versus FISH analyses. The use of several molecular tools increases our knowledge of the prokaryotic community dynamics from start-up to steady-state conditions in a full-scale MSW reactor. Copyright © 2012 Elsevier Ltd. All rights reserved.
Zhang, Junya; Lv, Chen; Tong, Juan; Liu, Jianwei; Liu, Jibao; Yu, Dawei; Wang, Yawei; Chen, Meixue; Wei, Yuansong
2016-01-01
The effects of microwave pretreatment (MW) on co-digestion of food waste (FW) and sewage sludge (SS) have never been investigated. In this study, a series of mesophilic biochemical methane potential (BMP) tests were conducted to determine the optimized ratio of FW and SS based on MW, and the evolution of bacterial and archaeal community was investigated through high-throughput sequencing method. Results showed that the optimized ratio was 3:2 for co-digestion of FW and SS based on MW, and the methane production was 316.24 and 338.44mLCH4/gVSadded for MW-FW and MW-SS, respectively. The MW-SS was superior for methane production compared to MW-FW, in which accumulation of propionic acid led to the inhibition of methanogenesis. Proteiniborus and Parabacteroides were responsible for proteins and polysaccharides degradation for all, respectively, while Bacteroides only dominated in co-digestion. Methanosphaera dominated in MW-FW at the active methane production phase, while it was Methanosarcina in MW-SS and mono-SS. Copyright © 2015 Elsevier Ltd. All rights reserved.
Emerson, D.; Rentz, J. A.; Moyer, C. L.
2005-12-01
The Loihi Seamount, located 30 km SE of the island of Hawai'i, is among the most active volcanos on Earth. The summit, at a depth of 1100m, includes a 250m deep caldera (Pele's Pit) formed by an eruption in 1996. The summit, and especially Pele's Pit, are the site of extensive low to intermediate temperature (10° to 65°C) hydrothermal venting, emanating both from diffuse fissures and orifices that have substantial flow rates. The vent fluid is characterized by a low sulfide content, high CO2 concentrations and Fe(II) amounts in the 10s to 100s of μM. Associated with all vents are extensive deposits of iron oxyhydroxides that typically have 107 to 108 bacterial cells/cc associated with them. The morphology of the Fe-oxides are indicative of biological origins. We have isolated microaerophilic, obligately lithotrophic Fe-oxidizing bacteria from Loihi and describe here `Mariprofundus ferroxydans' a unique bacterium that forms a filamentous iron oxide mineral. `M. ferroxydans' is the first cultured representative of a novel division of the Proteobacteria, known previously only from clones from different hydrothermal vent sites. Molecular evidence from Loihi mats based on clone libraries and terminal restriction length polymorphism (T-RFLP) analysis of 16S rRNA genes indicate that this lineage of Fe-oxidizing organisms are common inhabitants at Loihi. We speculate that this organism and its relatives form the basis of an active microbial mat community that owe their existence to the inherent gradients of Fe(II) and O2 that exist at the Loihi vents. In a geological context this is interesting because the Loihi summit and caldera are in an O2-minima zone; O2 concentrations in the bulk seawater are around 0.5 mg/l. In effect, Loihi could serve as a proxy for the late Archaean and early Proterozoic periods when the Earth's atmosphere went from reducing to oxidizing, and it is speculated that abundant Fe(II) in the Earth's oceans served as a major sink for O2 production
Looking for Fossil Bacteria in Martian Materials
Westall, F.; Walsh, M. M.; Mckay, D. D.; Wentworth, S.; Gibson, E. K.; Steele, A.; Toporski, J.; Lindstrom, D.; Martinez, R.; Allen, C. C.
1999-01-01
The rationale for looking for prokaryote fossils in Martian materials is based on our present understanding of the environmental evolution of that planet in comparison to the history of the terrestrial environments and the development and evolution of life on Earth. On Earth we have clear, albeit indirect, evidence of life in 3.8 b.y.-old rocks from Greenland and the first morphological fossils in 3.3-3.5 b.y.-old cherts from South Africa and Australia. In comparison, Mars, being smaller, probably cooled down after initial aggregation faster than the Earth. Consequently, there could have been liquid water on its surface earlier than on Earth. With a similar exogenous and endogenous input of organics and life-sustaining nutrients as is proposed for the Earth, life could have arisen on that planet, possibly slightly earlier dm it did on Earth. Whereas on Earth liquid water has remained at the surface of the planet since about 4.4 b.y. (with some possible interregnums caused by planet-sterilising impacts before 3.8. b.y. and perhaps a number of periods of a totally frozen Earth, this was not the case with Mars. Although it is not known exactly when surficial water disappeared from the surface, there would have been sufficient time for life to have developed into something similar to the terrestrial prokaryote stage. However, given the earlier environmental deterioration, it is unlikely that it evolved into the eukaryote stage and even evolution of oxygenic photosynthesis may not have been reached. Thus, the impetus of research is on single celled life simnilar to prokaryotes. We are investigating a number of methods of trace element analysis with respect to the Early Archaean microbial fossils. Preliminary neutron activation analysis of carbonaceous layers in the Early Archaean cherts from South Africa and Australia shows some partitioning of elements such as As, Sb, Cr with an especial enrichment of lanthanides in a carbonaceous-rich banded iron sediment . More
Aulbach, S.; Woodland, A. B.; Vasilyev, P.; Galvez, M. E.; Viljoen, K. S.
2017-09-01
Reconstructing the redox state of the mantle is critical in discussing the evolution of atmospheric composition through time. Kimberlite-borne mantle eclogite xenoliths, commonly interpreted as representing former oceanic crust, may record the chemical and physical state of Archaean and Proterozoic convecting mantle sources that generated their magmatic protoliths. However, their message is generally obscured by a range of primary (igneous differentiation) and secondary processes (seawater alteration, metamorphism, metasomatism). Here, we report the Fe3+/ΣFe ratio and δ18 O in garnet from in a suite of well-characterised mantle eclogite and pyroxenite xenoliths hosted in the Lace kimberlite (Kaapvaal craton), which originated as ca. 3 Ga-old ocean floor. Fe3+/ΣFe in garnet (0.01 to 0.063, median 0.02; n = 16) shows a negative correlation with jadeite content in clinopyroxene, suggesting increased partitioning of Fe3+ into clinopyroxene in the presence of monovalent cations with which it can form coupled substitutions. Jadeite-corrected Fe3+/ΣFe in garnet shows a broad negative trend with Eu*, consistent with incompatible behaviour of Fe3+ during olivine-plagioclase accumulation in the protoliths. This trend is partially obscured by increasing Fe3+ partitioning into garnet along a conductive cratonic geotherm. In contrast, NMORB-normalised Nd/Yb - a proxy of partial melt loss from subducting oceanic crust (1) - shows no obvious correlation with Fe3+/ΣFe, nor does garnet δ18OVSMOW (5.14 to 6.21‰) point to significant seawater alteration. Median bulk-rock Fe3+/ΣFe is roughly estimated at 0.025. This observation agrees with V/Sc systematics, which collectively point to a reduced Archaean convecting mantle source to the igneous protoliths of these eclogites compared to the modern MORB source. Oxygen fugacites (fO2) relative to the fayalite-magnetite-quartz buffer (FMQ) range from Δlog fO2 = FMQ-1.3 to FMQ-4.6. At those reducing conditions, the solubility
Hart, R.; Hogan, L.
1985-01-01
Recent noble gas studies suggests the Earth's atmosphere outgassed from the Earth's upper mantle synchronous with sea floor spreading, ocean ridge hydrothermal activity and the formation of continents by partial melting in subduction zones. The evidence for formation of the atmosphere by outgassing of the mantle is the presence of radionuclides H3.-4, Ar-040 and 136 Xe-136 in the atmosphere that were produced from K-40, U and Th in the mantle. How these radionuclides were formed is reviewed.
International Nuclear Information System (INIS)
Pimentel, Marcio Martins; Jost, Hardy; Fuck, Reinhardt Adolfo; Junges, Sergio Luiz; Armstrong, Richard; Resende, Marcelo Goncalves
2000-01-01
The Santa Rita greenstone belt represents one of the supracrustal belts of the Archaen terranes of Goias, central Brazil. The stratigraphic sequence of this greenstone belt comprises a lower of komatities and basalts and an upper metasedimentary unit made of carbonaceous schits, chert, iron formation and marble, unconformably overlain by clastic metasedimentary rocks. Felsic metavolcanics occur at the interface between the metabasalts and the upper metasedimentary pile. U-Pb SHRIMP age for zircons from the felsic metavolcanics reveal that it is not part of the Archaean sequence, but represents the product of mesoproterozoic (1580 ± 12 Ma) magmatic event. Sm-Nd isotopic data (initial e CHUR values between -10.5 and -14.9) and T DM values of 3.0 and 3.2 Ga, within the range of the surrounding TTG terranes, indicate that the original felsic magmas were produced by re-melting of Archaen crust. The data demonstrate that the Goias greenstone belt contains infolded and imbricated proterozoic rocks, as previously suggested by Sm-Nd isotopic analyses of some of the upper detrital metasedimentary rocks. (author)
International Nuclear Information System (INIS)
Sarkar, G.; Paul, D.K.; Misra, V.P.; de Laeter, J.R.; Mc Naughton, N.J.
1990-01-01
Preliminary Pb-Pb and Rb-Sr geochronology of granitic and gneissic rocks from the Sukma area of the Bastar craton, Central India, provides important constraints on crustal evolution. Much of the craton is made up of felsic orthogneisses and younger granitic intrusives, compositionally ranging from tonalite to granite. Pb-Pb isotopic data suggest the presence of ca. 3.0 Ga old gneisses. Younger granitic intrusives have been dated at ca. 2.6 Ga which represents a widespread resetting and/or emplacement event. Comparison of the Pb-Pb and Rb-Sr whole rock ages suggests that the latter were more perturbed after the gneiss-forming or emplacement events. All rock suites show significant geological scatter of isotopic data probably because of sampling on a regional scale, and reflect multi-stage isotopic evolution in a complex terrain. The present isotopic data indicate the presence of Archaean rock in the Bastar craton and suggest temporal similarity with the oldest crustal rocks in the Singhbhum and Dharwar cratons. (author). 18 refs., 4 tabs., 8 figs
Rb-Sr geochronology from Sao Felix to Xingu: preliminary results
International Nuclear Information System (INIS)
Lafon, J.M.; Pereira, E.D.; Silva Barradas, J.A. da
1991-01-01
Rb-Sr systematics have been applied on rocks from the Sao Felix do Xingu region, in the southeastern part of the State of Para. An age of 2716 ± 34 Ma with IR of 0.70292 ± 0.00030 (MSWD = 1.54) and an age of 2677 ± 50 Ma with IR of 0.70161 ± 0.00022 (MSWD = 5.21) had been obtained for a granitic body and a tonalitic body respectively, both of them associated to the green stones belts that occur in this area. Gneisses from the Xingu complex gave an age of 2574 ± 57 Ma with an IR of 0.70416 ± 0.00054 (MSWD = 5.06). An age of 1653 ± 14 Ma with IR of 0.70823 ± 0.02361 (MSWD = 1.71) had been obtained for the Velho Guilherme granite that crosscut the granite-green stones terrains. Such geochronological data show the existence of a magmatic event between 2.72 Ga and 2.68 Ga and permit us to conclude on the archaean age of the green stones terrains. (author)
Energy Technology Data Exchange (ETDEWEB)
Pimentel, Marcio Martins; Jost, Hardy; Fuck, Reinhardt Adolfo; Junges, Sergio Luiz [Brasilia Univ., DF (Brazil). Inst. de Geociencias]. E-mail: marcio@unb.br; Armstrong, Richard [Australian National Univ., Canberra, ACT (Australia). Research School of Earth Sciences; Resende, Marcelo Goncalves [Universidade Catolica de Brasilia, DF (Brazil). Curso de Graduacao em Engenharia Ambiental
2000-03-01
The Santa Rita greenstone belt represents one of the supracrustal belts of the Archaen terranes of Goias, central Brazil. The stratigraphic sequence of this greenstone belt comprises a lower of komatities and basalts and an upper metasedimentary unit made of carbonaceous schits, chert, iron formation and marble, unconformably overlain by clastic metasedimentary rocks. Felsic metavolcanics occur at the interface between the metabasalts and the upper metasedimentary pile. U-Pb SHRIMP age for zircons from the felsic metavolcanics reveal that it is not part of the Archaean sequence, but represents the product of mesoproterozoic (1580 {+-} 12 Ma) magmatic event. Sm-Nd isotopic data (initial e{sub CHUR} values between -10.5 and -14.9) and T{sub DM} values of 3.0 and 3.2 Ga, within the range of the surrounding TTG terranes, indicate that the original felsic magmas were produced by re-melting of Archaen crust. The data demonstrate that the Goias greenstone belt contains infolded and imbricated proterozoic rocks, as previously suggested by Sm-Nd isotopic analyses of some of the upper detrital metasedimentary rocks. (author)
Yamada, Chihaya; Kato, Souichiro; Kimura, Satoshi; Ishii, Masaharu; Igarashi, Yasuo
2014-09-01
Three thermophilic methanogens (Methanothermobacter thermautotrophicus, Methanosaeta thermophila, and Methanosarcina thermophila) were investigated for their ability to reduce poorly crystalline Fe(III) oxides (ferrihydrite) and the inhibitory effects of ferrihydrite on their methanogenesis. This study demonstrated that Fe(II) generation from ferrihydrite occurs in the cultures of the three thermophilic methanogens only when H2 was supplied as the source of reducing equivalents, even in the cultures of Mst. thermophila that do not grow on and produce CH4 from H2/CO2. While supplementation of ferrihydrite resulted in complete inhibition or suppression of methanogenesis by the thermophilic methanogens, ferrihydrite reduction by the methanogens at least partially alleviates the inhibitory effects. Microscopic and crystallographic analyses on the ferrihydrite-reducing Msr. thermophila cultures exhibited generation of magnetite on its cell surfaces through partial reduction of ferrihydrite. These findings suggest that at least certain thermophilic methanogens have the ability to extracellularly transfer electrons to insoluble Fe(III) compounds, affecting their methanogenic activities, which would in turn have significant impacts on materials and energy cycles in thermophilic anoxic environments. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Barret, Maialen; Gagnon, Nathalie; Topp, Edward; Masse, Lucie; Massé, Daniel I; Talbot, Guylaine
2013-02-01
Greenhouse gas emissions represent a major environmental problem associated with the management of manure from the livestock industry. Methane is the primary GHG emitted during manure outdoor storage. In this paper, the variability of two swine and two dairy manure storage tanks was surveyed, in terms of physico-chemical and microbiological parameters. The impact of the inter-tank and spatio-temporal variations of these parameters on the methanogenic activity of manure was ascertained. A Partial Least Square regression was carried out, which demonstrated that physico-chemical as well as microbiological parameters had a major influence on the methanogenic activity. Among the 19 parameters included in the regression, the concentrations of VFAs had the strongest negative influence on the methane emission rate of manure, resulting from their well-known inhibitory effect. The relative abundance of two amplicons in archaeal fingerprints was found to positively influence the methanogenic activity, suggesting that Methanoculleus spp. and possibly Methanosarcina spp. are major contributors to methanogenesis in storage tanks. This work gave insights into the mechanisms, which drive methanogenesis in swine and dairy manure storage tanks. Crown Copyright © 2012. Published by Elsevier Ltd. All rights reserved.
Lu, Qin; Yi, Jing; Yang, Dianhai
2016-01-01
High-solid anaerobic digestion of sewage sludge achieves highly efficient volatile solid reduction, and production of volatile fatty acid (VFA) and methane compared with conventional low-solid anaerobic digestion. In this study, the potential mechanisms of the better performance in high-solid anaerobic digestion of sewage sludge were investigated by using 454 high-throughput pyrosequencing and real-time PCR to analyze the microbial characteristics in sewage sludge fermentation reactors. The results obtained by 454 high-throughput pyrosequencing revealed that the phyla Chloroflexi, Bacteroidetes, and Firmicutes were the dominant functional microorganisms in high-solid and low-solid anaerobic systems. Meanwhile, the real-time PCR assays showed that high-solid anaerobic digestion significantly increased the number of total bacteria, which enhanced the hydrolysis and acidification of sewage sludge. Further study indicated that the number of total archaea (dominated by Methanosarcina) in a high-solid anaerobic fermentation reactor was also higher than that in a low-solid reactor, resulting in higher VFA consumption and methane production. Hence, the increased key bacteria and methanogenic archaea involved in sewage sludge hydrolysis, acidification, and methanogenesis resulted in the better performance of high-solid anaerobic sewage sludge fermentation.
Secondary fermentation in the runen of a sheep given a diet based on molasses.
Rowe, J B; Loughnan, M L; Nolan, J V; Leng, R A
1979-03-01
1. The extent of conversion of acetate-carbon to carbon dioxide in the rumen of a 40 kg wether consuming 1 kg molasses/d was estimated using isotope-tracer-dilution techniques. 2. There was a high rate of conversion of acetate to CO2 (6.0 g C/d) in the rumen. There were high concentrations in the rumen of Methanosarcina approximately 6 x 10(9)/ml which represents a significant proportion of the rumen bacterial biomass. These organisms are usually found in mud and sludge and are capable of oxidizing acetate. 3. The most likely explanation of these results was that there was an extensive secondary or sludge-type fermentation occurring in the rumen which results in volatile fatty acids being converted to CO2 and methane. In similar studies with sheep given lucerne (Medicago sativa) diets, conversion of acetate-C to CO2 within the rumen was not evident. 4. It is suggested that a major effect of the presence of secondary fermentation processes in the rumen may be to reduce availability of energy nutrients to the animal, and to alter the ratio protein:energy in the absorbed nutrients.
Low pressure microenvironments: Methane production at 50 mbar and 100 mbar by methanogens
Mickol, Rebecca L.; Kral, Timothy A.
2018-04-01
Low pressure is often overlooked in terms of possible biocidal effects when considering a habitable environment on Mars. Few experiments have investigated the ability for microorganisms to actively grow under low pressure conditions, despite the atmosphere being a location on Earth where organisms could be exposed to these pressures. Three species of methanogens (Methanobacterium formicicum, Methanosarcina barkeri, Methanococcus maripaludis) were tested for their ability to actively grow (demonstrate an increase in methane production and optical density) within low-pressure microenvironments at 50 mbar or 100 mbar. M. formicicum was the only species to demonstrate both an increase in methane and an increase in optical density during the low-pressure exposure period for experiments conducted at 50 mbar and 100 mbar. In certain experiments, M. barkeri showed an increase in optical density during the low-pressure exposure period, likely due to the formation of multicellular aggregates, but minimal methane production (conditions. Results indicate that low pressure exposure may just be inhibitory during the exposure itself, and metabolism may resume following incubation under more ideal conditions. Further work is needed to address growth/survival under Mars surface pressures.
The helium flux from the continents and ubiquity of low-3He/4He recycled crust and lithosphere
Day, James M. D.; Barry, Peter H.; Hilton, David R.; Burgess, Ray; Pearson, D. Graham; Taylor, Lawrence A.
2015-03-01
New helium isotope and trace-element abundance data are reported for pyroxenites and eclogites from South Africa, Siberia, and the Beni Bousera Massif, Morocco that are widely interpreted to form from recycled oceanic crustal protoliths. The first He isotope data are also presented for Archaean peridotites from the Kaapvaal (South Africa), Slave (Canada), and Siberian cratons, along with recently emplaced off-craton peridotite xenoliths from Kilbourne Hole, San Carlos (USA) and Vitim (Siberia), to complement existing 3He/4He values obtained for continental and oceanic peridotites. Helium isotope compositions of peridotite xenoliths vary from 7.3 to 9.6 RA in recently (volcanics that contain a contribution from asthenospheric sources. Using the new He isotope data for cratonic peridotites and assuming that significant portions (>50%) of the Archaean and Proterozoic continental lithospheric mantle are stable and unaffected by melt or fluid infiltration on geological timescales (>0.1 Ga), and that U and Th contents vary between cratonic lithosphere and non-cratonic lithosphere, calculations yield a 3He flux of 0.25-2.2 atoms/s/cm2 for the continental lithospheric mantle. These estimates differ by a factor of ten from non-cratonic lithospheric mantle and are closer to the observed 3He flux from the continents (<1 atoms/s/cm2). Pyroxenites and eclogites from the continental regions are all characterized by 3He/4He (0.03-5.6 RA) less than the depleted upper mantle, and relatively high U and Th contents. Together with oceanic and continental lithospheric peridotites, these materials represent reservoirs with low time-integrated 3He/(U + Th) in the mantle. Pyroxenites and eclogites are also characterized by higher Fe/Mg, more radiogenic Os-Pb isotope compositions, and more variable δ18O values (∼3‰ to 7‰), compared with peridotitic mantle. These xenoliths are widely interpreted to be the metamorphic/metasomatic equivalents of recycled oceanic crustal protoliths. The
International Nuclear Information System (INIS)
Drury, S.A.
1978-01-01
Seventeen rocks from the Lewisian Gneiss of the Inner Hebrides of Scotland, which represent three distinct lithological types at granulite to greenschist facies of metamorphism show rare-earth element patterns which seem not to have been disturbed by their complex metamorphic history. Some indication of their origin can be obtained by simple geochemical models. (Auth.)
Sun, W.; Lin, L.; Wang, P.
2012-12-01
clone library analyses indicated that major RFs recovered from incubations with methyl-compounds at room temperature and 40 oC were represented by sequences affiliated with Methanococcoides spp., Methanosarcina spp., and Methanolobus spp. In particular, only Methanosarcina- and Methanococcoides-related members were detected at salinities greater than 1000 mM or at 40 oC. RFs recovered from incubations with H2/CO2 at room temperature and 40 oC were represented by sequences related to different Methanococcus spp. Overall, methanogens utilizing H2/CO2 and methyl-compounds appear to be capable of actively producing methane at salinities greater than acetate-utilizing methanogens could tolerate. These methanogens might adapt better to the fluctuation of salinity or extremely high salinity induced by the surface evaporation in terrestrial mud volcanoes. When considering the overall methane emission from terrestrial mud volcanoes, these halo-tolerant methanogens become a significant factor. Key words: mud volcano, Methane, Methanogenesis, Salinity
Ravindra Kumar, G. R.; Sreejith, C.
2016-10-01
The Kerala Khondalite Belt (KKB) of the southern India encompasses volumetrically significant magmatic components. Among these, orthopyroxene-bearing, felsic ortho-granulites, popularly known as charnockites in Indian context, constitute an important lithology. In contrast to the well-known phenomena of arrested charnockitization, the geochemical characteristics and petrogenesis of these ortho-granulite suites remain poorly studied, leaving geodynamic models envisaged for the KKB highly conjectural. In this paper, we try to bridge this gap with detailed results on orthopyroxene-bearing, felsic ortho-granulites spread over the entire KKB and propose a new petrogenetic and crustal evolution model. Based on geochemical characteristics, the orthopyroxene-bearing, felsic ortho-granulites (charnockites sensu lato) of KKB are classified into (1) tonalitic (TC), (2) granitic (GC), and (3) augen (AC) suites. Members of the TC follow sodic (characterized by decreasing CaO/Na2O), whereas those of the GC and AC follow calc-alkaline trends of differentiation. Geochemical patterns of the TC resemble those of the Archaean tonalite-trondhjemite-granodiorite (TTG) suites, with slightly magnesian character (average Mg# = 33), moderate LREE (average LaN = 154), low HREE (average YbN = 6) and Y (1-53 ppm; average 11 ppm). The TC is also characterized by positive to slightly negative europium anomalies (Eu/Eu* = 0.7 to 1.67). The GC and AC suites, on the other hand, resemble post-Archaean arc-related granites. The GC displays ferroan nature (average Mg# = 22), low to moderate degrees of REE fractionation (average [La/Yb]N = 34.84), high contents of Y (5-128 ppm; average 68), and low Sr/Y (1-98) ratios. Significant negative Eu anomalies (Eu/Eu* = 0.18-0.91; average 0.50) and low Sr (65-690 ppm) are also noted in the GC. Similar chemical characteristics are shown by the AC, with ferroan nature (average Mg# = 21), low to moderate degrees of REE fractionation (average [La/Yb]N = 26), high
Glikson, Andrew; Vickers, John
2006-01-01
Creek Group-GCG [R. M. Hill, Stratigraphy, structure and alteration of hanging wall sedimentary rocks at the Sulphur Springs volcanogenic massive sulphide (VMS) prospect, east Pilbara Craton, Western Australia. B.Sc Hon. Thesis, University of Western Australia (1997) 67 pp.; M.J. Van Kranendonk, A.H. Hickman, R.H. Smithies, D.R. Nelson, Geology and tectonic evolution of the Archaean north Pilbara terrain, Pilbara Craton, Western Australia, Econ. Geol. 97 (2002) 695-732; M.J. Van Kranendonk, Geology of the North Shaw 1 : 100 000 Sheet. Geological Survey Western Australia 1 : 100 000 Geological Series (2000) 86 pp., R. Buick, C.A.W. Brauhart, P. Morant, J.R. Thornett, J.G. Maniew, J.G. Archibald, M.G. Doepel, I.R. Fletcher, A.L. Pickard, J.B. Smith, M.B. Barley, N.J. McNaughton, D.I. Groves, Geochronology and stratigraphic relations of the Sulphur Springs Group and Strelley Granite: a temporally distinct igneous province in the Archaean Pilbara Craton, Australia, Precambrian Res. 114 (2002) 87-120]). The structure and scale of the olistostrome, not seen elsewhere in the Pilbara Craton, is interpreted in terms of intense faulting and rifting, supported by topographic relief represented by deep incision of overlying arenites (Corboy Formation) into underlying units [M.J. Van Kranendonk, Geology of the North Shaw 1 : 100 000 Sheet. Geological Survey Western Australia 1 : 100 000 Geological Series (2000) 86 pp.]. The age overlaps between (1) 3.255 ± 4-3.235 ± 3 Ga peak igneous activity represented by the SSG and the Cleland plutonic suite (Pilbara Craton) and the 3.258 ± 3 Ga S2 Barberton impact unit, and (2) 3.235 ± 3 Ga top SSG break and associated faulting and the 3.243 ± 4 S3-S4 Barberton impact units may not be accidental. Should correlations between the Barberton S2-S4 impact units and magmatic and tectonic events in the Pilbara Craton be confirmed, they would imply impact-triggered reactivation of mantle convection, crustal anatexis, faulting and strong vertical
Earth's early O2 cycle suppressed by primitive continents
Smit, Matthijs A.; Mezger, Klaus
2017-10-01
Free oxygen began to accumulate in Earth's surface environments between 3.0 and 2.4 billion years ago. Links between oxygenation and changes in the composition of continental crust during this time are suspected, but have been difficult to demonstrate. Here we constrain the average composition of the exposed continental crust since 3.7 billion years ago by compiling records of the Cr/U ratio of terrigenous sediments. The resulting record is consistent with a predominantly mafic crust prior to 3.0 billion years ago, followed by a 500- to 700-million-year transition to a crust of modern andesitic composition. Olivine and other Mg-rich minerals in the mafic Archaean crust formed serpentine minerals upon hydration, continuously releasing O2-scavenging agents such as dihydrogen, hydrogen sulfide and methane to the environment. Temporally, the decline in mafic crust capable of such process coincides with the first accumulation of O2 in the oceans, and subsequently the atmosphere. We therefore suggest that Earth's early O2 cycle was ultimately limited by the composition of the exposed upper crust, and remained underdeveloped until modern andesitic continents emerged.
Prebiotic organic microstructures.
Bassez, Marie-Paule; Takano, Yoshinori; Kobayashi, Kensei
2012-08-01
Micro- and sub-micrometer spheres, tubules and fiber-filament soft structures have been synthesized in our experiments conducted with 3 MeV proton irradiations of a mixture of simple inorganic constituents, CO, N(2) and H(2)O. We analysed the irradiation products, with scanning electron microscopy (SEM) and atomic force microscopy (AFM). These laboratory organic structures produced a wide variety of proteinaceous and non-proteinaceous amino acids after HCl hydrolysis. The enantiomer analysis for D,L-alanine confirmed that the amino acids were abiotically synthesized during the laboratory experiment. We discuss the presence of CO(2) and the production of H(2) during exothermic processes of serpentinization and consequently we discuss the production of hydrothermal CO in a ferromagnesian silicate mineral environment. We also discuss the low intensity of the Earth's magnetic field during the Paleoarchaean Era and consequently we conclude that excitation sources arising from cosmic radiation were much more abundant during this Era. We then show that our laboratory prebiotic microstructures might be synthesized during the Archaean Eon, as a product of the serpentinization process of the rocks and of their mineral contents.
Accretion mode of oceanic ridges governed by axial mechanical strength
Sibrant, A. L. R.; Mittelstaedt, E.; Davaille, A.; Pauchard, L.; Aubertin, A.; Auffray, L.; Pidoux, R.
2018-04-01
Oceanic spreading ridges exhibit structural changes as a function of spreading rate, mantle temperature and the balance of tectonic and magmatic accretion. The role that these or other processes have in governing the overall shape of oceanic ridges is unclear. Here, we use laboratory experiments to simulate ridge spreading in colloidal aqueous dispersions whose rheology evolves from purely viscous to elastic and brittle when placed in contact with a saline water solution. We find that ridge shape becomes increasingly linear with spreading rate until reaching a minimum tortuosity. This behaviour is predicted by the axial failure parameter ΠF, a dimensionless number describing the balance of brittle and plastic failure of axial lithosphere. Slow-spreading, fault-dominated and fast-spreading, fluid intrusion-dominated ridges on Earth and in the laboratory are separated by the same critical ΠF value, suggesting that the axial failure mode governs ridge geometry. Values of ΠF can also be calculated for different mantle temperatures and applied to other planets or the early Earth. For higher mantle temperatures during the Archaean, our results preclude the predicted formation of large tectonic plates at high spreading velocity.
Biliary Microbiota, Gallstone Disease and Infection with Opisthorchis felineus.
Directory of Open Access Journals (Sweden)
Irina V Saltykova
2016-07-01
Full Text Available There is increasing interest in the microbiome of the hepatobiliary system. This study investigated the influence of infection with the fish-borne liver fluke, Opisthorchis felineus on the biliary microbiome of residents of the Tomsk region of western Siberia.Samples of bile were provided by 56 study participants, half of who were infected with O. felineus, and all of who were diagnosed with gallstone disease. The microbiota of the bile was investigated using high throughput, Illumina-based sequencing targeting the prokaryotic 16S rRNA gene. About 2,797, discrete phylotypes of prokaryotes were detected. At the level of phylum, bile from participants with opisthorchiasis showed greater numbers of Synergistetes, Spirochaetes, Planctomycetes, TM7 and Verrucomicrobia. Numbers of > 20 phylotypes differed in bile of the O. felineus-infected compared to non-infected participants, including presence of species of the genera Mycoplana, Cellulosimicrobium, Microlunatus and Phycicoccus, and the Archaeans genus, Halogeometricum, and increased numbers of Selenomonas, Bacteroides, Rothia, Leptotrichia, Lactobacillus, Treponema and Klebsiella.Overall, infection with the liver fluke O. felineus modified the biliary microbiome, increasing abundance of bacterial and archaeal phylotypes.
International Nuclear Information System (INIS)
Ewers, G.R.; Ferguson, J.; Needham, R.S.; Donnelly, T.H.
1984-01-01
The Pine Creek Geosyncline comprises about 14 km of chronostratigraphic mainly pelitic and psammitic Early Proterozoic sediments with interlayered tuff units, resting on granitic late Archaean complexes exposed as small domes. Sedimentation took place in one basin, and most stratigraphic units are represented throughout the basin. The sediments were regionally deformed and metamorphosed at 1800 Ma. Tightly folded greenschist facies strata in the centre grade into isoclinally deformed amphibolite facies metamorphics in the west and northeast, granulites are present in the extreme northeast. Pre and post-orogenic continental tholeiites, and post-orogenic granite diapirs intrude the Early Proterozoic metasediments, and the granites are surrounded by hornfels zones up to 10 km wide in the greenschist facies terrane. Cover rocks of Carpentarian (Middle Proterozoic) and younger ages rest on all these rocks unconformably and conceal the original basin margins. The uranium deposits post-date the approx. 1800 Ma regional metamorphic event; isotopic dating of uraninite and galena in the ore bodies indicates ages of mineralisation at approx. 1600 Ma, approx. 900 Ma and approx. 500 Ma. The ore bodies are stratabound, located within breccia zones, are of a shallow depth, and occur immediately below the Early/Middle Proterozoic unconformity
Kopitz, Annette; Soppa, Jörg; Krejtschi, Carsten; Hauser, Karin
2009-09-01
The TATA box binding protein (TBP) is involved in promoter recognition, the first step of transcription initiation. TBP is universally conserved and essential in archaea and eukaryotes. In archaea, TBPs have to be stable and to function in species that cover an extremely wide range of optimal growth temperatures (OGTs), from below 0 °C to more than 100 °C. Thus, the archaeal TBP family is ideally suited to study the evolutionary adaptation of proteins to an extremely wide range of temperatures. We characterized the thermostability of one mesophilic and one thermophilic TBP by infrared spectroscopy. Transition temperatures ( Tms) of thermal unfolding have been determined using TBPs from Methanosarcina mazei (OGT 37 °C) and from Methanothermobacter thermautotrophicus (OGT 65 °C). Furthermore, the influence of protein and salt concentration on thermostability has been characterized. Together with previous studies, our results reveal that the Tms of archaeal TBPs are closely correlated with the OGTs of the respective species. Noteworthy, this is also true for the TBP from M. mazei representing the first characterized TBP from a mesophilic archaeon. In contrast, the only characterized eukaryotic TBP of the mesophilic plant Arabidopsis thaliana has a Tm more than 40 °C above the OGT.
Directory of Open Access Journals (Sweden)
Stefanie Berger
2012-01-01
Full Text Available The thermophilic methanogen Methanosaeta thermophila uses acetate as sole substrate for methanogenesis. It was proposed that the acetate activation reaction that is needed to feed acetate into the methanogenic pathway requires the hydrolysis of two ATP, whereas the acetate activation reaction in Methanosarcina sp. is known to require only one ATP. As these organisms live at the thermodynamic limit that sustains life, the acetate activation reaction in Mt. thermophila seems too costly and was thus reevaluated. It was found that of the putative acetate activation enzymes one gene encoding an AMP-forming acetyl-CoA synthetase was highly expressed. The corresponding enzyme was purified and characterized in detail. It catalyzed the ATP-dependent formation of acetyl-CoA, AMP, and pyrophosphate (PPi and was only moderately inhibited by PPi. The breakdown of PPi was performed by a soluble pyrophosphatase. This enzyme was also purified and characterized. The pyrophosphatase hydrolyzed the major part of PPi (KM=0.27±0.05 mM that was produced in the acetate activation reaction. Activity was not inhibited by nucleotides or PPi. However, it cannot be excluded that other PPi-dependent enzymes take advantage of the remaining PPi and contribute to the energy balance of the cell.
Directory of Open Access Journals (Sweden)
Anna Doloman
2017-01-01
Full Text Available Anaerobic digestion (AD is a microbiologically coordinated process with dynamic relationships between bacterial players. Current understanding of dynamic changes in the bacterial composition during the AD process is incomplete. The objective of this research was to assess changes in bacterial community composition that coordinates with anaerobic codigestion of microalgal biomass cultivated on municipal wastewater. An upflow anaerobic sludge blanket reactor was used to achieve high rates of microalgae decomposition and biogas production. Samples of the sludge were collected throughout AD and extracted DNA was subjected to next-generation sequencing using methanogen mcrA gene specific and universal bacterial primers. Analysis of the data revealed that samples taken at different stages of AD had varying bacterial composition. A group consisting of Bacteroidales, Pseudomonadales, and Enterobacteriales was identified to be putatively responsible for the hydrolysis of microalgal biomass. The methanogenesis phase was dominated by Methanosarcina mazei. Results of observed changes in the composition of microbial communities during AD can be used as a road map to stimulate key bacterial species identified at each phase of AD to increase yield of biogas and rate of substrate decomposition. This research demonstrates a successful exploitation of methane production from microalgae without any biomass pretreatment.
Identification of anaerobic microorganisms for converting kitchen waste to biogas
International Nuclear Information System (INIS)
Amirhossein Malakahmad; Shahrom Mohd Zain; Noor Ezlin Ahmad Basri; Shamsul Rahman Mohamed Kutty; Mohd Hasnain Isa
2010-01-01
Anaerobic digestion process is one of the alternative methods to convert organic waste into methane gas which is a fuel and energy source. Activities of various kinds of microorganisms are the main factor for anaerobic digestion which produces methane gas. Therefore, in this study a modified Anaerobic Baffled Reactor (ABR) with working volume of 50 liters was designed to identify the microorganisms through biogas production. The mixture of 75% kitchen waste and 25% sewage sludge was used as substrate. Observations on microorganisms in the ABR showed that there exists a small amount of protozoa (5%) and fungi (2%) in the system, but almost 93% of the microorganism population consists of bacteria. It is definitely clear that bacteria are responsible for anaerobic biodegradation of kitchen waste. Results show that in the acidification zone of the ABR (front compartments of reactor) fast growing bacteria capable of growth at high substrate levels and reduced pH was dominant. A shift to slower growing scavenging bacteria that grow better at higher pH was occurring towards the end of the reactor. Due to the ability of activity in acetate environment the percentages of Methanococcus, Methanosarcina and Methanotrix were higher than other kinds of methane former in the system. (Author)
Niu, Lihua; Zhang, Xue; Li, Yi; Wang, Peifang; Zhang, Wenlong; Wang, Chao; Wang, Qing
2017-07-01
Due to the important roles of archaea in wastewater treatment processes, archaeal communities have been studied extensively in various anaerobic reactors, but the knowledge of archaeal communities in full-scale activated sludge wastewater treatment plants (WWTPs) remains quite poor. In this study, 454-pyrosequencing was for the first time employed to investigate archaeal communities from 20 full-scale activated sludge WWTPs distributed at a 3,660-meter elevational scale in China. Results showed that archaeal communities from WWTPs were dominated by Methanosarcinales (84.6%). A core archaeal population (94.5%) composed of Methanosaeta, Methanosarcina, Methanogenium and Methanobrevibacter was shared among WWTPs. The elevational pattern of archaeal communities was observed in WWTPs, with an elevational threshold associated with archaeal community richness and structures at approximately 1,500 meters above sea level (masl). A declining trend in community richness with increasing elevation was observed at higher elevations, whereas no trend was presented at lower elevations. Spearman correlation analysis indicated that the archaeal community richness at higher elevations was associated with more environmental variables than that at lower elevations. Redundancy analysis indicated that wastewater variables were the dominant contributors to the variation of community structures at higher elevations, followed by operational variables and elevation.
Kobayashi, Tsutomu; Tang, Yueqin; Urakami, Toyoshi; Morimura, Shigeru; Kida, Kenji
2014-02-01
Sweet potato shochu is a traditional Japanese spirit produced mainly in the South Kyushu area in Japan. The amount of stillage reaches approximately 8 x 10(5) tons per year. Wastewater mainly containing stillage from the production of sweet potato-shochu was treated thermophilically in a full-scale treatment plant using fixed-bed reactors (8 reactors x 283 m3). Following the addition of Ni2+ and Co2+, the reactors have been stably operated for six years at a high chemical oxygen demand (COD) loading rate of 14 kg/(m3 x day). Analysis of coenzyme content and microbial communities indicated that similar microbial communities were present in the liquid phase and on the fiber carriers installed in reactors. Bacteria in the phyla Firmicutes as well as Bacteroidetes were dominant bacteria, and Methanosarcina thermophila as well as Methanothermobacter crinale were dominant methanogens in the reactors. This study reveals that stillage from sweet potato-shochu production can be treated effectively in a full-scale fixed-bed reactor under thermophilic conditions with the help of Ni2+ and Co2+. The high diversity of bacterial community and the coexistence of both aceticlastic and hydrogenotrophic methanogens contributed to the excellent fermentation performance.
Directory of Open Access Journals (Sweden)
Irina V. Khilyas
2017-01-01
Full Text Available Bioelectrochemical systems such as microbial fuel cells (MFCs are promising new technologies for efficient removal of organic compounds from industrial wastewaters, including that generated from swine farming. We inoculated two pairs of laboratory-scale MFCs with sludge granules from a beer wastewater-treating anaerobic digester (IGBS or from sludge taken from the bottom of a tank receiving swine wastewater (SS. The SS-inoculated MFC outperformed the IGBS-inoculated MFC with regard to COD and VFA removal and electricity production. Using a metagenomic approach, we describe the microbial diversity of the MFC planktonic and anodic communities derived from the different inocula. Proteobacteria (mostly Deltaproteobacteria became the predominant phylum in both MFC anodic communities with amplification of the electrogenic genus Geobacter being the most pronounced. Eight dominant and three minor species of Geobacter were found in both MFC anodic communities. The anodic communities of the SS-inoculated MFCs had a higher proportion of Clostridium and Bacteroides relative to those of the IGBS-inoculated MFCs, which were enriched with Pelobacter. The archaeal populations of the SS- and IGBS-inoculated MFCs were dominated by Methanosarcina barkeri and Methanothermobacter thermautotrophicus, respectively. Our results show a long-term influence of inoculum type on the performance and microbial community composition of swine wastewater-treating MFCs.
Mustapha, Nurul Asyifah; Sakai, Kenji; Shirai, Yoshihito; Maeda, Toshinari
2016-11-01
Anaerobic digestion is an effective method for reducing the by-product of waste-activated sludge (WAS) from wastewater treatment plants and for producing bioenergy from WAS. However, only a limited number of studies have attempted to improve anaerobic digestion by targeting the microbial interactions in WAS. In this study, we examined whether different antibiotics positively, negatively, or neutrally influence methane fermentation by evaluating changes in the microbial community and functions in WAS. Addition of azithromycin promoted the microbial communities related to the acidogenic and acetogenic stages, and a high concentration of soluble proteins and a high activity of methanogens were detected. Chloramphenicol inhibited methane production but did not affect the bacteria that contribute to the hydrolysis, acidogenesis, and acetogenesis digestion stages. The addition of kanamycin, which exhibits the same methane productivity as a control (antibiotic-free WAS), did not affect all of the microbial communities during anaerobic digestion. This study demonstrates the simultaneous functions and interactions of diverse bacteria and methanogenic Archaea in different stages of the anaerobic digestion of WAS. The ratio of Caldilinea, Methanosarcina, and Clostridium may correspond closely to the trend of methane production in each antibiotic. The changes in microbial activities and function by antibiotics facilitate a better understanding of bioenergy production.
Mickol, R. L.; Kral, T. A.
2017-12-01
The low pressure at the surface of Mars (average: 6 mbar) is one potentially biocidal factor that any extant life on the planet would need to endure. Near subsurface life, while shielded from ultraviolet radiation, would also be exposed to this low pressure environment, as the atmospheric gas-phase pressure increases very gradually with depth. Few studies have focused on low pressure as inhibitory to the growth or survival of organisms. However, recent work has uncovered a potential constraint to bacterial growth below 25 mbar. The study reported here tested the survivability of four methanogen species ( Methanothermobacter wolfeii, Methanosarcina barkeri, Methanobacterium formicicum, Methanococcus maripaludis) under low pressure conditions approaching average martian surface pressure (6 mbar - 143 mbar) in an aqueous environment. Each of the four species survived exposure of varying length (3 days - 21 days) at pressures down to 6 mbar. This research is an important stepping-stone to determining if methanogens can actively metabolize/grow under these low pressures. Additionally, the recently discovered recurring slope lineae suggest that liquid water columns may connect the surface to deeper levels in the subsurface. If that is the case, any organism being transported in the water column would encounter the changing pressures during the transport.
Doloman, Anna; Soboh, Yousef; Walters, Andrew J.; Sims, Ronald C.
2017-01-01
Anaerobic digestion (AD) is a microbiologically coordinated process with dynamic relationships between bacterial players. Current understanding of dynamic changes in the bacterial composition during the AD process is incomplete. The objective of this research was to assess changes in bacterial community composition that coordinates with anaerobic codigestion of microalgal biomass cultivated on municipal wastewater. An upflow anaerobic sludge blanket reactor was used to achieve high rates of microalgae decomposition and biogas production. Samples of the sludge were collected throughout AD and extracted DNA was subjected to next-generation sequencing using methanogen mcrA gene specific and universal bacterial primers. Analysis of the data revealed that samples taken at different stages of AD had varying bacterial composition. A group consisting of Bacteroidales, Pseudomonadales, and Enterobacteriales was identified to be putatively responsible for the hydrolysis of microalgal biomass. The methanogenesis phase was dominated by Methanosarcina mazei. Results of observed changes in the composition of microbial communities during AD can be used as a road map to stimulate key bacterial species identified at each phase of AD to increase yield of biogas and rate of substrate decomposition. This research demonstrates a successful exploitation of methane production from microalgae without any biomass pretreatment. PMID:29259629
Ike, Michihiko; Inoue, Daisuke; Miyano, Tomoki; Liu, Tong Tong; Sei, Kazunari; Soda, Satoshi; Kadoshin, Shiro
2010-06-01
The microbial community in a full-scale anaerobic digester (2300m3) treating industrial food waste in the Kyoto Eco-Energy Project was analyzed using terminal restriction fragment length polymorphism for eubacterial and archaeal 16S rRNA genes. Both thermophilic and mesophilic sludge of treated swine waste were seeded to the digestion tank. During the 150-day startup period, coffee grounds as a main food waste, along with potato, kelp and boiled beans, tofu, bean curd lees, and deep-fried bean curd were fed to the digestion process step-by-step (max. 40t/d). Finally, the methane yield reached 360m3/t-feed with 40days' retention time, although temporary accumulation of propionate was observed. Eubacterial communities that formed in the thermophilic digestion tank differed greatly from both thermophilic and mesophilic types of seed sludge. Results suggest that the Actinomyces/Thermomonospora and Ralstonia/Shewanella were contributors for hydrolyzation and degradation of food waste into volatile fatty acids. Acetate-utilizing methanogens, Methanosaeta, were dominant in seed sludges of both types, but they decreased drastically during processing in the digestion tank. Methanosarcina and Methanobrevibacter/Methanobacterium were, respectively, possible main contributors for methane production from acetate and H2 plus CO2. Copyright 2010 Elsevier Ltd. All rights reserved.
Mosbæk, Freya; Kjeldal, Henrik; Mulat, Daniel G; Albertsen, Mads; Ward, Alastair J; Feilberg, Anders; Nielsen, Jeppe L
2016-10-01
Inhibition of anaerobic digestion through accumulation of volatile fatty acids occasionally occurs as the result of unbalanced growth between acidogenic bacteria and methanogens. A fast recovery is a prerequisite for establishing an economical production of biogas. However, very little is known about the microorganisms facilitating this recovery. In this study, we investigated the organisms involved by a novel approach of mapping protein-stable isotope probing (protein-SIP) onto a binned metagenome. Under simulation of acetate accumulation conditions, formations of (13)C-labeled CO2 and CH4 were detected immediately following incubation with [U-(13)C]acetate, indicating high turnover rate of acetate. The identified (13)C-labeled peptides were mapped onto a binned metagenome for improved identification of the organisms involved. The results revealed that Methanosarcina and Methanoculleus were actively involved in acetate turnover, as were five subspecies of Clostridia. The acetate-consuming organisms affiliating with Clostridia all contained the FTFHS gene for formyltetrahydrofolate synthetase, a key enzyme for reductive acetogenesis, indicating that these organisms are possible syntrophic acetate-oxidizing (SAO) bacteria that can facilitate acetate consumption via SAO, coupled with hydrogenotrophic methanogenesis (SAO-HM). This study represents the first study applying protein-SIP for analysis of complex biogas samples, a promising method for identifying key microorganisms utilizing specific pathways.
Directory of Open Access Journals (Sweden)
Susan Anne Baldwin
2015-03-01
Full Text Available Sulfidogenic biochemical reactors for metal removal that use complex organic carbon have been shown to be effective in laboratory studies, but their performance in the field is highly variable. Successful operation depends on the types of microorganisms supported by the organic matrix, and factors affecting the community composition are unknown. A molecular survey of a field-based biochemical reactor that had been removing zinc and arsenic for over six years revealed that the microbial community was dominated by methanogens related to Methanocorpusculum sp. and Methanosarcina sp., which co-occurred with Bacteroidetes environmental groups, such as Vadin HA17, in places where the organic matter was more degraded. The metabolic potential for organic matter decomposition by Ruminococcaceae was prevalent in samples with more pyrolysable carbon. Rhodobium- and Hyphomicrobium-related genera within the Rhizobiales Order that have the metabolic potential for dark hydrogen fermentation and methylotrophy, and unclassified Comamonadaceae were the dominant Proteobacteria. The unclassified environmental group Sh765B-TzT-29 was an important Delta-Proteobacteria group in this BCR, that co-occurred with the dominant Rhizobiales OTUs. Organic matter degradation is one driver for shifting the microbial community composition and therefore possibly the performance of these bioreactors over time.
Energy Technology Data Exchange (ETDEWEB)
Saia, F.T.; Damianovic, M.H.R.Z.; Cattony, E.B.M.; Brucha, G.; Foresti, E. [Sao Paulo Univ., Sao Carlos (Brazil). Lab. of Biological Processes; Vazoller, R.F. [Sao Paulo Univ., Sao Paulo (Brazil). Lab. of Environmental Microbiology
2007-06-15
This paper discusses the results of pentachlorophenol (PCP) anaerobic biodegradation in a horizontal-flow anaerobic immobilized biomass (HAIB) reactor operated under methanogenic and halophylic conditions. The system was inoculated with autochthonous microorganisms taken from a site in the Santos-Sao Vicente Estuary (state of Sao Paulo, Brazil) severely contaminated with PCP, phenolic compounds, polychlorinated biphenyls, polycyclic aromatic hydrocarbons, and heavy metals. The inoculum was previously enriched for methanogenesis activity by changing glucose concentrations and under halophylic condition. PCP was added to the HAIB reactor as sodium salt (NaPCP) at an initial concentration of 5 mg l{sup -1} and increased to 13, 15, and 21 mg l{sup -1}. Organic matter removal efficiency ranged from 77 to 100%. PCP removal efficiency was 100%. Denaturing gradient gel electrophoresis profile showed changes in the structure of Bacteria domain, which was associated with NaPCP and glucose amendments. The diversity of Archaea remained unaltered during the different phases. Scanning electron microscope examinations showed that cells morphologically resembling Methanosarcina and Methanosaeta predominated in the biofilm. These cells were detected by fluorescence in situ hybridization with the Methanosarcinales (MSMX860) specific probe. The results are of great importance in planning the estuary's restoration by using anaerobic technology and autochthonous microorganisms for bioremediation. (orig.)
Mickol, R L; Kral, T A
2017-12-01
The low pressure at the surface of Mars (average: 6 mbar) is one potentially biocidal factor that any extant life on the planet would need to endure. Near subsurface life, while shielded from ultraviolet radiation, would also be exposed to this low pressure environment, as the atmospheric gas-phase pressure increases very gradually with depth. Few studies have focused on low pressure as inhibitory to the growth or survival of organisms. However, recent work has uncovered a potential constraint to bacterial growth below 25 mbar. The study reported here tested the survivability of four methanogen species (Methanothermobacter wolfeii, Methanosarcina barkeri, Methanobacterium formicicum, Methanococcus maripaludis) under low pressure conditions approaching average martian surface pressure (6 mbar - 143 mbar) in an aqueous environment. Each of the four species survived exposure of varying length (3 days - 21 days) at pressures down to 6 mbar. This research is an important stepping-stone to determining if methanogens can actively metabolize/grow under these low pressures. Additionally, the recently discovered recurring slope lineae suggest that liquid water columns may connect the surface to deeper levels in the subsurface. If that is the case, any organism being transported in the water column would encounter the changing pressures during the transport.
Valle, Edith R; Henderson, Gemma; Janssen, Peter H; Cox, Faith; Alexander, Trevor W; McAllister, Tim A
2015-06-01
In this study, methanogen-specific coenzyme F420 autofluorescence and confocal laser scanning microscopy were used to identify rumen methanogens and define their spatial distribution in free-living, biofilm-, and protozoa-associated microenvironments. Fluorescence in situ hybridization (FISH) with temperature-controlled hybridization was used in an attempt to describe methanogen diversity. A heat pretreatment (65 °C, 1 h) was found to be a noninvasive method to increase probe access to methanogen RNA targets. Despite efforts to optimize FISH, 16S rRNA methanogen-specific probes, including Arch915, bound to some cells that lacked F420, possibly identifying uncharacterized Methanomassiliicoccales or reflecting nonspecific binding to other members of the rumen bacterial community. A probe targeting RNA from the methanogenesis-specific methyl coenzyme M reductase (mcr) gene was shown to detect cultured Methanosarcina cells with signal intensities comparable to those of 16S rRNA probes. However, the probe failed to hybridize with the majority of F420-emitting rumen methanogens, possibly because of differences in cell wall permeability among methanogen species. Methanogens were shown to integrate into microbial biofilms and to exist as ecto- and endosymbionts with rumen protozoa. Characterizing rumen methanogens and defining their spatial distribution may provide insight into mitigation strategies for ruminal methanogenesis.
Mosbæk, Freya; Kjeldal, Henrik; Mulat, Daniel G; Albertsen, Mads; Ward, Alastair J; Feilberg, Anders; Nielsen, Jeppe L
2016-01-01
Inhibition of anaerobic digestion through accumulation of volatile fatty acids occasionally occurs as the result of unbalanced growth between acidogenic bacteria and methanogens. A fast recovery is a prerequisite for establishing an economical production of biogas. However, very little is known about the microorganisms facilitating this recovery. In this study, we investigated the organisms involved by a novel approach of mapping protein-stable isotope probing (protein-SIP) onto a binned metagenome. Under simulation of acetate accumulation conditions, formations of 13C-labeled CO2 and CH4 were detected immediately following incubation with [U-13C]acetate, indicating high turnover rate of acetate. The identified 13C-labeled peptides were mapped onto a binned metagenome for improved identification of the organisms involved. The results revealed that Methanosarcina and Methanoculleus were actively involved in acetate turnover, as were five subspecies of Clostridia. The acetate-consuming organisms affiliating with Clostridia all contained the FTFHS gene for formyltetrahydrofolate synthetase, a key enzyme for reductive acetogenesis, indicating that these organisms are possible syntrophic acetate-oxidizing (SAO) bacteria that can facilitate acetate consumption via SAO, coupled with hydrogenotrophic methanogenesis (SAO-HM). This study represents the first study applying protein-SIP for analysis of complex biogas samples, a promising method for identifying key microorganisms utilizing specific pathways. PMID:27128991
Dong, Jun; Ding, Linjie; Wang, Xu; Chi, Zifang; Lei, Jiansen
2015-03-01
Anaerobic methane oxidation (AMO) is considered to be an important sink of CH4 in habitats as marine sediments. But, few studies focused on AMO in landfills which may be an important sink of CH4 derived from waste fermentation. To show evidence of AMO and to uncover function anaerobic methanotroph (ANME) community in landfill, different age waste samples were collected in Jinqianpu landfill located in north China. Through high-throughput sequencing, Methanomicrobiales and Methanosarcinales archaea associated with ANME and reverse methanogenic archaea of Methanosarcina and Methanobacterium were detected. Sulfate-reducing bacteria (SRB) (Desulfobulbus and Desulfococcus) which could couple with ANME-conducting AMO were also found. But, the community structure of ANME had no significant difference with depths. From the results of investigation, we can come to a conclusion that sulfate-dependent anaerobic methane oxidation (SR-DAMO) would be the dominant AMO process in the landfill, while iron-dependent anaerobic methane oxidation (M/IR-DAMO) process was weak though concentration of ferric iron was large in the landfill. Denitrification-dependent anaerobic methane oxidation (NR-DAMO) was negative because of lack of nitrate and relevant function microorganisms in the landfill. Results also indicate that CH4 mitigation would have higher potential by increasing electron acceptor contents and promoting the growth of relevant function microorganisms.
Risatti, J.B.; Rowland, S.J.; Yon, D.A.; Maxwell, J.R.
1984-01-01
Abundant volatile lipids of Methanobacterium thermoautotrophicum and Methanosarcina barkeri include isoprenoid hydrocarbons (??? C30), and C15, C20 and C25 isoprenoid alcohols. M. barkeri contains 2,6,10,15,19-pentamethyleicosane, whose relative stereochemistry is the same as found in marine sediments, indicating that it is a marker of methanogenic activity. The C20, C30 and C25 alkenes in M. thermoautotrophicum also have a preferred sterochemistry; the latter have the 2,6,10,14,18-pentamethyleicosanyl skeleton, suggesting that the alkane in marine sediments may derive from methanogens. The stereochemistry of squalane in a marine sediment is also compatible with an origin in methanogens; in contrast, the stereochemistry of pristane in M. thermoautotrophicum indicates a fossil fuel contaminant origin, suggesting that this and certain other alkanes reported in archaebacteria might also be of contaminant origin. There is, therefore, little evidence at present that the pristane in immature marine sediments originates in methanogens. The C15 and C20 saturated alcohols in M. thermoautotrophicum have mainly the all-R configuration. If this is generally true for methanogens, the C20 alcohol in the Messel shale may originate mainly from methanogens, whereas that in the Green River shale may originate mainly from photosynthetic organisms. ?? 1984.
CSIR Research Space (South Africa)
Kgaswane, EM
2009-12-01
Full Text Available locations are shown with solid triangles, and event locations are shown with white circles. Most of the events are located outside of the area shown in the map. B12304 KGASWANE ET AL.: CRUSTAL STRUCTURE OF SOUTHERN AFRICA 6 of 19 B12304 velocity profiles... supergroup (white line) taken from van der Westhuizen et al. [2006] and the location of lower crust xenoliths obtained from Pretorius and Barton [2003] and Schmitz and Bowring [2003a]. The number labels 1–15 represent the names of the kimberlites: 1...
Barros, Valciney Gomes de; Duda, Rose Maria; Vantini, Juliana da Silva; Omori, Wellington Pine; Ferro, Maria Inês Tiraboschi; Oliveira, Roberto Alves de
2017-11-01
Biogas production from sugarcane vinasse has enormous economic, energy, and environmental management potential. However, methane production stability and biodigested vinasse quality remain key issues, requiring better nutrient and alkalinity availability, operational strategies, and knowledge of reactor microbiota. This study demonstrates increased methane production from vinasse through the use of sugarcane filter cake and improved effluent recirculation, with elevated organic loading rates (OLR) and good reactor stability. We used UASB reactors in a two-stage configuration, with OLRs up to 45gCODL -1 d -1 , and obtained methane production as high as 3LL -1 d -1 . Quantitative PCR indicated balanced amounts of bacteria and archaea in the sludge (10 9 -10 10 copiesg -1 VS), and of the predominant archaea orders, Methanobacteriales and Methanosarcinales (10 6 -10 8 copiesg -1 VS). 16S rDNA sequencing also indicated the thermophilic Thermotogae as the most abundant class of bacteria in the sludge. Copyright © 2017 Elsevier Ltd. All rights reserved.
Albaric, J.; Perrot, J.; Deschamps, A.; Deverchere, J.; Wambura, R. F.; Tiberi, C.; Petit, C.; Le Gall, B.; Sue, C.
2008-12-01
How a rift system propagates and breaks throughout a cold and thick continental crust remains poorly known. Only few places allow to address the question. In the East African Rift System (EARS), the eastern magma- rich branch abruptly splits into two amagmatic arms (the Eyasi and Manyara faulted systems), south of a E-W volcanic chain (the Ngorongoro-Kilimanjaro transverse volcanic belt), as crossing the Archaean Tanzanian craton margin. We present the first detailed seismotectonic picture of the Eyasi-Manyara rifts where a network of ~25 seismometers was settled from June to November 2007 (SEISMO-TANZ'07 seismological experiment). From the seismicity recorded by the network, we identify active faults and discuss the stress field framework obtained from the inversion of focal mechanisms. We use the determined depth of earthquakes (1) to discuss the crustal structure of the transition zone from a magma-rich to a magma-starved section of the EARS and (2) to further emphasize the rheological control on depth distributions in the EARS (Albaric et al., Tectonophysics, 2008). The stress and strain directions deduced from our work are also used to question recently published kinematics and conceptual models of the EARS (Calais et al., Geol. Soc. London, 2006 ; Le Gall et al., Tectonophysics, 2008).
Na-metasomatism in the uranium fields of Singhbhum Shear zone, India
International Nuclear Information System (INIS)
Chaki, Anjan
2013-01-01
Singhbhum Shear Zone (SSZ) of eastern India hosts uranium, copper and apatite-magnetite mineralization, which occurs either independently or overlaps in space. SSZ is a nearly 200 km long, 1-5 km wide, intensely techtonized, northward-convex, arcuate mobile belt that separates the Archaean cratonic nucleus to its south from the Proterozoic North Singhbhum Fold Belt on the north. Except Bagjata mines in the eastern sector, majority of the known uranium deposits and mines (e.g. Jaduguda, Bhatin, Narwapahar, Banduhurang and Mohuldih) are situated in the central sector of the shear zone. All the deposits are of low grade (0.05% U 3 O 8 ) and low to medium tonnage. The common rock types of the SSZ are quartz-chlorite schists, quartzsericite schists, quartzite, metaconglomerate, soda granite, quartz-albite bearing schists/gneisses, granophyres and tourmalinite. The mineralization occur as lenticular to tabular bodies, which are (pene-) concordant with dominant planer structures, i.e. foliation parallel with the lithological layering (S 3 II S 0 ). Principal uranium mineral is uraninite with low thorium (UO 2 /ThO 2 =70-150), high lead (PbO =14-15%) and moderate REE contents with minor pitchblende and some secondary minerals near the surface. Many ore minerals, particularly the sulfide phases of Ni, Co, Mo, Cu and Fe are common
Petrology and geochemistry of komatiites and tholeiites from Gorgona Island, Colombia
Aitken, Bruce G.; Echeverría, Lina M.
1984-04-01
Komatiitic rocks from Gorgona Island, Colombia, in contrast to their Archaean counterparts, occur as rather structureless flows. In addition, textural and mineralogical features indicate that the Gorgona komatiites may have crystallized from superheated liquids. Komatiitic rocks have MgO contents which range from 24 to 11 wt.% and plot on well-defined olivine (Fo90) control lines. Calculations show that potential evolved liquids (MgO<11 wt%) will be SiO2-poor. Komatiites, in this case, cannot be regarded as parental to the associated tholeiitic basalt sequence. On the basis of REE concentrations and Sr, Nd isotopic compositions, the associated basalts are found to be of two types. One type (K-tholeiite) is characterized by noticeably fractionated REE patterns and relatively primitive isotopic compositions similar to those of the komatiites. K-tholeiites, together with komatiites, are regarded as comprising a distinctive komatiitic suite. REE patterns within this suite show progressive depletion in the LREE from K-tholeiites to komatiites, and represent increasingly higher degrees of melting of the same mantle source region. The other type (T-tholeiite), representative of the bulk of the exposed basalt sequence, has flat REE patterns and relatively evolved isotopic compositions. This tholeiitic suite is clearly genetically unrelated to the komatiitic suite.
Brazil Geological Basic Survey Program - Ponte Nova - Sheet SF.23-X-B-II - Minas Gerais State
International Nuclear Information System (INIS)
Brandalise, L.A.
1991-01-01
The present report refers to the Ponte Nova Sheet (SF.23-X-B-II) systematic geological mapping, on the 1:100.000 scale. The Sheet covers the Zona da Mata region, Minas Gerais State, in the Mantiqueira Geotectonic Province, to the eastern part of Sao Francisco Geotectonic Province, as defined in the project. The high grade metamorphic rocks to low amphibolite, occurring in the area were affected by a marked low angle shearing transposition, and show diphtheritic effects. Archaean to Proterozoic ages are attributed to the metamorphites mostly by comparison to similar types of the region. Three deformed events were registered in the region. Analysis of the crustal evolution pattern based on geological mapping, laboratorial analyses, gravimetric and air magnetometry data, and available geochronologic data is given in the 6. Chapter, Part II, in the text. Major element oxides, trace-elements, and rare-earths elements were analysed to establish parameters for the rocks environment elucidation. Geochemical survey was carried out with base on pan concentrated and stream sediments distributed throughout the Sheet. Gneisses quarries (industrial rocks) in full exploration activity have been registered, as well as sand and clay deposits employed in construction industry. Metallogenetic/Provisional analysis points out the area as a favorable one for gold prospection. (author)
Prodigious degassing of a billion years of accumulated radiogenic helium at Yellowstone
Lowenstern, Jacob B.; Evans, William C.; Bergfeld, D.; Hunt, Andrew G.
2014-01-01
Helium is used as a critical tracer throughout the Earth sciences, where its relatively simple isotopic systematics is used to trace degassing from the mantle, to date groundwater and to time the rise of continents1. The hydrothermal system at Yellowstone National Park is famous for its high helium-3/helium-4 isotope ratio, commonly cited as evidence for a deep mantle source for the Yellowstone hotspot2. However, much of the helium emitted from this region is actually radiogenic helium-4 produced within the crust by α-decay of uranium and thorium. Here we show, by combining gas emission rates with chemistry and isotopic analyses, that crustal helium-4 emission rates from Yellowstone exceed (by orders of magnitude) any conceivable rate of generation within the crust. It seems that helium has accumulated for (at least) many hundreds of millions of years in Archaean (more than 2.5 billion years old) cratonic rocks beneath Yellowstone, only to be liberated over the past two million years by intense crustal metamorphism induced by the Yellowstone hotspot. Our results demonstrate the extremes in variability of crustal helium efflux on geologic timescales and imply crustal-scale open-system behaviour of helium in tectonically and magmatically active regions.
New SHRIMP U-Pb zircon ages of the metapelitic granulites from NW of Madurai, Southern India
International Nuclear Information System (INIS)
Prakash, D.
2010-01-01
Zircon cathodoluminescent imaging and SHRIMP U-Pb dating were carried out for metapelitic rocks (sapphirine-hearing granulites and garnet-cordierite gneisses) from the NW of Madurai, Southern India. The cathodoluminescence images reveal the complex, inhomogeneous internal structure having irregular-shaped core and overgrowths. Zircon grains have obliterated oscillatory zoning. SHRIMP U-Pb chronological results yield ages of 550 ± 15 Ma and 530 ± 50 Ma as a time of metamorphic overprint, and the age of 2509 ± 12 Ma and 2509 ± 30 Ma corresponding to a timing of protolith formation for sapphirine-bearing granulites and garnet-cordierite gneisses respectively. Zircon ages reflect that continental crust in the NW of Madurai region resulted from the recycling of Archaean protolith of an igneous origin similar to the preserved crust in the southern part of Dharwar craton. The present SHRIMP U-Pb zircon ages are in close agreement with earlier published Nd isotopic data which suggest an extended precrustal history of their protoliths. The abraded zircon grains indicate multiple recycling and repeated metamorphism that has ultimately resulted in present day continental crust exposed in Madurai region. These SHRIMP U-Pb zircon ages from metapelitic UHT granulites are also significant to understanding the architecture of the SGT during the amalgamation of Gondwana in Neoproterozoic time. (author)
Directory of Open Access Journals (Sweden)
Pekka Tuisku
2006-01-01
Full Text Available The Palaeoproterozoic Lapland granulite belt was juxtaposed between Archaean and Proterozoic terrains in the NE part of the Fennoscandian Shield concurrently with the accretion of Svecofennian arc complexes at ~1.9 Ga. The belt consists mainly of aluminous migmatiticmetagreywackes. Abundant noritic to enderbitic magmas were intruded concordantly into the metasediments and were probably an important heat source for metamorphism, which took place during the crystallization of the magmas. This is supported by structural and contact relations of metasediments and igneous rocks, and by the lack progressive metamorphic reaction textures in the igneous rock series. The peak of metamorphism took place above the dehydration melting temperature of the biotite-sillimanite-plagioclase-quartz assemblageat 750−850°C and 5−8.5 kbar which lead to formation of a restitic palaeosome and peraluminous granitic melt in metapelites. Subsequently, the rocks were decompressed and cooled below the wet melting temperature of pelitic rocks (650°C under the stability field of andalusite coexisting with potassium feldspar (2−3 kbar. Cooling was accompanied by the crystallization of the neosomes, often carrying aluminium-rich phases. Postmetamorphic duplexing of the LGB is clearly seen in the distribution of calculated PT conditions.
Stability of model membranes in extreme environments.
Namani, Trishool; Deamer, David W
2008-08-01
The first forms of cellular life required a source of amphiphilic compounds capable of assembling into stable boundary structures. Membranes composed of fatty acids have been proposed as model systems of primitive membranes, but their bilayer structure is stable only within a narrow pH range and low ionic strength. They are particularly sensitive to aggregating effects of divalent cations (Mg+2, Ca+2, Fe+2) that would be present in Archaean sea water. Here we report that mixtures of alkyl amines and fatty acids form vesicles at strongly basic and acidic pH ranges which are resistant to the effects of divalent cations up to 0.1 M. Vesicles formed by mixtures of decylamine and decanoic acid (1:1 mole ratio) are relatively permeable to pyranine, a fluorescent anionic dye, but permeability could be reduced by adding 2 mol% of a polycyclic aromatic hydrocarbon such as pyrene. Permeability to the dye was also reduced by increasing the chain length of the amphiphiles. For instance, 1:1 mole ratio mixtures of dodecylamine and dodecanoic acid were able to retain pyranine dye during and following gel filtration. We conclude that primitive cell membranes were likely to be composed of mixtures of amphiphilic and hydrophobic molecules that manifested increased stability over pure fatty acid membranes.
New SHRIMP zircon results from Broken Hill: towards robust stratigraphic and event timing
International Nuclear Information System (INIS)
Page, R.W.; Stevens, B.P.J.
1999-01-01
Full text: Zircon U-Pb SHRIMP geochronology is a powerful means of elucidating geological ages, providing that it is integrated with unequivocal field constraints, and providing that the fundamental assumptions which are behind any isotopic dating methods are geologically validated. In an attempt to better quantify the timing of Broken Hill's complex history and to reduce some current uncertainties, we report initial results from a new U-Pb SHRIMP investigation. This program was planned within the background of our own disparate stratigraphic and structural approaches to Broken Hill geology, and with objectives to (a) benchmark our new age results with those of previous workers as well as our own previous work in the Broken Hill Group, (b) evaluate and test the evidence for reported Archaean basement terrain, (c) date stratigraphic units in the upper parts of the Willyama Supergroup, (d) better constrain the timing of deformational events. Our U-Pb SHRIMP work on zircons from layered paragneisses in the Redan Geophysical Zone near Farmcote was catalysed by Nutman and Ehlers' (1998a) preferred interpretation that these 'strondhjemitic' gneisses represent an original ∼2650 Ma protolith. Our work finds zircon provenance age signatures typical of almost all ca. 1700 Ma metasediments, whether in the Broken Hill Block or other Australian Palaeoproterozoic settings. This therefore suggests that the rocks are not Archaean basement, but are part of a Thackaringa Group package possibly deposited about 1705-1710 Ma ago. New SHRIMP work on the Alma Gneiss provides a magmatic age of 1704±3 Ma, and a minimum stratigraphic age for host Thackaringa Group. This result is within error of our ages for other granitoids (1703±3 Ma, 1704±3 Ma) in the same stratigraphic position near Farmcote. As the Thackaringa Group is no more than 1000-1500 metres thick and includes 1710-1700 Ma detrital zircons, pan of the Alma Gneiss intrusion may well have been shallowly intruded, and akin to
Rademacher, Antje; Zakrzewski, Martha; Schlüter, Andreas; Schönberg, Mandy; Szczepanowski, Rafael; Goesmann, Alexander; Pühler, Alfred; Klocke, Michael
2012-03-01
DNAs of two biofilms of a thermophilic two-phase leach-bed biogas reactor fed with rye silage and winter barley straw were sequenced by 454-pyrosequencing technology to assess the biofilm-based microbial community and their genetic potential for anaerobic digestion. The studied biofilms matured on the surface of the substrates in the hydrolysis reactor (HR) and on the packing in the anaerobic filter reactor (AF). The classification of metagenome reads showed Clostridium as most prevalent bacteria in the HR, indicating a predominant role for plant material digestion. Notably, insights into the genetic potential of plant-degrading bacteria were determined as well as further bacterial groups, which may assist Clostridium in carbohydrate degradation. Methanosarcina and Methanothermobacter were determined as most prevalent methanogenic archaea. In consequence, the biofilm-based methanogenesis in this system might be driven by the hydrogenotrophic pathway but also by the aceticlastic methanogenesis depending on metabolite concentrations such as the acetic acid concentration. Moreover, bacteria, which are capable of acetate oxidation in syntrophic interaction with methanogens, were also predicted. Finally, the metagenome analysis unveiled a large number of reads with unidentified microbial origin, indicating that the anaerobic degradation process may also be conducted by up to now unknown species. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.
A Thermodynamically-consistent FBA-based Approach to Biogeochemical Reaction Modeling
Shapiro, B.; Jin, Q.
2015-12-01
Microbial rates are critical to understanding biogeochemical processes in natural environments. Recently, flux balance analysis (FBA) has been applied to predict microbial rates in aquifers and other settings. FBA is a genome-scale constraint-based modeling approach that computes metabolic rates and other phenotypes of microorganisms. This approach requires a prior knowledge of substrate uptake rates, which is not available for most natural microbes. Here we propose to constrain substrate uptake rates on the basis of microbial kinetics. Specifically, we calculate rates of respiration (and fermentation) using a revised Monod equation; this equation accounts for both the kinetics and thermodynamics of microbial catabolism. Substrate uptake rates are then computed from the rates of respiration, and applied to FBA to predict rates of microbial growth. We implemented this method by linking two software tools, PHREEQC and COBRA Toolbox. We applied this method to acetotrophic methanogenesis by Methanosarcina barkeri, and compared the simulation results to previous laboratory observations. The new method constrains acetate uptake by accounting for the kinetics and thermodynamics of methanogenesis, and predicted well the observations of previous experiments. In comparison, traditional methods of dynamic-FBA constrain acetate uptake on the basis of enzyme kinetics, and failed to reproduce the experimental results. These results show that microbial rate laws may provide a better constraint than enzyme kinetics for applying FBA to biogeochemical reaction modeling.
In Silico Identification of Microbial Partners to Form Consortia with Anaerobic Fungi
Directory of Open Access Journals (Sweden)
St. Elmo Wilken
2018-01-01
Full Text Available Lignocellulose is an abundant and renewable resource that holds great promise for sustainable bioprocessing. However, unpretreated lignocellulose is recalcitrant to direct utilization by most microbes. Current methods to overcome this barrier include expensive pretreatment steps to liberate cellulose and hemicellulose from lignin. Anaerobic gut fungi possess complex cellulolytic machinery specifically evolved to decompose crude lignocellulose, but they are not yet genetically tractable and have not been employed in industrial bioprocesses. Here, we aim to exploit the biomass-degrading abilities of anaerobic fungi by pairing them with another organism that can convert the fermentable sugars generated from hydrolysis into bioproducts. By combining experiments measuring the amount of excess fermentable sugars released by the fungal enzymes acting on crude lignocellulose, and a novel dynamic flux balance analysis algorithm, we screened potential consortia partners by qualitative suitability. Microbial growth simulations reveal that the fungus Anaeromyces robustus is most suited to pair with either the bacterium Clostridia ljungdahlii or the methanogen Methanosarcina barkeri—both organisms also found in the rumen microbiome. By capitalizing on simulations to screen six alternative organisms, valuable experimental time is saved towards identifying stable consortium members. This approach is also readily generalizable to larger systems and allows one to rationally select partner microbes for formation of stable consortia with non-model microbes like anaerobic fungi.
Directory of Open Access Journals (Sweden)
Frank R. Bengelsdorf
2015-08-01
Full Text Available Biogas from biowaste can be an important source of renewable energy, but the fermentation process of low-structure waste is often unstable. The present study uses a full-scale biogas reactor to test the hypothesis that straw as an additional biofilm carrier will increase methane yield; and this effect is mirrored in a specific microbial community attached to the straw. Better reactor performance after addition of straw, at simultaneously higher organic loading rate and specific methane yield confirmed the hypothesis. The microbial communities on straw as a biofilm carrier and of the liquid reactor content were investigated using 16S rDNA amplicon sequencing by means of 454 pyrosequencing technology. The results revealed high diversity of the bacterial communities in the liquid reactor content as well as the biofilms on the straw. The most abundant archaea in all samples belonged to the genera Methanoculleus and Methanosarcina. Addition of straw resulted in a significantly different microbial community attached to the biofilm carrier. The bacterium Candidatus Cloacamonas acidaminovorans and methanogenic archaea of the genus Methanoculleus dominated the biofilm on straw. Syntrophic interactions between the hydrogenotrophic Methanoculleus sp. and members of the hydrogen-producing bacterial community within biofilms may explain the improved methane yield. Thus, straw addition can be used to improve and to stabilize the anaerobic process in substrates lacking biofilm-supporting structures.
Li, Ruirui; Duan, Na; Zhang, Yuanhui; Liu, Zhidan; Li, Baoming; Zhang, Dongming; Dong, Taili
2017-10-01
Anaerobic digestion (AD) is a promising alternative for livestock manure management. This paper presents the experimental results obtained through a batch experiment by using chicken manure (CM) and microalgae Chlorella sp. as co-substrates. The effect of co-digestion was evaluated by varying CM to Chlorella sp. ratios (0:10, 2:8, 4:6, 6:4, 8:2, 10: 0 based on the volatile solids (VS)). The major objective of this study is to evaluate the feasibility and synergistic impact of co-digestion of CM and Chlorella sp. Enhanced 14.20% and 76.86% methane production than CM and Chlorella sp. mono-digestion respectively was achieved in co-digestion at the ratio 8:2. In addition, the co-digestion at the ratio 8:2 showed significantly higher methane yield than the weighted average of the individual substrates' specific methane yield (WSMY), indicating strong synergy effect. The Illumina Miseq sequencing analysis showed that the AD process suppressed the acetoclastic methanogenesis Methanosaeta content; but partly enhanced hydrogenotrophic methanogenesis Methanosarcina, Methanospirillum and Methanobacterium, which was responsible for the methane production. The pre-treated microalgae was then introduced at the optimal ratio 8:2 to estimate the effect of pre-treatment of microalgae on AD process. However, the pre-treatment exhibited no positive effect. Copyright © 2017 Elsevier Ltd. All rights reserved.
Xie, Wei; Jiao, Na; Ma, Cenling; Fang, Sa; Phelps, Tommy J; Zhu, Ruixin; Zhang, Chuanlun
2017-08-01
Archaea are cosmopolitan in aerated soils around the world. While the dominance of Thaumarchaeota has been reported in most soils, the methanogens are recently found to be ubiquitous but with low abundances in the aerated soil globally. However, the seasonal changes of Archaea community in the aerated soils are still in the mist. In this study, we investigated the change of Archaea in the context of environmental variables over a period of 12 months in a subtropical soil on the Chongming Island, China. The results showed that Nitrososphaera spp. were the dominant archaeal population while the methanogens were in low proportions but highly diverse (including five genera: Methanobacterium, Methanocella, Methanosaeta, Methanosarcina, and Methanomassiliicoccus) in the aerated soil samples determined by high throughput sequencing. A total of 126 LSA correlations were found in the dataset including all the 72 archaeal OTUs and 8 environmental factors. A significance index defined as the pagerank score of each OTU divided by its relative abundance was used to evaluate the significance of each OTU. The results showed that five out of 17 methanogen OTUs were significantly positively correlated with temperature, suggesting those methanogens might increase with temperature rather than being dormant in the aerated soils. Given the metabolic response of methanogens to temperature under aerated soil conditions, their contribution to the global methane cycle warrants evaluation.
Model of a DNA-protein complex of the architectural monomeric protein MC1 from Euryarchaea.
Directory of Open Access Journals (Sweden)
Françoise Paquet
Full Text Available In Archaea the two major modes of DNA packaging are wrapping by histone proteins or bending by architectural non-histone proteins. To supplement our knowledge about the binding mode of the different DNA-bending proteins observed across the three domains of life, we present here the first model of a complex in which the monomeric Methanogen Chromosomal protein 1 (MC1 from Euryarchaea binds to the concave side of a strongly bent DNA. In laboratory growth conditions MC1 is the most abundant architectural protein present in Methanosarcina thermophila CHTI55. Like most proteins that strongly bend DNA, MC1 is known to bind in the minor groove. Interaction areas for MC1 and DNA were mapped by Nuclear Magnetic Resonance (NMR data. The polarity of protein binding was determined using paramagnetic probes attached to the DNA. The first structural model of the DNA-MC1 complex we propose here was obtained by two complementary docking approaches and is in good agreement with the experimental data previously provided by electron microscopy and biochemistry. Residues essential to DNA-binding and -bending were highlighted and confirmed by site-directed mutagenesis. It was found that the Arg25 side-chain was essential to neutralize the negative charge of two phosphates that come very close in response to a dramatic curvature of the DNA.
Chen, Ruirui; Wang, Yiming; Wei, Shiping; Wang, Wei; Lin, Xiangui
2014-12-01
With increasing livestock breeding, methane (CH4 ) emissions from manure management will increasingly contribute more to atmospheric CH4 concentration. The dynamics of methanogens and methanotrophs have not yet been studied in the manure environment. The current study combines surface CH4 emissions with methanogenic and methanotrophic community analyses from two management practices, windrow composting (WCOM) and solid storage (SSTO). Our results showed that there was an c. 50% reduction of CH4 emissions with WCOM compared with SSTO over a 50-day period. A sharp decrease in the quantities of both methanogens and methanotrophs in WCOM suggested that CH4 mitigation was mainly due to decreased CH4 production rather than increased CH4 oxidation. Pyrosequencing analysis demonstrated that aeration caused a clear shift of dominant methanogens in the manure, with specifically a significant decrease in Methanosarcina and increase in Methanobrevibacter. The composition of methanogenic community was influenced by manure management and regulated CH4 production. A sharp increase in the quantity of methanotrophs in SSTO suggested that microbial CH4 oxidation is an important sink for the CH4 produced. The increased abundance of Methylococcaceae in SSTO suggested that Type I methanotrophs have an advantage in CH4 oxidation in occupying niches under low CH4 and high O2 conditions. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Díaz, Emiliano E; Stams, Alfons J M; Amils, Ricardo; Sanz, José L
2006-07-01
Methanogenic granules from an anaerobic bioreactor that treated wastewater of a beer brewery consisted of different morphological types of granules. In this study, the microbial compositions of the different granules were analyzed by molecular microbiological techniques: cloning, denaturing gradient gel electrophoresis and fluorescent in situ hybridization (FISH), and scanning and transmission electron microscopy. We propose here that the different types of granules reflect the different stages in the life cycle of granules. Young granules were small, black, and compact and harbored active cells. Gray granules were the most abundant granules. These granules have a multilayer structure with channels and void areas. The core was composed of dead or starving cells with low activity. The brown granules, which were the largest granules, showed a loose and amorphous structure with big channels that resulted in fractured zones and corresponded to the older granules. Firmicutes (as determined by FISH) and Nitrospira and Deferribacteres (as determined by cloning and sequencing) were the predominant Bacteria. Remarkably, Firmicutes could not be detected in the brown granules. The methanogenic Archaea identified were Methanosaeta concilii (70 to 90% by FISH and cloning), Methanosarcina mazei, and Methanospirillum spp. The phenotypic appearance of the granules reflected the physiological condition of the granules. This may be valuable to easily select appropriate seed sludges to start up other reactors.
Directory of Open Access Journals (Sweden)
Jing Yi
Full Text Available The total solids content of feedstocks affects the performances of anaerobic digestion and the change of total solids content will lead the change of microbial morphology in systems. In order to increase the efficiency of anaerobic digestion, it is necessary to understand the role of the total solids content on the behavior of the microbial communities involved in anaerobic digestion of organic matter from wet to dry technology. The performances of mesophilic anaerobic digestion of food waste with different total solids contents from 5% to 20% were compared and the microbial communities in reactors were investigated using 454 pyrosequencing technology. Three stable anaerobic digestion processes were achieved for food waste biodegradation and methane generation. Better performances mainly including volatile solids reduction and methane yield were obtained in the reactors with higher total solids content. Pyrosequencing results revealed significant shifts in bacterial community with increasing total solids contents. The proportion of phylum Chloroflexi decreased obviously with increasing total solids contents while other functional bacteria showed increasing trend. Methanosarcina absolutely dominated in archaeal communities in three reactors and the relative abundance of this group showed increasing trend with increasing total solids contents. These results revealed the effects of the total solids content on the performance parameters and the behavior of the microbial communities involved in the anaerobic digestion of food waste from wet to dry technologies.
Jin, Jingwei; Dai, Xiaohu
2014-01-01
The total solids content of feedstocks affects the performances of anaerobic digestion and the change of total solids content will lead the change of microbial morphology in systems. In order to increase the efficiency of anaerobic digestion, it is necessary to understand the role of the total solids content on the behavior of the microbial communities involved in anaerobic digestion of organic matter from wet to dry technology. The performances of mesophilic anaerobic digestion of food waste with different total solids contents from 5% to 20% were compared and the microbial communities in reactors were investigated using 454 pyrosequencing technology. Three stable anaerobic digestion processes were achieved for food waste biodegradation and methane generation. Better performances mainly including volatile solids reduction and methane yield were obtained in the reactors with higher total solids content. Pyrosequencing results revealed significant shifts in bacterial community with increasing total solids contents. The proportion of phylum Chloroflexi decreased obviously with increasing total solids contents while other functional bacteria showed increasing trend. Methanosarcina absolutely dominated in archaeal communities in three reactors and the relative abundance of this group showed increasing trend with increasing total solids contents. These results revealed the effects of the total solids content on the performance parameters and the behavior of the microbial communities involved in the anaerobic digestion of food waste from wet to dry technologies. PMID:25051352
Survival of methanogens during desiccation: implications for life on Mars.
Kendrick, Michael G; Kral, Timothy A
2006-08-01
The relatively recent discoveries that liquid water likely existed on the surface of past Mars and that methane currently exists in the martian atmosphere have fueled the possibility of extant or extinct life on Mars. One possible explanation for the existence of the methane would be the presence of methanogens in the subsurface. Methanogens are microorganisms in the domain Archaea that can metabolize molecular hydrogen as an energy source and carbon dioxide as a carbon source and produce methane. One factor of importance is the arid nature of Mars, at least at the surface. If one is to assume that life exists below the surface, then based on the only example of life that we know, liquid water must be present. Realistically, however, that liquid water may be seasonal just as it is at some locations on our home planet. Here we report on research designed to determine how long certain species of methanogens can survive desiccation on a Mars soil simulant, JSC Mars-1. Methanogenic cells were grown on JSC Mars-1, transferred to a desiccator within a Coy anaerobic environmental chamber, and maintained there for varying time periods. Following removal from the desiccator and rehydration, gas chromatographic measurements of methane indicated survival for varying time periods. Methanosarcina barkeri survived desiccation for 10 days, while Methanobacterium formicicum and Methanothermobacter wolfeii were able to survive for 25 days.
Langer, Susanne G; Ahmed, Sharif; Einfalt, Daniel; Bengelsdorf, Frank R; Kazda, Marian
2015-01-01
Numerous observations indicate a high flexibility of microbial communities in different biogas reactors during anaerobic digestion. Here, we describe the functional redundancy and structural changes of involved microbial communities in four lab-scale continuously stirred tank reactors (CSTRs, 39°C, 12 L volume) supplied with different mixtures of maize silage (MS) and sugar beet silage (SBS) over 80 days. Continuously stirred tank reactors were fed with mixtures of MS and SBS in volatile solid ratios of 1:0 (Continuous Fermenter (CF) 1), 6:1 (CF2), 3:1 (CF3), 1:3 (CF4) with equal organic loading rates (OLR 1.25 kgVS m−3 d−1) and showed similar biogas production rates in all reactors. The compositions of bacterial and archaeal communities were analysed by 454 amplicon sequencing approach based on 16S rRNA genes. Both bacterial and archaeal communities shifted with increasing amounts of SBS. Especially pronounced were changes in the archaeal composition towards Methanosarcina with increasing proportion of SBS, while Methanosaeta declined simultaneously. Compositional shifts within the microbial communities did not influence the respective biogas production rates indicating that these communities adapted to environmental conditions induced by different feedstock mixtures. The diverse microbial communities optimized their metabolism in a way that ensured efficient biogas production. PMID:26200922
Ecophysiology of terminal carbon metabolizing bacteria in anoxic sedimentary environments
International Nuclear Information System (INIS)
Phelps, T.J.
1985-01-01
Chemical, radiotracer, and microbiological experiments were used to understand the transformation of simple carbon compounds by anaerobic bacteria in diverse aquatic sediments and laboratory cultures. The mildly acidic sediments of Knack Lake (pH 6.2), displayed low rates of organic decomposition, and methane formation occurred almost exclusively from acetate. Low pH inhibited methanogenesis and organic decomposition. Fall turnover in Lake Mendota sediments was associated with dramatic changes in environmental parameters including: elevated concentrations of sulfate and carbon metabolites, increased rates of sulfate reduction, decreased levels of methanogenesis, increased ratio (by viable counts) of sulfate reducing to methanogenic bacteria, and higher 14 CO 2 / 14 C 4 + 14 CO 2 gas ratios produced during the biodegradation of 14 C-carbon substrates (e.g., acetate and methanol). Hydrogen consumption by sulfate reducers in Lake Mendota sediments and in co-cultures of Desulfovibrio vulgaris and Methanosarcina barkeri led to an alteration in the carbon and electron flow pathway resulting in increased CO 2 , sulfide production, and decreased methanogenesis. These data agreed with the environmental observations in Lake Mendota that high sulfate concentrations resulted in higher ratios of CO 2 /CH 4 produced from the degradation of organic matter. A new glycine-metabolizing acetogenic species was isolated and characterized from Knaack Lake which further extended the known diversity of anaerobic bacteria in nature
Directory of Open Access Journals (Sweden)
Annika Vaksmaa
2017-11-01
Full Text Available Paddy fields are important ecosystems, as rice is the primary food source for about half of the world’s population. Paddy fields are impacted by nitrogen fertilization and are a major anthropogenic source of methane. Microbial diversity and methane metabolism were investigated in the upper 60 cm of a paddy soil by qPCR, 16S rRNA gene amplicon sequencing and anoxic 13C-CH4 turnover with a suite of electron acceptors. The bacterial community consisted mainly of Acidobacteria, Chloroflexi, Proteobacteria, Planctomycetes, and Actinobacteria. Among archaea, Euryarchaeota and Bathyarchaeota dominated over Thaumarchaeota in the upper 30 cm of the soil. Bathyarchaeota constituted up to 45% of the total archaeal reads in the top 5 cm. In the methanogenic community, Methanosaeta were generally more abundant than the versatile Methanosarcina. The measured maximum methane production rate was 444 nmol gdwh-1, and the maximum rates of nitrate-, nitrite-, and iron-dependent anaerobic oxidation of methane (AOM were 57 nmol, 55 nmol, and 56 nmol gdwh-1, respectively, at different depths. qPCR revealed a higher abundance of ‘Candidatus Methanoperedens nitroreducens’ than methanotrophic NC10 phylum bacteria at all depths, except at 60 cm. These results demonstrate that there is substantial potential for AOM in fertilized paddy fields, with ‘Candidatus Methanoperedens nitroreducens’ archaea as a potential important contributor.
International Nuclear Information System (INIS)
Qu, X.; Vavilin, V.A.; Mazeas, L.; Lemunier, M.; Duquennoi, C.; He, P.-J.; Bouchez, T.
2009-01-01
Utilizing stable carbon isotope data to account for aceticlastic and non-aceticlastic pathways of methane generation, a model was created to describe laboratory batch anaerobic decomposition of cellulosic materials (office paper and cardboard). The total organic and inorganic carbon concentrations, methane production volume, and methane and CO 2 partial pressure values were used for the model calibration and validation. According to the fluorescent in situ hybridization observations, three groups of methanogens including strictly hydrogenotrophic methanogens, strictly aceticlastic methanogens (Methanosaeta sp.) and Methanosarcina sp., consuming both acetate and H 2 /H 2 CO 3 as well as acetate-oxidizing syntrophs, were considered. It was shown that temporary inhibition of aceticlastic methanogens by non-ionized volatile fatty acids or acidic pH was responsible for two-step methane production from office paper at 35 o C where during the first and second steps methane was generated mostly from H 2 /H 2 CO 3 and acetate, respectively. Water saturated and unsaturated cases were tested. According to the model, at the intermediate moisture (150%), much lower methane production occurred because of full-time inhibition of aceticlastic methanogens. At the lowest moisture, methane production was very low because most likely hydrolysis was seriously inhibited. Simulations showed that during cardboard and office paper biodegradation at 55 o C, non-aceticlastic syntrophic oxidation by acetate-oxidizing syntrophs and hydrogenotrophic methanogens were the dominant methanogenic pathways.
Yi, Jing; Dong, Bin; Jin, Jingwei; Dai, Xiaohu
2014-01-01
The total solids content of feedstocks affects the performances of anaerobic digestion and the change of total solids content will lead the change of microbial morphology in systems. In order to increase the efficiency of anaerobic digestion, it is necessary to understand the role of the total solids content on the behavior of the microbial communities involved in anaerobic digestion of organic matter from wet to dry technology. The performances of mesophilic anaerobic digestion of food waste with different total solids contents from 5% to 20% were compared and the microbial communities in reactors were investigated using 454 pyrosequencing technology. Three stable anaerobic digestion processes were achieved for food waste biodegradation and methane generation. Better performances mainly including volatile solids reduction and methane yield were obtained in the reactors with higher total solids content. Pyrosequencing results revealed significant shifts in bacterial community with increasing total solids contents. The proportion of phylum Chloroflexi decreased obviously with increasing total solids contents while other functional bacteria showed increasing trend. Methanosarcina absolutely dominated in archaeal communities in three reactors and the relative abundance of this group showed increasing trend with increasing total solids contents. These results revealed the effects of the total solids content on the performance parameters and the behavior of the microbial communities involved in the anaerobic digestion of food waste from wet to dry technologies.
Lueders, Tillmann; Manefield, Mike; Friedrich, Michael W
2004-01-01
Stable isotope probing (SIP) of nucleic acids allows the detection and identification of active members of natural microbial populations that are involved in the assimilation of an isotopically labelled compound into nucleic acids. SIP is based on the separation of isotopically labelled DNA or rRNA by isopycnic density gradient centrifugation. We have developed a highly sensitive protocol for the detection of 'light' and 'heavy' nucleic acids in fractions of centrifugation gradients. It involves the fluorometric quantification of total DNA or rRNA, and the quantification of either 16S rRNA genes or 16S rRNA in gradient fractions by real-time PCR with domain-specific primers. Using this approach, we found that fully 13C-labelled DNA or rRNA of Methylobacterium extorquens was quantitatively resolved from unlabelled DNA or rRNA of Methanosarcina barkeri by cesium chloride or cesium trifluoroacetate density gradient centrifugation respectively. However, a constant low background of unspecific nucleic acids was detected in all DNA or rRNA gradient fractions, which is important for the interpretation of environmental SIP results. Consequently, quantitative analysis of gradient fractions provides a higher precision and finer resolution for retrieval of isotopically enriched nucleic acids than possible using ethidium bromide or gradient fractionation combined with fingerprinting analyses. This is a prerequisite for the fine-scale tracing of microbial populations metabolizing 13C-labelled compounds in natural ecosystems.
Directory of Open Access Journals (Sweden)
Xuan Jia
Full Text Available A metaproteomic approach was used to analyse the proteins expressed and provide functional evidence of key metabolic pathways in the combined production of hydrogen and methane by anaerobic fermentation (CHMP-AF for reed straw utilisation. The functions and structures of bacteria and archaea populations show significant succession in the CHMP-AF process. There are many kinds of bacterial functional proteins, mainly belonging to phyla Firmicutes, Proteobacteria, Actinobacteria and Bacteroidetes, that are involved in carbohydrate metabolism, energy metabolism, lipid metabolism, and amino acid metabolism. Ferredoxin-NADP reductase, present in bacteria in genus Azotobacter, is an important enzyme for NADH/NAD+ equilibrium regulation in hydrogen production. The archaeal functional proteins are mainly involved in methane metabolism in energy metabolism, such as acetyl-CoA decarboxylase, and methyl-coenzyme M reductase, and the acetic acid pathway exhibited the highest proportion of the total. The archaea of genus Methanosarcina in phylum Euryarchaeota can produce methane under the effect of multi-functional proteins through acetic acid, CO2 reduction, and methyl nutrient pathways. The study demonstrates metaproteomics as a new way of uncovering community functional and metabolic activity. The combined information was used to identify the metabolic pathways and organisms crucial for lignocellulosic biomass degradation and biogas production. This also regulates the process from its protein levels and improves the efficiency of biogas production using reed straw biomass.
Thermophilic anaerobic co-digestion of garbage, screened swine and dairy cattle manure.
Liu, Kai; Tang, Yue-Qin; Matsui, Toru; Morimura, Shigeru; Wu, Xiao-Lei; Kida, Kenji
2009-01-01
Methane fermentation characteristics of garbage, swine manure (SM), dairy cattle manure (DCM) and mixtures of these wastes were studied. SM and DCM showed much lower volatile total solid (VTS) digestion efficiencies and methane yield than those of garbage. VTS digestion efficiency of SM was significantly increased when it was co-digested with garbage (Garbage: SM=1:1). Co-digestion of garbage, SM and DCM with respect to the relative quantity of each waste discharged in the Kikuchi (1: 16: 27) and Aso (1: 19: 12) areas indicated that co-digestion with garbage would improve the digestion characteristic of SM and DCM as far as the ratio of DCM in the wastes was maintained below a certain level. When the mixed waste (Garbage: SM: DCM=1:19:12) was treated using a thermophilic UAF reactor, methanogens responsible for the methane production were Methanoculleus and Methanosarcina species. Bacterial species in the phylum Firmicutes were dominant bacteria responsible for the digestion of these wastes. As the percentage of garbage in the mixed wastes used in this study was low (2-3%) and the digestion efficiency of DCM was obviously improved, the co-digestion of SM and DCM with limited garbage was a prospective method to treat the livestock waste effectively and was an attractive alternative technology for the construction of a sustainable environment and society in stock raising area.
Fatty acid-oxidizing consortia along a nutrient gradient in the Florida Everglades.
Chauhan, Ashvini; Ogram, Andrew
2006-04-01
The Florida Everglades is one of the largest freshwater marshes in North America and has been subject to eutrophication for decades. A gradient in P concentrations extends for several kilometers into the interior of the northern regions of the marsh, and the structure and function of soil microbial communities vary along the gradient. In this study, stable isotope probing was employed to investigate the fate of carbon from the fermentation products propionate and butyrate in soils from three sites along the nutrient gradient. For propionate microcosms, 16S rRNA gene clone libraries from eutrophic and transition sites were dominated by sequences related to previously described propionate oxidizers, such as Pelotomaculum spp. and Syntrophobacter spp. Significant representation was also observed for sequences related to Smithella propionica, which dismutates propionate to butyrate. Sequences of dominant phylotypes from oligotrophic samples did not cluster with known syntrophs but with sulfate-reducing prokaryotes (SRP) and Pelobacter spp. In butyrate microcosms, sequences clustering with Syntrophospora spp. and Syntrophomonas spp. dominated eutrophic microcosms, and sequences related to Pelospora dominated the transition microcosm. Sequences related to Pelospora spp. and SRP dominated clone libraries from oligotrophic microcosms. Sequences from diverse bacterial phyla and primary fermenters were also present in most libraries. Archaeal sequences from eutrophic microcosms included sequences characteristic of Methanomicrobiaceae, Methanospirillaceae, and Methanosaetaceae. Oligotrophic microcosms were dominated by acetotrophs, including sequences related to Methanosarcina, suggesting accumulation of acetate.
Yang, Yang; Wang, Yong
2017-01-01
A metaproteomic approach was used to analyse the proteins expressed and provide functional evidence of key metabolic pathways in the combined production of hydrogen and methane by anaerobic fermentation (CHMP-AF) for reed straw utilisation. The functions and structures of bacteria and archaea populations show significant succession in the CHMP-AF process. There are many kinds of bacterial functional proteins, mainly belonging to phyla Firmicutes, Proteobacteria, Actinobacteria and Bacteroidetes, that are involved in carbohydrate metabolism, energy metabolism, lipid metabolism, and amino acid metabolism. Ferredoxin-NADP reductase, present in bacteria in genus Azotobacter, is an important enzyme for NADH/NAD+ equilibrium regulation in hydrogen production. The archaeal functional proteins are mainly involved in methane metabolism in energy metabolism, such as acetyl-CoA decarboxylase, and methyl-coenzyme M reductase, and the acetic acid pathway exhibited the highest proportion of the total. The archaea of genus Methanosarcina in phylum Euryarchaeota can produce methane under the effect of multi-functional proteins through acetic acid, CO2 reduction, and methyl nutrient pathways. The study demonstrates metaproteomics as a new way of uncovering community functional and metabolic activity. The combined information was used to identify the metabolic pathways and organisms crucial for lignocellulosic biomass degradation and biogas production. This also regulates the process from its protein levels and improves the efficiency of biogas production using reed straw biomass. PMID:28817657
Lee, Jung-Yeol; Park, Jeong-Hoon; Park, Hee-Deung
2017-10-01
Direct interspecies electron transfer (DIET) between exoelectrogenic bacteria and methanogenic archaea via conductive materials is reported as an efficient method to produce methane in anaerobic organic waste digestion. A voltage can be applied to the conductive materials to accelerate the DIET between two groups of microorganisms to produce methane. To evaluate this hypothesis, two sets of anaerobic serum bottles with and without applied voltage were used with a pair of graphite rods as conductive materials to facilitate DIET. Initially, the methane production rate was similar between the two sets of serum bottles, and later the serum bottles with an applied voltage of 0.39V showed a 168% higher methane production rate than serum bottles without an applied voltage. In cyclic voltammograms, the characteristic redox peaks for hydrogen and acetate oxidation were identified in the serum bottles with an applied voltage. In the microbial community analyses, hydrogenotrophic methanogens (e.g. Methanobacterium) were observed to be abundant in serum bottles with an applied voltage, while methanogens utilizing carbon dioxide (e.g., Methanosaeta and Methanosarcina) were dominant in serum bottles without an applied voltage. Taken together, the applied voltage on conductive materials might not be effective to promote DIET in methane production. Instead, it appeared to generate a condition for hydrogenotrophic methanogenesis. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
McDermott, F.; Hawkesworth, C.J.; Harris, N.B.W.
1988-01-01
Nd isotopic data was presented for southern Africa in support of episodic crustal growth. Over 50 percent of the continental crust there had formed before 2.5 Ga, and less than 10 percent was produced after about 1.0 Ga. The data imply a mean crustal age of about 2.4 Ga for southern Africa, and a higher rate of crustal growth than that derived from Australian shale data, particularly during the Proterozoic. Isotopic data from Damara metasediments imply that there is no need to invoke decoupling of the Rb-Sr and Sm-Nd systems in the continental crust
Mcdermott, F.; Hawkesworth, C. J.; Harris, N. B. W.
1988-01-01
Nd isotopic data was presented for southern Africa in support of episodic crustal growth. Over 50 percent of the continental crust there had formed before 2.5 Ga, and less than 10 percent was produced after about 1.0 Ga. The data imply a mean crustal age of about 2.4 Ga for southern Africa, and a higher rate of crustal growth than that derived from Australian shale data, particularly during the Proterozoic. Isotopic data from Damara metasediments imply that there is no need to invoke decoupling of the Rb-Sr and Sm-Nd systems in the continental crust.
International Nuclear Information System (INIS)
Babu, E.V.S.S.K.; Vijaya Kumar, T.; Sreenivas, B.; Khadke, Namrata; Vijaya Gopal, B.; Bhaskar Rao, Y.J.
2015-01-01
The Archaean Dharwar and Bastar cratons of Peninsular India are separated by the NE-SW trending Godavari Graben. This zone is involved in recurrent rifting. It is generally believed that earlier phase of rifting dates back to Mesoproterozoic and the younger phase is related to the deposition of Permo-carboniferous coal-bearing sediments. A belt of high-grade rocks (∼ 150 x 45 km) - the Karimnagar granulite terrane (KGT) along the southern flank of the graben. The KGT comprises high-grade lithologies such as orthopyroxene-bearing quarto-feldspathic gneiss, amphibolite-granulite facies supracrustal belts that include metamorphosed quartz-arenites, pelites, carbonates, iron formation and mafic rocks as well as several zones of migmatite and younger granitoid intrusives. The study presented new LA-ICPMS zircon U-Pb age data for five granitoid (charnockite and granite) samples (KRN-90-24, KRN-90-30, KRN-13-02, KRN-13-03 and KRN-13-05; a closer constraint of the age crystallization of protoliths and high-grade metamorphism of felsic granulites and orthogneisses from the KGT. Hf isotopic compositions were also obtained for selected zircons from two samples (KRN-90-24 and KRN-90-30) using New Wave UP-213 Laser Ablation system coupled to Nu Plasma HR MC-ICPMS to constraint the nature of the felsic protoliths of the charnockite and granite gneisses in the KGT
Uranium occurrences in the Granite Zone
International Nuclear Information System (INIS)
Nyegaard, P.; Armour-Brown, A.
1986-04-01
This report describes the work and results of the South Greenland Exploration Programme (Sydex) during the 1984 field season in the Granite Zone, and discusses the results and conclusions that can be drawn from them. It also contains a structural analysis of the Ivigtut-Julianehaab region, which will help in future exploration by indicating the likely directions of uraniferous faults and fractures. It also includes suggestions for future work with both exploration and scientific aspects. The project was carried out by the Geological Survey Greenland (GGU) in co-operation with Risoe National Laboratory. It was financed by the Danish Ministry of Energy. The structural analysis was carried out using previous geological maps, our own field observations and an analysis of lineament frequencies taken from aerial photographs and satellite images. Major lineaments in the region are due to E-W sinistral wrench faults and NE-SW normal faults. Analysis of the minor lineaments showed that the region could be divided into three blocks which have each reacted differently to the same regional stress field which was active throughout the Gardar period. A northern block which has been influenced by an older system of faults in the Archaean gneiss, a central block dominated by a graben, and a southern block where there is a change to a less intensively faulted area. 2 maps, 27 refs. (EG)
Large-scale variation in lithospheric structure along and across the Kenya rift
Prodehl, C.; Mechie, J.; Kaminski, W.; Fuchs, K.; Grosse, C.; Hoffmann, H.; Stangl, R.; Stellrecht, R.; Khan, M.A.; Maguire, Peter K.H.; Kirk, W.; Keller, Gordon R.; Githui, A.; Baker, M.; Mooney, W.; Criley, E.; Luetgert, J.; Jacob, B.; Thybo, H.; Demartin, M.; Scarascia, S.; Hirn, A.; Bowman, J.R.; Nyambok, I.; Gaciri, S.; Patel, J.; Dindi, E.; Griffiths, D.H.; King, R.F.; Mussett, A.E.; Braile, L.W.; Thompson, G.; Olsen, K.; Harder, S.; Vees, R.; Gajewski, D.; Schulte, A.; Obel, J.; Mwango, F.; Mukinya, J.; Riaroh, D.
1991-01-01
The Kenya rift is one of the classic examples of a continental rift zone: models for its evolution range from extension of the lithosphere by pure shear1, through extension by simple shear2, to diapiric upwelling of an asthenolith3. Following a pilot study in 19854, the present work involved the shooting of three seismic refraction and wide-angle reflection profiles along the axis, across the margins, and on the northeastern flank of the rift (Fig. 1). These lines were intended to reconcile the different crustal thickness estimates for the northern and southern parts of the rift4-6 and to reveal the structure across the rift, including that beneath the flanks. The data, presented here, reveal significant lateral variations in structure both along and across the rift. The crust thins along the rift axis from 35 km in the south to 20 km in the north; there are abrupt changes in Mono depth and uppermost-mantle seismic velocity across the rift margins, and crustal thickening across the boundary between the Archaean craton and PanAfrican orogenic belt immediately west of the rift. These results suggest that thickened crust may have controlled the rift's location, that there is a decrease in extension from north to south, and that the upper mantle immediately beneath the rift may contain reservoirs of magma generated at greater depth.
Rare-earth element geochemistry in the Luanga Mafic-Ultramafic Complex, Para
International Nuclear Information System (INIS)
Suita, M.T.F.; Nilson, A.A.
1989-01-01
Six whole-rock samples (harzburgite, orthopyroxenic and norite) of the Luanga Mafic-Ultramafic Complex (Para) were analysed for rare-earth elements (REE) through plasma spectrometry. The Luanga Complex is a deformed and metamorphosed layered mafic-ultramafic body of Archaean age. The Complex underwent medium-grade metamorphism in three stages. The first stage (medium grade) involved local formation of tremolite and reduction of Ca content in plagioclase. The second stage (low grade) consisted of serpentinization of amphibole or ortopyroxene forming bastile and generation of albite + epidote + white mica + actinolite from plagioclase. The third stage involved renewed serpentinization and/or talcification of pre-existing minerals (including serpentine) along fracture and fault surfaces. The analysed rocks display light rare-earth element (LREE) enrichment up to sixty times the composition of the Leedly chondrite and La/Yb ratios from 6.2 to 20.0 they are low in medium rare-earth elements (MREE), displaying discrete to strong negative Eu anomaly even in plagioclase cumulates and are slightly enriched in heavy rare-earth elements (HREE), usually higher than chondrite values. The low MREE area related to the occurrence of orthopyroxene (bronzite) in a way similar to the pattern of alpine periodotites, while HREE enrichment is compatible with the presence of bronzite and Mg-olivine, probably an inherited igneous feature. (author) [pt
Decrease in oceanic crustal thickness since the breakup of Pangaea
van Avendonk, Harm J. A.; Davis, Joshua K.; Harding, Jennifer L.; Lawver, Lawrence A.
2017-01-01
Earth's mantle has cooled by 6-11 °C every 100 million years since the Archaean, 2.5 billion years ago. In more recent times, the surface heat loss that led to this temperature drop may have been enhanced by plate-tectonic processes, such as continental breakup, the continuous creation of oceanic lithosphere at mid-ocean ridges and subduction at deep-sea trenches. Here we use a compilation of marine seismic refraction data from ocean basins globally to analyse changes in the thickness of oceanic crust over time. We find that oceanic crust formed in the mid-Jurassic, about 170 million years ago, is 1.7 km thicker on average than crust produced along the present-day mid-ocean ridge system. If a higher mantle temperature is the cause of thicker Jurassic ocean crust, the upper mantle may have cooled by 15-20 °C per 100 million years over this time period. The difference between this and the long-term mantle cooling rate indeed suggests that modern plate tectonics coincide with greater mantle heat loss. We also find that the increase of ocean crustal thickness with plate age is stronger in the Indian and Atlantic oceans compared with the Pacific Ocean. This observation supports the idea that upper mantle temperature in the Jurassic was higher in the wake of the fragmented supercontinent Pangaea due to the effect of continental insulation.
Decreasing ammonia inhibition in thermophilic methanogenic bioreactors using carbon fiber textiles.
Sasaki, Kengo; Morita, Masahiko; Hirano, Shin-ichi; Ohmura, Naoya; Igarashi, Yasuo
2011-05-01
Ammonia accumulation is one of the main causes of the loss of methane production observed during fermentation. We investigated the effect of addition of carbon fiber textiles (CFT) to thermophilic methanogenic bioreactors with respect to ammonia tolerance during the process of degradation of artificial garbage slurry, by comparing the performance of the reactors containing CFT with the performance of reactors without CFT. Under total ammonia-N concentrations of 3,000 mg L(-1), the reactors containing CFT were found to mediate stable removal of organic compounds and methane production. Under these conditions, high levels of methanogenic archaea were retained at the CFT, as determined by 16S rRNA gene analysis for methanogenic archaea. In addition, Methanobacterium sp. was found to be dominant in the suspended fraction, and Methanosarcina sp. was dominant in the retained fraction of the reactors with CFT. However, the reactors without CFT had lower rates of removal of organic compounds and production of methane under total ammonia-N concentrations of 1,500 mg L(-1). Under this ammonia concentration, a significant accumulation of acetate was observed in the reactors without CFT (130.0 mM), relative to the reactors with CFT (4.2 mM). Only Methanobacterium sp. was identified in the reactors without CFT. These results suggest that CFT enables stable proliferation of aceticlastic methanogens by preventing ammonia inhibition. This improves the process of stable garbage degradation and production of methane in thermophilic bioreactors that include high levels of ammonia.
Thummes, Kathrin; Schäfer, Jenny; Kämpfer, Peter; Jäckel, Udo
2007-12-01
Since compost is widely used as soil amendment and the fact that during the processing of compost material high amounts of microorganisms are released into the air, we investigated whether compost may act as a carrier for thermophilic methanogens to temperate soils. All eight investigated compost materials showed a clear methane production potential between 0.01 and 0.98 micromol CH(4) g dw(-1)h(-1) at 50 degrees C. Single strand conformation polymorphism (SSCP) and cloning analysis indicated the presence of Methanosarcina thermophila, Methanoculleus thermophilus, and Methanobacterium formicicum. Bioaerosols collected during the turning of a compost pile showed both a highly similar SSCP profile compared to the corresponding compost material and clear methane production during anoxic incubation in selective medium at 50 degrees C. Both observations indicated a considerable release of thermophilic methanogens into the air. To analyse the persistence of compost-borne thermophilic methanogens in temperate oxic soils, we therefore studied their potential activity in compost and compost/soil mixtures, which was brought to a meadow soil, as well as in an agricultural soil fertilised with compost. After 24h anoxic incubation at 50 degrees C, all samples containing compost showed a clear methanogenic activity, even 1 year after application. In combination with the in vitro observed resilience of the compost-borne methanogens against desiccation and UV radiation we assume that compost material acts as an effective carrier for the distribution of thermophilic methanogens by fertilisation and wind.
International Nuclear Information System (INIS)
Yang, Yingnan; Tsukahara, Kenichiro; Sawayama, Shigeki
2007-01-01
A newly developed anaerobic rotating disk reactor (ARDR) packed with polyurethane was used in continuous mode for organic waste removal under thermophilic (55 o C) anaerobic conditions. This paper reports the effects of the rotational speed on the methanogenic performance and community in an ARDR supplied with acetic acid synthetic wastewater as the organic substrate. The best performance was obtained from the ARDR with the rotational speed (ω) of 30 rpm. The average removal of dissolved organic carbon was 98.5%, and the methane production rate was 393 ml/l-reactor/day at an organic loading rate of 2.69 g/l-reactor/day. Under these operational conditions, the reactor had a greater biomass retention capacity and better reactor performance than those at other rotational speeds (0, 5 and 60 rpm). The results of 16S rRNA phylogenetic analysis indicated that the major methanogens in the reactor belonged to the genus Methanosarcina spp. The results of real-time polymerase chain reaction (PCR) analysis suggested that the cell density of methanogenic archaea immobilized on the polyurethane foam disk could be concentrated more than 2000 times relative to those in the original thermophilic sludge. Scanning electron microphotographs showed that there were more immobilized microbes at ω of 30 rpm than 60 rpm. A rotational speed on the outer layer of the disk of 6.6 m/min could be appropriate for anaerobic digestion using the polyurethane ARDR
Directory of Open Access Journals (Sweden)
Jianchao Zhang
2018-01-01
Full Text Available Carboxylated multiwalled carbon nanotubes (MWCNTs-COOH have become a growing concern in terms of their fate and toxicity in aqueous environments. Methane (CH4 is a major product of organic matter degradation in waterlogged environments. In this study, we determined the effect of MWCNTs-COOH on the production of CH4 from propionate oxidation in paddy soil enrichments. The results showed that the methanogenesis from propionate degradation was accelerated in the presence of MWCNTs-COOH. In addition, the rates of CH4 production and propionate degradation increased with increasing concentrations of MWCNTs-COOH. Scanning electron microscopy (SEM observations showed that the cells were intact and maintained their structure in the presence of MWCNTs-COOH. In addition, SEM and fluorescence in situ hybridization (FISH images revealed that the cells were in direct contact with the MWCNTs and formed cell-MWCNTs aggregates that contained both bacteria and archaea. On the other hand, nontoxic magnetite nanoparticles (Fe3O4 had similar effects on the CH4 production and cell integrity as the MWCNTs-COOH. Compared with no nanomaterial addition, the relative abundances of Geobacter and Methanosarcina species increased in the presence of MWCNTs-COOH. This study suggests that MWCNTs-COOH exerted positive rather than cytotoxic effects on the syntrophic oxidation of propionate in paddy soil enrichments and affected the bacterial and archaeal community structure at the test concentrations. These findings provide novel insight into the consequences of nanomaterial release into anoxic natural environments.
DESTRUCTION OF THE LITHOSPHERE: FAULTBLOCK DIVISIBILITY AND ITS TECTONOPHYSICAL REGULARITIES
Directory of Open Access Journals (Sweden)
Semen I. Sherman
2012-01-01
Full Text Available A new concept is proposed concerning the origin and inception of ‘initial’ faults and formation of large blocks as a result of cooling of the Archaean lithosphere, during which Benard cells had formed (Fig. 5. At locations where cooling convection currents went down, partial crystallization took place, stresses were localized, and initial fault occurred there. The systems of such fault developed mainly in two directions and gradually formed an initial block pattern of the lithosphere. This pattern is now represented by the largest Archaean faults acting as boundaries of the lithospheric plates and large intraplate blocks (Fig. 6. This group of faults represents the first scaletime level of destruction of the lithosphere. Large blocks of the first (and may be the second order, which are located on the viscous foundation, interacted with each other under the influence of the sublithospheric movements or endogenous sources and thus facilitated the occurrence of high stresses inside the blocks. When the limits of strength characteristics of the block medium were exceeded, the intrablock stresses were released and caused formation of fractures/faults and blocks of various ranks (Fig. 14. This large group, including faultblock structures of various ranks and ages, comprises the second level of the scaletime destruction of the lithosphere.The intense evolution of ensembles of faults and blocks of the second scaletime level is facilitated by shortterm activation of faultblock structures of the lithosphere under the influence of strain waves. Periods of intensive shortterm activation are reliably detected by seismic monitoring over the past fifty years. Investigations of periodical processes specified in the geological records over the post-Proterozoic periods [Khain, Khalilov, 2009] suggest that in so far uninvestigated historical and more ancient times, the top of the lithosphere was subject to wave processes that
Lv, Wen
with system performances. Methanosarcina and Methanobacterium were the most important methanogenic genera in the digesters where intense hydrolysis/acidogenesis and methanogenesis occurred, while Methanosaeta established itself in the mesophilic digesters with sufficient retention time and low concentrations of volatile fatty acids (VFA). The populations of all the quantified methanogen genera (Methanobacterium, Methanosarcina, Methanosaeta , and Methanoculleus) were inversely correlated or associated with high concentrations of VFA. The results of DGGE and qPCR were confirmed and improved by the pyrosequencing data (Chapter 8). Different operation conditions led to the development of different microbial communities that resulted in the functional differences among AD systems. The bacterial community tended to be more diverse in the digesters with more lenient conditions. Firmicutes was a major phylum in each AD system and might be associated with system performance. Chloroflexi was a major phylum in each thermophilic digester with balanced hydrolysis/acidogenesis and methanogenesis, so it might be indicative of efficient operations of thermophilic digesters. Thermotogae only appeared as a major phylum in the AT-TPAD system and might be important to its performance. The results of my studies had impacts on the development of renewable bioenergy. On one hand, the two new thermophilic cellulolytic isolates may be further evaluated for development of CBP strains. On the other hand, the series of comparative and integrated studies of different AD systems provided new knowledge that may guide future research and development of AD systems, particularly TPAD systems. Furthermore, the correlation between system performances and microbial communities may help improve design and operation of AD in general.
An overview of metallic mineralization in the Pine Creek Geosyncline
International Nuclear Information System (INIS)
Needham, R.S.; Roarty, M.J.
1980-01-01
Although renowned for its relatively recently discovered large uranium deposits, the Pine Creek Geosyncline has a history of exploitation dating back to 1865, during which time 16 metals have been extracted. Uranium makes up 96.8 percent of the value of recorded production and reserves at present metal prices, lead 1.9 percent, gold and zinc 0.32 percent each, iron 0.2 percent, silver 0.2 percent and all other metals 0.3 percent. The Alligator Rivers Uranium Field accounts for 95 percent of the total value of recorded production and reserves, the Rum Jungle Uranium Field 4 percent, and all other areas 1 percent. Deposits range from stratiform through stratabound to vein-type. Most have undergone some degree of alteration or remobilisation, and extreme metasomatism in some masks clues to the earlier evolution of the deposits. Small vein-type hydrothermal deposits, clustered around intrusive granites, predominate. Other deposits can be sub-divided into those associated with the basement, those associated with the Masson and Cahill Formations, and those associated with the Gerowie Tuff, Koolpin, and Kapalga Formations. Many deposits have undergone supergene concentration near the surface, and some have been formed predominantly by this process. Uranium appears to have been mainly derived from Archaean source rocks, and base metals and some precious metals from volcanic exhalative sources. Main areas of potential are the Alligator Rivers region for uranium and possibly gold, and the central part of the geosyncline for base metals. (author)
Uranium geology and prospecting in Greenland
International Nuclear Information System (INIS)
Steenfelt, A.; Neilson, B.L.; Secher, K.
1977-01-01
The Geological Survey of Greenland is responsible for most of the uranium and thorium prospecting activity in Greenland, which involves airborne gamma spectrometry and scintillometry, geochemical sampling, geological investigations and ground scintillometry. Since 1971 large areas of east and west Greenland have been investigated by aerial surveys, geochemical sampling and most of the detailed scintillometric work having been restricted to small areas in east Greenland. Anomalous radioactivity in west Greenland is recorded from carbonatite intrusions, and from units in Proterozoic and Archaean gneisses. No mineralization has been found to date. In south Greenland investigations have been centred on the uranium and thorium deposit at Kvanefjeld, which is situated in a corner of the Ilimaussaq alkaline intrusion. The coincidence of favourable conditions during the differentiation and crystallization of the magma led to an extreme enrichment of uranium and thorium in the rocks that were last formed - the lujavrites. The deposit comprises parts of the lujavrites and a secondary enrichment zone in the contact between lujavrite and basaltic cover rocks. Reasonably assured reserves are 5800 t U with a grade of 310 ppm U. In the Caledonides of east Greenland some gneisses in basement cores, a dark siltstone in late Precambrian sediments and the Devonian acid magmatic rocks are characterized by a higher radiation level. A number of small mineral occurrences have been found, the majority of which are associated with the Devonian acid magmatic rocks. (author)
International Nuclear Information System (INIS)
Anhaeusser, C.R.; Robb, L.J.
1982-01-01
The Archaean granitic terrane south and south-west of the Barberton greenstone belt consists predominantly of an older suite of tonalitic and trondhjemitic gneisses into which have been emplaced two large multi-component granitoid bodies known as the Heerenveen and Mpuluzi batholiths. Although geochronologic and Sr-isotopic studies demonstrate that there is little distinction between the ages and initial ratios of the various phases associated with these batholiths, each body displays contrasting textural and geochemical characteristics. The oldest phase is represented by coarse porphyritic granitic rocks into which is intruded a medium-to-fine-grained homogeneous granodioritic phase. Both phases are components of a bimodal association that is, in turn, intruded by a third phase which includes medium-grained pink or grey granodiorite and adamellite dykes feeding a homogeneous sheet-like carapace over-lying the coarser porphyritic granites. A fourth phase, consisting predominantly of potassic migmatites and gneisses, occurs in the areas rimming the batholiths and represents the product of interaction between the batholith magmas and components of the pre-existing crust in the region. Geochemically, the Heerenveen batholith has trondhjemitic affinities whereas the Mpuluzi batholith consists predominantly of potassic granites. Together with the Nelspruit batholith north of the Barberton greenstone belt the three granitic bodies show a progression in actual values of K 2 O, Na 2 O, Rb, and Sr with the Nelspruit body having chemical characteristics intermediate between the two
Regional geology of the Pine Creek Geosyncline
International Nuclear Information System (INIS)
Needham, R.S.; Crick, I.H.; Stuart-Smith, P.G.
1980-01-01
The Pine Creek Geosyncline comprises about 14km of chronostratigraphic mainly pelitic and psammitic Lower Proterozoic sediments with interlayered tuff units, resting on granitic late Archaean complexes exposed as three small domes. Sedimentation took place in one basin, and most stratigraphic units are represented throughout the basin. The sediments were regionally deformed and metamorphosed at 1800Ma. Tightly folded greenschist facies strata in the centre grade into isoclinally deformed amphibolite facies metamorphics in the west and northeast. Pre and post-orogenic continental tholeiites, and post-orogenic granite diapirs intrude the Lower Proterozoic metasediments, and the granites are surrounded by hornfels zones up to 10km wide in the greenschist facies terrane. Cover rocks of Carpentarian (Middle Proterozoic) and younger ages rest on all these rocks unconformably and conceal the original basin margins. The Lower Proterozoic metasediments are mainly pelites (about 75 percent) which are commonly carbonaceous, lesser psammites and carbonates (about 10 percent each), and minor rudites (about 5 percent). Volcanic rocks make up about 10 percent of the total sequence. The environment of deposition ranges from shallow-marine to supratidal and fluviatile for most of the sequence, and to flysch in the topmost part. Poor exposure and deep weathering over much of the area hampers correlation of rock units; the correlation preferred by the authors is presented, and possible alternatives are discussed. Regional geological observations pertinent to uranium ore genesis are described. (author)
Shen-Miller, J; Lindner, Petra; Xie, Yongming; Villa, Sarah; Wooding, Kerry; Clarke, Steven G; Loo, Rachel R O; Loo, Joseph A
2013-09-01
Single-seeded fruit of the sacred lotus Nelumbo nucifera Gaertn var. China Antique from NE China have viability as long as ~1300 years determined by direct radiocarbon-dating, having a germination rate of 84%. The pericarp, a fruit tissue that encloses the single seeds of Nelumbo , is considered one of the major factors that contribute to fruit longevity. Proteins that are heat stable and have protective function may be equally important to seed viability. We show proteins of Nelumbo fruit that are able to withstand heating, 31% of which remained soluble in the 110°C-treated embryo-axis of a 549-yr-old fruit and 76% retained fluidity in its cotyledons. Genome of Nelumbo is published. The amino-acid sequences of 11 "thermal proteins" (soluble at 100°C) of modern Nelumbo embryo-axes and cotyledons, identified by mass spectrometry, Western blot and bioassay, are assembled and aligned with those of an archaeal-hyperthermophile Methancaldococcus jannaschii (Mj; an anaerobic methanogen having a growth optimum of 85°C) and with five mesophile angiosperms. These thermal proteins have roles in protection and repair under stress. More than half of the Nelumbo thermal proteins (55%) are present in the archaean Mj, indicating their long-term durability and history. One Nelumbo protein-repair enzyme exhibits activity at 100°C, having a higher heat-tolerance than that of Arabidopsis. A list of 30 sequenced but unassembled thermal proteins of Nelumbo is supplemented.
Hadj-Kaddour, Zakia; Liégeois, Jean-Paul; Demaiffe, Daniel; Caby, Renaud
1998-12-01
The Tin Zebane dyke swarm was emplaced at the end of the Pan-African orogeny along a mega-shear zone separating two contrasting terranes of the Tuareg shield. It is located along the western boundary of the Archaean In Ouzzal rigid terrane, but inside the adjacent Tassendjanet terrane, strongly remobilized at the end of the Precambrian. The Tin Zebane swarm was emplaced during post-collisional sinistral movements along the shear zone at 592.2±5.8 Ma (19WR Rb-Sr isochron). It is a dyke-on-dyke system consisting of dykes and stocks of gabbros and dykes of metaluminous and peralkaline granites. All rock types have Sr and Nd isotopic initial ratios (Sr i=0.7028 and ɛNd=+6.2) typical of a depleted mantle source, similar to the prevalent mantle (PREMA) at that period. No crustal contamination occurred in the genesis of the Tin Zebane swarm. Even the samples showing evidence of fluid interaction (essentially alkali mobility) have the same isotopic signature. The peralkaline granites have peculiar geochemical characteristics that mimic subduction-related granites: this geochemical signature is interpreted in terms of extensive differentiation effects due to late cumulates comprising aegirine, zircon, titanite, allanite and possibly fergusonite, separated from the liquid in the swarm itself due to magmatic flow turbulence. The Tin Zebane dyke swarm is thus of paramount importance for constraining the differentiation of mantle products to generate highly evolved alkaline granites without continental crust participation, in a post-collisional setting.
Yu, D; Kurola, J M; Lähde, K; Kymäläinen, M; Sinkkonen, A; Romantschuk, M
2014-10-01
Over 258 Mt of solid waste are generated annually in Europe, a large fraction of which is biowaste. Sewage sludge is another major waste fraction. In this study, biowaste and sewage sludge were co-digested in an anaerobic digestion reactor (30% and 70% of total wet weight, respectively). The purpose was to investigate the biogas production and methanogenic archaeal community composition in the anaerobic digestion reactor under meso- (35-37 °C) and thermophilic (55-57 °C) processes and an increasing organic loading rate (OLR, 1-10 kg VS m(-3) d(-1)), and also to find a feasible compromise between waste treatment capacity and biogas production without causing process instability. In summary, more biogas was produced with all OLRs by the thermophilic process. Both processes showed a limited diversity of the methanogenic archaeal community which was dominated by Methanobacteriales and Methanosarcinales (e.g. Methanosarcina) in both meso- and thermophilic processes. Methanothermobacter was detected as an additional dominant genus in the thermophilic process. In addition to operating temperatures, the OLRs, the acetate concentration, and the presence of key substrates like propionate also affected the methanogenic archaeal community composition. A bacterial cell count 6.25 times higher than archaeal cell count was observed throughout the thermophilic process, while the cell count ratio varied between 0.2 and 8.5 in the mesophilic process. This suggests that the thermophilic process is more stable, but also that the relative abundance between bacteria and archaea can vary without seriously affecting biogas production. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Niu, Qigui; Takemura, Yasuyuki; Kubota, Kengo; Li, Yu-You
2015-01-01
Highlights: • Microbial community dynamics and process functional resilience were investigated. • The threshold of TAN in mesophilic reactor was higher than the thermophilic reactor. • The recoverable archaeal community dynamic sustained the process resilience. • Methanosarcina was more sensitive than Methanoculleus on ammonia inhibition. • TAN and FA effects the dynamic of hydrolytic and acidogenic bacteria obviously. - Abstract: While methane fermentation is considered as the most successful bioenergy treatment for chicken manure, the relationship between operational performance and the dynamic transition of archaeal and bacterial communities remains poorly understood. Two continuous stirred-tank reactors were investigated under thermophilic and mesophilic conditions feeding with 10%TS. The tolerance of thermophilic reactor on total ammonia nitrogen (TAN) was found to be 8000 mg/L with free ammonia (FA) 2000 mg/L compared to 16,000 mg/L (FA1500 mg/L) of mesophilic reactor. Biomethane production was 0.29 L/gV S in in the steady stage and decreased following TAN increase. After serious inhibition, the mesophilic reactor was recovered successfully by dilution and washing stratagem compared to the unrecoverable of thermophilic reactor. The relationship between the microbial community structure, the bioreactor performance and inhibitors such as TAN, FA, and volatile fatty acid was evaluated by canonical correspondence analysis. The performance of methanogenic activity and substrate removal efficiency were changed significantly correlating with the community evenness and phylogenetic structure. The resilient archaeal community was found even after serious inhibition in both reactors. Obvious dynamics of bacterial communities were observed in acidogenic and hydrolytic functional bacteria following TAN variation in the different stages
Effects of cattle husbandry on abundance and activity of methanogenic archaea in upland soils.
Radl, Viviane; Gattinger, Andreas; Chronáková, Alica; Nemcová, Anna; Cuhel, Jiri; Simek, Miloslav; Munch, Jean Charles; Schloter, Michael; Elhottová, Dana
2007-09-01
In the present study, we tested the hypothesis that animal treading associated with a high input of organic matter would favour methanogenesis in soils used as overwintering pasture. Hence, methane emissions and methanogen populations were examined at sections with different degree of cattle impact in a Farm in South Bohemia, Czech Republic. In spring, methane emission positively corresponded to the gradient of animal impact. Applying phospholipid etherlipid analysis, the highest archaeal biomass was found in section severe impact (SI), followed by moderate impact (MI) and no impact. The same trend was observed for the methanogens as showed by real-time quantitative PCR analyses of methyl coenzyme M reductase (mcrA) genes. The detection of monounsaturated isoprenoid side chain hydrocarbons (i20:1) indicated the presence of acetoclastic methanogens in the cattle-impacted sites. This result was corroborated by the phylogenetic analysis of mcrA gene sequences obtained from section SI, which showed that 33% of the analysed clones belonged to the genus Methanosarcina. The majority of the sequenced clones (41%) showed close affiliations with uncultured rumen archaeons. This leads to the assumption that a substantial part of the methanogenic community in plot SI derived from the grazing cattle itself. Compared to the spring sampling, in autumn, a significant reduction in archaeal biomass and number of copies of mcrA genes was observed mainly for section MI. It can be concluded that after 5 months without cattle impact, the severely impact section maintained its methane production potential, whereas the methane production potential under moderate impact returned to background values.
Energy Technology Data Exchange (ETDEWEB)
Niu, Qigui; Takemura, Yasuyuki; Kubota, Kengo [Department of Civil and Environmental Engineering, Graduate School of Engineering Tohoku University, 6-6-06 Aza-Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Li, Yu-You, E-mail: yyli@epl1.civil.tohoku.ac.jp [Department of Civil and Environmental Engineering, Graduate School of Engineering Tohoku University, 6-6-06 Aza-Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Key Lab of Northwest Water Resource, Environment and Ecology, MOE, Xi’an University of Architecture and Technology, Xi’an (China)
2015-09-15
Highlights: • Microbial community dynamics and process functional resilience were investigated. • The threshold of TAN in mesophilic reactor was higher than the thermophilic reactor. • The recoverable archaeal community dynamic sustained the process resilience. • Methanosarcina was more sensitive than Methanoculleus on ammonia inhibition. • TAN and FA effects the dynamic of hydrolytic and acidogenic bacteria obviously. - Abstract: While methane fermentation is considered as the most successful bioenergy treatment for chicken manure, the relationship between operational performance and the dynamic transition of archaeal and bacterial communities remains poorly understood. Two continuous stirred-tank reactors were investigated under thermophilic and mesophilic conditions feeding with 10%TS. The tolerance of thermophilic reactor on total ammonia nitrogen (TAN) was found to be 8000 mg/L with free ammonia (FA) 2000 mg/L compared to 16,000 mg/L (FA1500 mg/L) of mesophilic reactor. Biomethane production was 0.29 L/gV S{sub in} in the steady stage and decreased following TAN increase. After serious inhibition, the mesophilic reactor was recovered successfully by dilution and washing stratagem compared to the unrecoverable of thermophilic reactor. The relationship between the microbial community structure, the bioreactor performance and inhibitors such as TAN, FA, and volatile fatty acid was evaluated by canonical correspondence analysis. The performance of methanogenic activity and substrate removal efficiency were changed significantly correlating with the community evenness and phylogenetic structure. The resilient archaeal community was found even after serious inhibition in both reactors. Obvious dynamics of bacterial communities were observed in acidogenic and hydrolytic functional bacteria following TAN variation in the different stages.
Microbial Community Response to Simulated Petroleum Seepage in Caspian Sea Sediments
Directory of Open Access Journals (Sweden)
Katrin Knittel
2017-04-01
Full Text Available Anaerobic microbial hydrocarbon degradation is a major biogeochemical process at marine seeps. Here we studied the response of the microbial community to petroleum seepage simulated for 190 days in a sediment core from the Caspian Sea using a sediment-oil-flow-through (SOFT system. Untreated (without simulated petroleum seepage and SOFT sediment microbial communities shared 43% bacterial genus-level 16S rRNA-based operational taxonomic units (OTU0.945 but shared only 23% archaeal OTU0.945. The community differed significantly between sediment layers. The detection of fourfold higher deltaproteobacterial cell numbers in SOFT than in untreated sediment at depths characterized by highest sulfate reduction rates and strongest decrease of gaseous and mid-chain alkane concentrations indicated a specific response of hydrocarbon-degrading Deltaproteobacteria. Based on an increase in specific CARD-FISH cell numbers, we suggest the following groups of sulfate-reducing bacteria to be likely responsible for the observed decrease in aliphatic and aromatic hydrocarbon concentration in SOFT sediments: clade SCA1 for propane and butane degradation, clade LCA2 for mid- to long-chain alkane degradation, clade Cyhx for cycloalkanes, pentane and hexane degradation, and relatives of Desulfobacula for toluene degradation. Highest numbers of archaea of the genus Methanosarcina were found in the methanogenic zone of the SOFT core where we detected preferential degradation of long-chain hydrocarbons. Sequencing of masD, a marker gene for alkane degradation encoding (1-methylalkylsuccinate synthase, revealed a low diversity in SOFT sediment with two abundant species-level MasD OTU0.96.
Maus, Irena; Kim, Yong Sung; Wibberg, Daniel; Stolze, Yvonne; Off, Sandra; Antonczyk, Sebastian; Pühler, Alfred; Scherer, Paul; Schlüter, Andreas
2017-02-28
Process surveillance within agricultural biogas plants (BGPs) was concurrently studied by high-throughput 16S rRNA gene amplicon sequencing and an optimized quantitative microscopic fingerprinting (QMF) technique. In contrast to 16S rRNA gene amplicons, digitalized microscopy is a rapid and cost-effective method that facilitates enumeration and morphological differentiation of the most significant groups of methanogens regarding their shape and characteristic autofluorescent factor 420. Moreover, the fluorescence signal mirrors cell vitality. In this study, four different BGPs were investigated. The results indicated stable process performance in the mesophilic BGPs and in the thermophilic reactor. Bacterial subcommunity characterization revealed significant differences between the four BGPs. Most remarkably, the genera Defluviitoga and Halocella dominated the thermophilic bacterial subcommunity, whereas members of another taxon, Syntrophaceticus , were found to be abundant in the mesophilic BGP. The domain Archaea was dominated by the genus Methanoculleus in all four BGPs, followed by Methanosaeta in BGP1 and BGP3. In contrast, Methanothermobacter members were highly abundant in the thermophilic BGP4. Furthermore, a high consistency between the sequencing approach and the QMF method was shown, especially for the thermophilic BGP. The differences elucidated that using this biphasic approach for mesophilic BGPs provided novel insights regarding disaggregated single cells of Methanosarcina and Methanosaeta species. Both dominated the archaeal subcommunity and replaced coccoid Methanoculleus members belonging to the same group of Methanomicrobiales that have been frequently observed in similar BGPs. This work demonstrates that combining QMF and 16S rRNA gene amplicon sequencing is a complementary strategy to describe archaeal community structures within biogas processes.
Angenent, Largus T; Sung, Shihwu; Raskin, Lutgarde
2002-11-01
Changes in methanogenic population levels were followed during startup of a full-scale, farm-based anaerobic sequencing batch reactor (ASBR) and these changes were linked to operational and performance data. The ASBR was inoculated with anaerobic digester sludge from a municipal wastewater treatment facility. During an acclimation period of approximately 3 months, the ASBR content was diluted to maintain a total ammonia-N level of approximately 2000mg l(-1). After this acclimation period, the volatile solids loading rate was increased to its design value of 1.7g l(-1) day(-1) with a 15-day hydraulic retention time, which increased the total ammonia-N level in the ASBR to approximately 3,600 mg l(-1). The 16S ribosomal RNA (rRNA) levels of the acetate-utilizing methanogens of the genus Methanosarcina decreased from 3.8% to 1.2% (expressed as a percentage of the total 16S rRNA levels) during this period, while the 16S rRNA levels of Methanosaeta concilii remained low (below 2.2%). Methane production and reactor performance were not affected as the 16S rRNA levels of the hydrogen-utilizing methanogens of the order Methanomicrobiales increased from 2.3% to 7.0%. Hence, it is likely that during operation with high ammonia levels, the major route of methane production is through a syntrophic relationship between acetate-oxidizing bacteria and hydrogen-utilizing methanogens. Anaerobic digestion at total ammonia-N levels exceeding 3500mg l(-1) was sustainable apparently due to the acclimation of hydrogen-utilizing methanogens to high ammonia levels.
Metabolic engineering for the high-yield production of isoprenoid-based C5 alcohols in E. coli
George, Kevin W.; Thompson, Mitchell G.; Kang, Aram; Baidoo, Edward; Wang, George; Chan, Leanne Jade G.; Adams, Paul D.; Petzold, Christopher J.; Keasling, Jay D.; Soon Lee, Taek
2015-01-01
Branched five carbon (C5) alcohols are attractive targets for microbial production due to their desirable fuel properties and importance as platform chemicals. In this study, we engineered a heterologous isoprenoid pathway in E. coli for the high-yield production of 3-methyl-3-buten-1-ol, 3-methyl-2-buten-1-ol, and 3-methyl-1-butanol, three C5 alcohols that serve as potential biofuels. We first constructed a pathway for 3-methyl-3-buten-1-ol, where metabolite profiling identified NudB, a promiscuous phosphatase, as a likely pathway bottleneck. We achieved a 60% increase in the yield of 3-methyl-3-buten-1-ol by engineering the Shine-Dalgarno sequence of nudB, which increased protein levels by 9-fold and reduced isopentenyl diphosphate (IPP) accumulation by 4-fold. To further optimize the pathway, we adjusted mevalonate kinase (MK) expression and investigated MK enzymes from alternative microbes such as Methanosarcina mazei. Next, we expressed a fusion protein of IPP isomerase and the phosphatase (Idi1~NudB) along with a reductase (NemA) to diversify production to 3-methyl-2-buten-1-ol and 3-methyl-1-butanol. Finally, we used an oleyl alcohol overlay to improve alcohol recovery, achieving final titers of 2.23 g/L of 3-methyl-3-buten-1-ol (~70% of pathway-dependent theoretical yield), 150 mg/L of 3-methyl-2-buten-1-ol, and 300 mg/L of 3-methyl-1-butanol. PMID:26052683
Shibata, K.; Suwa, K.; Uchiumi, S.; Agata, T.
1996-10-01
RbSr whole rock and KAr mineral age determinations were made on rocks from the Broderick Falls (Webuye) area, western Kenya. Granitic rocks yielded a RbSr whole rock isochron age of 2555 ± 101 Ma with an initial {87Sr}/{86Sr} ratio of 0.70121 ± 0.00038. This age represents the time of granitoid emplacement. KAr mineral ages range from 574 to 3420 Ma, which is very variable with respect to mineral type and locality. Mylonitic granodiorite very close to the Nandi Escarpment gave a KAr age of 916 Ma from biotite, suggesting the time of the activity of the Nandi Fault, which may be an earlier phase of the Pan-African Orogeny. Ages of biotites in a zone between 4 and 6 km northeast of the Nandi Fault are anomalously high compared to those of coexisting hornblende and the RbSr isochron age, confirming the existence of excess 40Ar in biotite. Excess 40Ar was probably introduced into biotite under the appropriate temperature conditions prevailing near the Nandi Fault. Taramite, a rare sodic-calcic amphibole, was found in a cordierite-biotite gneiss of the Kavirondian Supergroup and gave a typical Pan-African KAr age of 574 Ma. The last Pan-African metamorphism occurred in the terrane east of the Surongai Thrust.
Bharathi, M; Chellapandi, P
2017-02-01
Methanobrevibacter ruminantium M1 (MRU) is a rumen methanogenic archaean that can be able to utilize formate and CO 2 /H 2 as growth substrates. Extensive analysis on the evolutionary genomic contexts considered herein to unravel its intergenomic relationship and metabolic adjustment acquired from the genomic content of Methanothermobacter thermautotrophicus ΔH. We demonstrated its intergenomic distance, genome function, synteny homologs and gene families, origin of replication, and methanogenesis to reveal the evolutionary relationships between Methanobrevibacter and Methanothermobacter. Comparison of the phylogenetic and metabolic markers was suggested for its archaeal metabolic core lineage that might have evolved from Methanothermobacter. Orthologous genes involved in its hydrogenotrophic methanogenesis might be acquired from intergenomic ancestry of Methanothermobacter via Methanobacterium formicicum. Formate dehydrogenase (fdhAB) coding gene cluster and carbon monoxide dehydrogenase (cooF) coding gene might have evolved from duplication events within Methanobrevibacter-Methanothermobacter lineage, and fdhCD gene cluster acquired from bacterial origins. Genome-wide metabolic survey found the existence of four novel pathways viz. l-tyrosine catabolism, mevalonate pathway II, acyl-carrier protein metabolism II and glutathione redox reactions II in MRU. Finding of these pathways suggested that MRU has shown a metabolic potential to tolerate molecular oxygen, antimicrobial metabolite biosynthesis and atypical lipid composition in cell wall, which was acquainted by metabolic cross-talk with mammalian bacterial origins. We conclude that coevolution of genomic contents between Methanobrevibacter and Methanothermobacter provides a clue to understand the metabolic adaptation of MRU in the rumen at different environmental niches. Copyright © 2016 Elsevier Inc. All rights reserved.
A Geodynamic Study of Active Crustal Deformation and Earthquakes in North China
Yang, Y.; Liu, M.
2005-12-01
North China is part of the Archaean Sino-Korean craton, yet today it is a region of intense crustal deformation and earthquakes, including 21 M >=7.0 events since 512 AD. More than half of the large events occurred within the Fen-Wei rift system surrounding the stable Ordos plateau; the largest events (M >=7.3) show a sequential southward migration along the rift. However, since 1695 the Fen-Wei rift has became seismically dormant, while seismicity seems having shifted eastward to the North China plain, marked by the 1996 Tangshan earthquake (M=7.8). We have developed a 3D viscoelastic geodynamic model to study the cause of seismicity and its spatial-temporal pattern in North China. Constrained by crustal kinematics from GPS and neotectonic data, the model shows high deviatoric stress in the North China crust, resulting mainly from compression of the expanding Tibetan Plateau and resistance from the stable Siberian block. Within North China seismicity is largely controlled by lateral heterogeneity of lithospheric structures, which explains the concentration of seismicity in the Fen-Wei rift. Our results show that stress triggering may have contributed to the sequential migration of large events along the rift, and the release and migration of stress and strain energy from these large events may partially explain the intense seismicity in the North China plain in the past 300 years. Comparing the predicted long-term spatial pattern of strain energy with seismic energy release provides some insights of potential earthquake risks in North China.
López-Moro, F. J.; López-Plaza, M.; Gutiérrez-Alonso, G.; Fernández-Suárez, J.; López-Carmona, A.; Hofmann, M.; Romer, R. L.
2018-04-01
In this study, we report U-Pb Laser Ablation ICP-MS zircon and ID-TIMS monazite ages for peraluminous granitoid plutons (biotite ± muscovite ± cordierite ± sillimanite) in the Tormes Dome, one of the gneiss-cored domes located in the Central Iberian Zone of the Variscan belt of northern Spain. Textural domains in zircon, interpreted to represent the magmatic crystallization of the granitoids (and one monazite fraction in the Ledesma pluton) yielded ages around 320 Ma, in agreement with other geochronological studies in the region. This age is interpreted to date the timing of decompression crustal melting driven by the extensional collapse of the orogenic belt in this domain of the Variscan chain of western Europe. In addition, there are several populations of inherited (xenocrystic) zircon: (1) Carboniferous zircon crystals (ca. 345 Ma) as well as one of the monazite fractions in the coarse-grained facies of the Ledesma pluton that also yielded an age of ca. 343 Ma. (2) Devonian-Silurian zircon xenocrysts with scattered ages between ca. 390 and 432 Ma. (3) Middle Cambrian-Ordovician (ca. 450-511 Ma). (4) Ediacaran-Cryogenian zircon ages (ca. 540-840 Ma). (5) Mesoproterozoic to Archaean zircon (900-2700 Ma). The abundance of Carboniferous-inherited zircon shows that crustal recycling/cannibalization may often happen at a fast pace in orogenic scenarios with only short lapses of quiescence. In our case study, it seems plausible that a "crustal layer" of ca. 340 Ma granitoids/migmatites was recycled, partially or totally, only 15-20 My after its emplacement.
Creating global comparative analyses of tectonic rifts, monogenetic volcanism and inverted relief
van Wyk de Vries, Benjamin
2016-04-01
I have been all around the world, and to other planets and have travelled from the present to the Archaean and back to seek out the most significant tectonic rifts, monogenetic volcanoes and examples of inverted relief. I have done this to provide a broad foundation of the comparative analysis for the Chaîne des Puys - Limagne fault nomination to UNESCO world Heritage. This would have been an impossible task, if not for the cooperation of the scientific community and for Google Earth, Google Maps and academic search engines. In preparing global comparisons of geological features, these quite recently developed tools provide a powerful way to find and describe geological features. The ability to do scientific crowd sourcing, rapidly discussing with colleagues about features, allows large numbers of areas to be checked and the open GIS tools (such as Google Earth) allow a standardised description. Search engines also allow the literature on areas to be checked and compared. I will present a comparative study of rifts of the world, monogenetic volcanic field and inverted relief, integrated to analyse the full geological system represented by the Chaîne des Puys - Limagne fault. The analysis confirms that the site is an exceptional example of the first steps of continental drift in a mountain rift setting, and that this is necessarily seen through the combined landscape of tectonic, volcanic and geomorphic features. The analysis goes further to deepen the understanding of geological systems and stresses the need for more study on geological heritage using such a global and broad systems approach.
Genetically Engineering Entomopathogenic Fungi.
Zhao, H; Lovett, B; Fang, W
2016-01-01
Entomopathogenic fungi have been developed as environmentally friendly alternatives to chemical insecticides in biocontrol programs for agricultural pests and vectors of disease. However, mycoinsecticides currently have a small market share due to low virulence and inconsistencies in their performance. Genetic engineering has made it possible to significantly improve the virulence of fungi and their tolerance to adverse conditions. Virulence enhancement has been achieved by engineering fungi to express insect proteins and insecticidal proteins/peptides from insect predators and other insect pathogens, or by overexpressing the pathogen's own genes. Importantly, protein engineering can be used to mix and match functional domains from diverse genes sourced from entomopathogenic fungi and other organisms, producing insecticidal proteins with novel characteristics. Fungal tolerance to abiotic stresses, especially UV radiation, has been greatly improved by introducing into entomopathogens a photoreactivation system from an archaean and pigment synthesis pathways from nonentomopathogenic fungi. Conversely, gene knockout strategies have produced strains with reduced ecological fitness as recipients for genetic engineering to improve virulence; the resulting strains are hypervirulent, but will not persist in the environment. Coupled with their natural insect specificity, safety concerns can also be mitigated by using safe effector proteins with selection marker genes removed after transformation. With the increasing public concern over the continued use of synthetic chemical insecticides and growing public acceptance of genetically modified organisms, new types of biological insecticides produced by genetic engineering offer a range of environmentally friendly options for cost-effective control of insect pests. Copyright © 2016 Elsevier Inc. All rights reserved.
Accessory mineral records of tectonic environments? (Invited)
Storey, C.; Marschall, H. R.; Enea, F.; Taylor, J.; Jennings, E. S.
2010-12-01
Accessory mineral research continues to gather momentum as we seek to unleash their full potential. It is now widely recognised that robust accessory minerals, such as zircon, rutile, titanite, allanite and monazite, are archives of important trace elements that can help deduce metamorphic reaction history in metapelites, metabasites and other rock types. Moreover, they are important carriers of certain trace elements and govern or influence the products of partial melting and of fluid-rock interaction (e.g. magmas and mineralisation) in settings like subduction zones and hydrothermal systems. Perhaps most importantly, they can often be dated using the U-Th-Pb system. More recently, radiogenic (Lu-Hf, Sm-Nd, Rb-Sr) and stable (O) isotope systems have been applied and have further pushed the utility of accessory mineral research. In this talk I will discuss some of these advances towards one particular aim: the use of detrital accessory minerals for fingerprinting tectonic environments. This is a particularly laudable aim in Precambrian rocks, for which the preservation potential of orogenic belts and fossil subduction zones and their diagnostic metamorphic rocks is low. The implication is that our understanding of plate tectonics, particularly in the Archaean, is biased by the preserved in-tact rock record. An analogy is that Jack Hills zircons record evidence of Earth’s crust some 400 Ma before the preserved rock record begins. I will focus on some recent advances and new data from rutile and also the mineral inclusion record within zircon, which shows great promise for petrologic interpretation.
Some geological effects of the search for radioactive minerals in the Canadian shield
International Nuclear Information System (INIS)
Lang, A.H.; Ruzicka, V.
1979-01-01
Priorities for funds and personnel to provide field and laboratory work related to finding and evaluating radioactive deposits, mainly those of uranium, also led directly and indirectly to greatly increased knowledge of the general geology of the Canadian Shield. The paper outlines some of the main advances made in these ways, as well as some minor ones. Main examples are: the acceleration of geological mapping and special studies of stratigraphy, structure and other aspects of several parts of the Shield, including the Archaean-Proterozoic boundary; the acquisition of modern equipment capable of making large numbers of isotope age determinations, which was soon applied to general problems in the Shield, including revision of its regional provinces and sub-provinces and the subdivision of Proterozoic time; the obtaining of modern equipment for X-ray identification of minerals and for several kinds of rock and mineral analyses, which soon allowed more advanced and more extensive mineral, petrological and trace element studies of various parts of the Shield and a general study of metallogenic provinces, illustrated by metallogenic maps, which stemmed from a metallogenic map for uranium. The development of Geiger counters and other detectors is outlined because of their relation to the map for uranium and so to aeroradiometric surveys. By 1960, 26 producing uranium mines had been developed from an estimated 12 000 occurrences carrying more than 0.05% U 3 O 8 equivalent. Current activities of the Geological Survey of Canada for radioactive minerals are summarized for whatever hints this may provide regarding further indirect effects
Exploring Biogeochemistry and Microbial Diversity of Extant Microbialites in Mexico and Cuba
Valdespino-Castillo, Patricia M.; Hu, Ping; Merino-Ibarra, Martín; López-Gómez, Luz M.; Cerqueda-García, Daniel; González-De Zayas, Roberto; Pi-Puig, Teresa; Lestayo, Julio A.; Holman, Hoi-Ying; Falcón, Luisa I.
2018-01-01
Microbialites are modern analogs of ancient microbial consortia that date as far back as the Archaean Eon. Microbialites have contributed to the geochemical history of our planet through their diverse metabolic capacities that mediate mineral precipitation. These mineral-forming microbial assemblages accumulate major ions, trace elements and biomass from their ambient aquatic environments; their role in the resulting chemical structure of these lithifications needs clarification. We studied the biogeochemistry and microbial structure of microbialites collected from diverse locations in Mexico and in a previously undescribed microbialite in Cuba. We examined their structure, chemistry and mineralogy at different scales using an array of nested methods including 16S rRNA gene high-throughput sequencing, elemental analysis, X-Ray fluorescence (XRF), X-Ray diffraction (XRD), Scanning Electron Microscopy-Energy Dispersive Spectroscopy (SEM-EDS), Fourier Transformed Infrared (FTIR) spectroscopy and Synchrotron Radiation-based Fourier Transformed Infrared (SR-FTIR) spectromicroscopy. The resulting data revealed high biological and chemical diversity among microbialites and specific microbe to chemical correlations. Regardless of the sampling site, Proteobacteria had the most significant correlations with biogeochemical parameters such as organic carbon (Corg), nitrogen and Corg:Ca ratio. Biogeochemically relevant bacterial groups (dominant phototrophs and heterotrophs) showed significant correlations with major ion composition, mineral type and transition element content, such as cadmium, cobalt, chromium, copper and nickel. Microbial-chemical relationships were discussed in reference to microbialite formation, microbial metabolic capacities and the role of transition elements as enzyme cofactors. This paper provides an analytical baseline to drive our understanding of the links between microbial diversity with the chemistry of their lithified precipitations. PMID
International Nuclear Information System (INIS)
Wang Wenguang; Tao Quan; Zhang Shouben
1997-10-01
Regional geologic characteristics, metallogenetic conditions and prospects of uranium ores in the central part of the Eastern Liaoning Province of North China is studied systematically. It demonstrates that the Archaean basement of the study area consists of a special type of granite-greenstone belts in China. It is called the granite-greenstone belts of the Liaoning-model, in which the granitic rocks are mainly migmatitic granite and granite-gneiss of migmatitic genesis. The greenstone belts in this area have undergone strong metamorphism. Large amounts of Precambrian geochronological studies have been made with U-Pb isotopic method on zircon; and a new Precambrian geologic time scale has been established. It is also proved that multistage activation of the Early Precambrian basement and the proto-platform took place in Early Proterozoic. Emphases are laid on uranium and thorium abundances and their variations as well as primary uranium contents of rocks in the granite-greenstone terrain and those of the Lower Proterozoic. At the same time, uraninite as accessory mineral in granitic rocks is found to exist more or less. Early Precambrian strata and many kinds of mineral deposits occurring in the strata are in origin chiefly of syngenetic hot brine sedimentation and of submarine extrusive gas-hydrothermal sedimentation superimposed by metamorphism. Metallogenetic features and models of various types of uranium deposits are studied emphatically and compared with similar large deposits abroad. In addition, overall synthetical appraisals are made for this area; and on this basis, prospecting directions and favourable sections of uranium metallization are suggested. (4 refs., 4 tabs.)
Diamonds from Myanmar and Thailand: Characteristics and possible origins
International Nuclear Information System (INIS)
Griffin, W.L.; Commonwealth Scientific and Industrial Research Organisation, North Ryde, NSW; Win, T.T.; Andrew, A.S.; Davies, R.; Wathanakul, P.; Metcalfe, I.
2000-01-01
Alluvial diamonds with no obvious sources ('headless placers') are found in several areas of SE Asia and Oceania, including Myanmar, southern Thailand (Phuket), Sumatra, Kalimantan and eastern Australia. These deposits occur in relatively young geological terrains, in contrast to the Archaean or Proterozoic terrains that host most primary diamond deposits and their associated alluvial workings. Significant quantities of diamonds have been recovered from two areas in Myanmar, Momeik in the northern part of the country, and Theindaw in the southern part, and from the Phuket-Takuapa area of SW Thailand. Smaller quantities have been found in several other localities, notably in the Taungoo-Htantabin area of Myanmar. The Momeik diamonds are recovered during mining of gemstone gravels; the Theindaw and Phuket diamonds are by-products of tin dredging. To understand the origin of these enigmatic diamonds and to provide an improved exploration model, we are carrying out detailed studies of the morphology, mineral inclusions, internal growth structures and growth history, nitrogen concentration and aggregation state, and carbon isotopic composition of diamonds from Myanmar, Thailand and eastern Australia. We have examined >40 stones from Phuket, >110 from Theindaw and >25 from Momeik; these range in size from <0.1 ct to 3.5 ct, averaging ca 0.2 ct. While there are differences among the samples from different areas, the small sample size means these may not be representative and the similarities among the samples are striking. They are therefore described together here. More detailed data are given by Win et al., (1998) and Wathanakul et al., (1998)
Creus, P. K.; Basson, I. J.; Stoch, B.; Mogorosi, O.; Gabanakgosi, K.; Ramsden, F.; Gaegopolwe, P.
2018-01-01
Country rock at Jwaneng Diamond Mine provides a rare insight into the deformational history of the Transvaal Supergroup in southern Botswana. The ca. 235 Ma kimberlite diatremes intruded into late Archaean to Early Proterozoic, mixed, siliciclastic-carbonate sediments, that were subjected to at least three deformational events. The first deformational event (D1), caused by NW-SE directed compression, is responsible for NE-trending, open folds (F1) with associated diverging, fanning, axial planar cleavage. The second deformational event (D2) is probably progressive, involving a clockwise rotation of the principal stress to NE-SW trends. Early D2, which was N-S directed, involved left-lateral, oblique shearing along cleavage planes that developed around F1 folds, along with the development of antithetic structures. Progressive clockwise rotation of far-field forces saw the development of NW-trending folds (F2) and its associated, weak, axial planar cleavage. D3 is an extensional event in which normal faulting, along pre-existing cleavage planes, created a series of rhomboid-shaped, fault-bounded blocks. Normal faults, which bound these blocks, are the dominant structures at Jwaneng Mine. Combined with block rotation and NW-dipping bedding, a horst-like structure on the northwestern limb of a broad, gentle, NE-trending anticline is indicated. The early compressional and subsequent extensional events are consistent throughout the Jwaneng-Ramotswa-Lobatse-Thabazimbi area, suggesting that a large area records the same fault geometry and, consequently, deformational history. It is proposed that Jwaneng Mine is at or near the northernmost limit of the initial, northwards-directed compressional event.
Directory of Open Access Journals (Sweden)
Anne M. Spain
2015-09-01
Full Text Available Zodletone spring is a sulfide-rich spring in southwestern Oklahoma characterized by shallow, microoxic, light-exposed spring water overlaying anoxic sediments. Previously, culture-independent 16S rRNA gene based diversity surveys have revealed that Zodletone spring source sediments harbor a highly diverse microbial community, with multiple lineages putatively involved in various sulfur-cycling processes. Here, we conducted a metatranscriptomic survey of microbial populations in Zodletone spring source sediments to characterize the relative prevalence and importance of putative phototrophic, chemolithotrophic, and heterotrophic microorganisms in the sulfur cycle, the identity of lineages actively involved in various sulfur cycling processes, and the interaction between sulfur cycling and other geochemical processes at the spring source. Sediment samples at the spring’s source were taken at three different times within a 24-h period for geochemical analyses and RNA sequencing. In depth mining of datasets for sulfur cycling transcripts revealed major sulfur cycling pathways and taxa involved, including an unexpected potential role of Actinobacteria in sulfide oxidation and thiosulfate transformation. Surprisingly, transcripts coding for the cyanobacterial Photosystem II D1 protein, methane monooxygenase, and terminal cytochrome oxidases were encountered, indicating that genes for oxygen production and aerobic modes of metabolism are actively being transcribed, despite below-detectable levels (<1 µM of oxygen in source sediment. Results highlight transcripts involved in sulfur, methane, and oxygen cycles, propose that oxygenic photosynthesis could support aerobic methane and sulfide oxidation in anoxic sediments exposed to sunlight, and provide a viewpoint of microbial metabolic lifestyles under conditions similar to those seen during late Archaean and Proterozoic eons.
Tang, Yueqin; Shigematsu, Toru; Ikbal; Morimura, Shigeru; Kida, Kenji
2004-05-01
We demonstrated previously that micro-aeration allows construction of an effective thermophilic methane-fermentation system for treatment of municipal solid waste (MSW) without production of H(2)S. In the present study, we compared the microbial communities in a thermophilic MSW digester without aeration and with micro-aeration by fluorescence in situ hybridization (FISH), denaturing gradient gel electrophoresis (DGGE), phylogenetic analysis of libraries of 16S rRNA gene clones and quantitative real-time PCR. Moreover, we studied the activity of sulfate-reducing bacteria (SRB) by analysis of the transcription of the gene for dissimilatory sulfite reductase (dsr). Experiments using FISH revealed that microorganisms belonging to the domain Bacteria dominated in the digester both without aeration and with micro-aeration. Phylogenetic analysis based on 16S rRNA gene and analysis of bacteria by DGGE did not reveal any obvious difference within the microbial communities under the two aeration conditions, and bacteria affiliated with the phylum Firmicutes were dominant. In Archaea, the population of Methanosarcina decreased while the population of Methanoculleus increased as a result of micro-aerations as revealed by the analysis of 16S rRNA gene clones and quantitative real-time PCR. Reverse transcription and PCR (RT-PCR) demonstrated the transcription of dsrA not only in the absence of aeration but also in the presence of micro-aeration, even under conditions where no H(2)S was detected in the biogas. In conclusion, micro-aeration has no obvious effects on the phylogenetic diversity of microorganisms. Furthermore, the activity of SRBs in the digester was not repressed even though the concentration of H(2)S in the biogas was very low under the micro-aeration conditions.
Bromeliad catchments as habitats for methanogenesis in tropical rainforest canopies
Directory of Open Access Journals (Sweden)
Shana K. Goffredi
2011-12-01
Full Text Available Tropical epiphytic plants within the family Bromeliaceae are unusual in that they possess foliage capable of retaining water and impounded material. This creates an acidic (pH 3.5-6.5 and anaerobic (< 1 ppm O2 environment suspended in the canopy. Results from a Costa Rican rainforest show that most bromeliads (n = 75/86 greater than ~20 cm in plant height or ~4-5 cm tank depth, showed presence of methanogens within the lower anoxic horizon of the tank. Archaea were dominated by methanogens (77-90% of recovered ribotypes and community structure, although variable, was generally comprised of a single type, closely related to either hydrogenotrophic Methanoregula or Methanocella, a specific clade of aceticlastic Methanosaeta, or Methanosarcina. Juvenile bromeliads, or those species, such as Guzmania, with shallow tanks, generally did not possess methanogens, as assayed by PCR specific for methanogen 16S rRNA genes, nor did artificial catchments (~ 100 ml volume, in place 6-12 months prior to sample collection. Methanogens were not detected in soil (n = 20, except in one case, in which the dominant ribotype was different from nearby bromeliads. Recovery of methyl coenzyme M reductase genes supported the occurrence of hydrogenotrophic and aceticlastic methanogens within bromeliad tanks, as well as the trend, via QPCR analysis of mcrA, of increased methanogenic capacity with increased plant height. Methane production rates of up to 300 nmol CH4 ml tank water -1 day-1 were measured in microcosm experiments. These results suggest that bromeliad-associated archaeal communities may play an important role in the cycling of carbon in neotropical forests.
Comparative fecal metagenomics unveils unique functional capacity of the swine gut
Directory of Open Access Journals (Sweden)
Martinson John
2011-05-01
Full Text Available Abstract Background Uncovering the taxonomic composition and functional capacity within the swine gut microbial consortia is of great importance to animal physiology and health as well as to food and water safety due to the presence of human pathogens in pig feces. Nonetheless, limited information on the functional diversity of the swine gut microbiome is available. Results Analysis of 637, 722 pyrosequencing reads (130 megabases generated from Yorkshire pig fecal DNA extracts was performed to help better understand the microbial diversity and largely unknown functional capacity of the swine gut microbiome. Swine fecal metagenomic sequences were annotated using both MG-RAST and JGI IMG/M-ER pipelines. Taxonomic analysis of metagenomic reads indicated that swine fecal microbiomes were dominated by Firmicutes and Bacteroidetes phyla. At a finer phylogenetic resolution, Prevotella spp. dominated the swine fecal metagenome, while some genes associated with Treponema and Anareovibrio species were found to be exclusively within the pig fecal metagenomic sequences analyzed. Functional analysis revealed that carbohydrate metabolism was the most abundant SEED subsystem, representing 13% of the swine metagenome. Genes associated with stress, virulence, cell wall and cell capsule were also abundant. Virulence factors associated with antibiotic resistance genes with highest sequence homology to genes in Bacteroidetes, Clostridia, and Methanosarcina were numerous within the gene families unique to the swine fecal metagenomes. Other abundant proteins unique to the distal swine gut shared high sequence homology to putative carbohydrate membrane transporters. Conclusions The results from this metagenomic survey demonstrated the presence of genes associated with resistance to antibiotics and carbohydrate metabolism suggesting that the swine gut microbiome may be shaped by husbandry practices.
Link Between Capacity for Current Production and Syntrophic Growth in Geobacter species
Directory of Open Access Journals (Sweden)
Amelia-Elena eRotaru
2015-07-01
Full Text Available Electrodes are unnatural electron acceptors, and it is yet unknown how some Geobacter species evolved to use electrodes as terminal electron acceptors. Analysis of different Geobacter species revealed that they varied in their capacity for current production. G. metallireducens and G. hydrogenophilus generated high current densities (ca. 0.05 mA/cm2, comparable to G. sulfurreducens. G. bremensis, G. chapellei, G. humireducens, and G. uranireducens, produced much lower currents (ca. 0.05 mA/cm2 and G. bemidjiensis was previously found to not produce current. There was no correspondence between the effectiveness of current generation and Fe(III oxide reduction rates. Some high-current-density strains (G. metallireducens and G. hydrogenophilus reduced Fe(III-oxides as fast as some low-current-density strains (G. bremensis, G. humireducens, and G. uranireducens whereas other low-current-density strains (G. bemidjiensis and G. chapellei reduced Fe(III oxide as slowly as G. sulfurreducens, a high-current-density strain. However, there was a correspondence between the ability to produce higher currents and the ability to grow syntrophically. G. hydrogenophilius was found to grow in co-culture with Methanosarcina barkeri, which is capable of direct interspecies electron transfer (DIET, but not with Methanospirillium hungatei capable only of H2 or formate transfer. Conductive granular activated carbon (GAC stimulated metabolism of the G. hydrogenophilus - M. barkeri co-culture, consistent with electron exchange via DIET. These findings, coupled with the previous finding that G. metallireducens and G. sulfurreducens are also capable of DIET, suggest that evolution to optimize DIET has fortuitiously conferred the capability for high-density current production to some Geobacter species.
Deng, Yongcui; Cui, Xiaoyong; Hernández, Marcela; Dumont, Marc G
2014-01-01
The wetlands of the Qinghai-Tibetan Plateau are believed to play an important role in global nutrient cycling, but the composition and diversity of microorganisms in this ecosystem are poorly characterized. An understanding of the effects of geography and microtopography on microbial populations will provide clues to the underlying mechanisms that structure microbial communities. In this study, we used pyrosequencing-based analysis of 16S rRNA gene sequences to assess and compare the composition of soil microbial communities present in hummock and hollow soils from three wetlands (Dangxiong, Hongyuan and Maduo) on the Qinghai-Tibetan Plateau, the world's highest plateau. A total of 36 bacterial phyla were detected. Proteobacteria (34.5% average relative abundance), Actinobacteria (17.3%) and Bacteroidetes (11%) had the highest relative abundances across all sites. Chloroflexi, Acidobacteria, Verrucomicrobia, Firmicutes, and Planctomycetes were also relatively abundant (1-10%). In addition, archaeal sequences belonging to Euryarchaea, Crenarchaea and Thaumarchaea were detected. Alphaproteobacteria sequences, especially of the order Rhodospirillales, were significantly more abundant in Maduo than Hongyuan and Dangxiong wetlands. Compared with Hongyuan soils, Dangxiong and Maduo had significantly higher relative abundances of Gammaproteobacteria sequences (mainly order Xanthomonadales). Hongyuan wetland had a relatively high abundance of methanogens (mainly genera Methanobacterium, Methanosarcina and Methanosaeta) and methanotrophs (mainly Methylocystis) compared with the other two wetlands. Principal coordinate analysis (PCoA) indicated that the microbial community structure differed between locations and microtopographies and canonical correspondence analysis indicated an association between microbial community structure and soil properties or geography. These insights into the microbial community structure and the main controlling factors in wetlands of the Qinghai
He, Z X; Qiao, J Y; Yan, Q X; Tan, Z L; Wang, M
2018-04-12
Methane produced from formate is one of the important methanogensis pathways in the rumen. However, quantitative information of CH4 production from formate has been rarely reported. The aim of this study was to characterize the conversion rate (CR) of formic acid into CH4 and CO2 by rumen microorganisms. Ground lucerne hay was incubated with buffered ruminal fluid for 6, 12, 24 and 48 h. Before the incubation, 13C-labeled H13COOH was also supplied into the incubation bottle at a dose of 0, 1.5, 2.2 or 2.9 mg/g of DM substrate. There were no interactions (P>0.05) between dose and incubation time for all variables evaluated. When expressed as an absolute amount (ml in gas sample) or a relative CR (%), both 13CH4 and 13CO2 production quadratically increased (P<0.01) with the addition of H13COOH. The total 13C (13CH4 and 13CO2) CR was also quadratically increased (P<0.01) when H13COOH was added. Moreover, formate addition linearly decreased (P<0.031) the concentrations of NH3-N, total and individual volatile fatty acids (acetate, propionate and butyrate), and quadratically decreased (P<0.014) the populations of protozoa, total methanogens, Methanosphaera stadtmanae, Methanobrevibacter ruminantium M1, Methanobrevibacter smithii and Methanosarcina barkeri. In summary, formate affects ruminal fermentation and methanogenesis, as well as the rumen microbiome, in particular microorganisms which are directly or indirectly involved in ruminal methanogenesis. This study provides quantitative verification for the rapid dissimilation of formate into CH4 and CO2 by rumen microorganisms.
The Effects of Perchlorates on the Permafrost Methanogens: Implication for Autotrophic Life on Mars.
Shcherbakova, Viktoria; Oshurkova, Viktoria; Yoshimura, Yoshitaka
2015-09-09
The terrestrial permafrost represents a range of possible cryogenic extraterrestrial ecosystems on Earth-like planets without obvious surface ice, such as Mars. The autotrophic and chemolithotrophic psychrotolerant methanogens are more likely than aerobes to function as a model for life forms that may exist in frozen subsurface environments on Mars, which has no free oxygen, inaccessible organic matter, and extremely low amounts of unfrozen water. Our research on the genesis of methane, its content and distribution in permafrost horizons of different ages and origin demonstrated the presence of methane in permanently frozen fine-grained sediments. Earlier, we isolated and described four strains of methanogenic archaea of Methanobacterium and Methanosarcina genera from samples of Pliocene and Holocene permafrost from Eastern Siberia. In this paper we study the effect of sodium and magnesium perchlorates on growth of permafrost and nonpermafrost methanogens, and present evidence that permafrost hydogenotrophic methanogens are more resistant to the chaotropic agent found in Martian soil. In this paper we study the effect of sodium and magnesium perchlorates on the growth of permafrost and nonpermafrost methanogens, and present evidence that permafrost hydogenotrophic methanogens are more resistant to the chaotropic agent found in Martian soil. Furthermore, as shown in the studies strain M2(T) M. arcticum, probably can use perchlorate anion as an electron acceptor in anaerobic methane oxidation. Earth's subzero subsurface environments are the best approximation of environments on Mars, which is most likely to harbor methanogens; thus, a biochemical understanding of these pathways is expected to provide a basis for designing experiments to detect autotrophic methane-producing life forms on Mars.
Schmidt, Jens Ejbye; Ahring, Birgitte Kjær
1999-01-01
Sterile granular sludge was inoculated with either Methanosarcina mazeii S-6, Methanosaeta concilii GP-6, or both species in acetate-fed upflow anaerobic sludge blanket (UASB) reactors to investigate the immobilization patterns and dynamics of aceticlastic methanogens in granular sludge. After several months of reactor operation, the methanogens were immobilized, either separately or together. The fastest immobilization was observed in the reactor containing M. mazeii S-6. The highest effluent concentration of acetate was observed in the reactor with only M. mazeii S-6 immobilized, while the lowest effluent concentration of acetate was observed in the reactor where both types of methanogens were immobilized together. No changes were observed in the kinetic parameters (Ks and μmax) of immobilized M. concilii GP-6 or M. mazeii S-6 compared with suspended cultures, indicating that immobilization does not affect the growth kinetics of these methanogens. An enzyme-linked immunosorbent assay using polyclonal antibodies against either M. concilii GP-6 or M. mazeii S-6 showed significant variations in the two methanogenic populations in the different reactors. Polyclonal antibodies were further used to study the spatial distribution of the two methanogens. M. concilii GP-6 was immobilized only on existing support material without any specific pattern. M. mazeii S-6, however, showed a different immobilization pattern: large clumps were formed when the concentration of acetate was high, but where the acetate concentration was low this strain was immobilized on support material as single cells or small clumps. The data clearly show that the two aceticlastic methanogens immobilize differently in UASB systems, depending on the conditions found throughout the UASB reactor. PMID:10049862
Mulat, Daniel Girma; Jacobi, H. Fabian; Feilberg, Anders; Adamsen, Anders Peter S.; Richnow, Hans-Hermann
2015-01-01
Flexible biogas production that adapts biogas output to energy demand can be regulated by changing feeding regimes. In this study, the effect of changes in feeding intervals on process performance, microbial community structure, and the methanogenesis pathway was investigated. Three different feeding regimes (once daily, every second day, and every 2 h) at the same organic loading rate were studied in continuously stirred tank reactors treating distiller's dried grains with solubles. A larger amount of biogas was produced after feeding in the reactors fed less frequently (once per day and every second day), whereas the amount remained constant in the reactor fed more frequently (every 2 h), indicating the suitability of the former for the flexible production of biogas. Compared to the conventional more frequent feeding regimes, a methane yield that was up to 14% higher and an improved stability of the process against organic overloading were achieved by employing less frequent feeding regimes. The community structures of bacteria and methanogenic archaea were monitored by terminal restriction fragment length polymorphism (T-RFLP) analysis of 16S rRNA and mcrA genes, respectively. The results showed that the composition of the bacterial community varied under the different feeding regimes, and the observed T-RFLP patterns were best explained by the differences in the total ammonia nitrogen concentrations, H2 levels, and pH values. However, the methanogenic community remained stable under all feeding regimes, with the dominance of the Methanosarcina genus followed by that of the Methanobacterium genus. Stable isotope analysis showed that the average amount of methane produced during each feeding event by acetoclastic and hydrogenotrophic methanogenesis was not influenced by the three different feeding regimes. PMID:26497462
The Effects of Perchlorates on the Permafrost Methanogens: Implication for Autotrophic Life on Mars
Directory of Open Access Journals (Sweden)
Viktoria Shcherbakova
2015-09-01
Full Text Available The terrestrial permafrost represents a range of possible cryogenic extraterrestrial ecosystems on Earth-like planets without obvious surface ice, such as Mars. The autotrophic and chemolithotrophic psychrotolerant methanogens are more likely than aerobes to function as a model for life forms that may exist in frozen subsurface environments on Mars, which has no free oxygen, inaccessible organic matter, and extremely low amounts of unfrozen water. Our research on the genesis of methane, its content and distribution in permafrost horizons of different ages and origin demonstrated the presence of methane in permanently frozen fine-grained sediments. Earlier, we isolated and described four strains of methanogenic archaea of Methanobacterium and Methanosarcina genera from samples of Pliocene and Holocene permafrost from Eastern Siberia. In this paper we study the effect of sodium and magnesium perchlorates on growth of permafrost and nonpermafrost methanogens, and present evidence that permafrost hydogenotrophic methanogens are more resistant to the chaotropic agent found in Martian soil. In this paper we study the effect of sodium and magnesium perchlorates on the growth of permafrost and nonpermafrost methanogens, and present evidence that permafrost hydogenotrophic methanogens are more resistant to the chaotropic agent found in Martian soil. Furthermore, as shown in the studies strain M2T M. arcticum, probably can use perchlorate anion as an electron acceptor in anaerobic methane oxidation. Earth’s subzero subsurface environments are the best approximation of environments on Mars, which is most likely to harbor methanogens; thus, a biochemical understanding of these pathways is expected to provide a basis for designing experiments to detect autotrophic methane-producing life forms on Mars.
Structural basis for the site-specific incorporation of lysine derivatives into proteins.
Directory of Open Access Journals (Sweden)
Veronika Flügel
Full Text Available Posttranslational modifications (PTMs of proteins determine their structure-function relationships, interaction partners, as well as their fate in the cell and are crucial for many cellular key processes. For instance chromatin structure and hence gene expression is epigenetically regulated by acetylation or methylation of lysine residues in histones, a phenomenon known as the 'histone code'. Recently it was shown that these lysine residues can furthermore be malonylated, succinylated, butyrylated, propionylated and crotonylated, resulting in significant alteration of gene expression patterns. However the functional implications of these PTMs, which only differ marginally in their chemical structure, is not yet understood. Therefore generation of proteins containing these modified amino acids site specifically is an important tool. In the last decade methods for the translational incorporation of non-natural amino acids using orthogonal aminoacyl-tRNA synthetase (aaRS:tRNAaaCUA pairs were developed. A number of studies show that aaRS can be evolved to use non-natural amino acids and expand the genetic code. Nevertheless the wild type pyrrolysyl-tRNA synthetase (PylRS from Methanosarcina mazei readily accepts a number of lysine derivatives as substrates. This enzyme can further be engineered by mutagenesis to utilize a range of non-natural amino acids. Here we present structural data on the wild type enzyme in complex with adenylated ε-N-alkynyl-, ε-N-butyryl-, ε-N-crotonyl- and ε-N-propionyl-lysine providing insights into the plasticity of the PylRS active site. This shows that given certain key features in the non-natural amino acid to be incorporated, directed evolution of this enzyme is not necessary for substrate tolerance.
van der Meer, Quinten H. A.; Klaver, Martijn; Reisberg, Laurie; Riches, Amy J. V.; Davies, Gareth R.
2017-11-01
Re-Os and platinum group element analyses are reported for peridotite xenoliths from the 533 Ma Venetia kimberlite cluster situated in the Limpopo Mobile Belt, the Neoarchaean collision zone between the Kaapvaal and Zimbabwe Cratons. The Venetian xenoliths provide a rare opportunity to examine the state of the cratonic lithosphere prior to major regional metasomatic disturbance of Re-Os systematics throughout the Phanerozoic. The 32 studied xenoliths record Si-enrichment that is characteristic of the Kaapvaal lithospheric mantle and can be subdivided into five groups based on Re-Os analyses. The most pristine group I samples (n = 13) display an approximately isochronous relationship and fall on a 3.28 ± 0.17 Ga (95 % conf. int.) reference line that is based on their mean TMA age. This age overlaps with the formation age of the Limpopo crust at 3.35-3.28 Ga. The group I samples derive from ∼50 to ∼170 km depth, suggesting coeval melt depletion of the majority of the Venetia lithospheric mantle column. Group II and III samples have elevated Re/Os due to Re addition during kimberlite magmatism. Group II has otherwise undergone a similar evolution as the group I samples with overlapping 187Os/188Os at eruption age: 187Os/188OsEA, while group III samples have low Os concentrations, unradiogenic 187Os/188OsEA and were effectively Re-free prior to kimberlite magmatism. The other sample groups (IV and V) have disturbed Re-Os systematics and provide no reliable age information. A strong positive correlation is recorded between Os and Re concentrations for group I samples, which is extended to groups II and III after correction for kimberlite addition. This positive correlation precludes a single stage melt depletion history and indicates coupled remobilisation of Re and Os. The combination of Re-Os mobility, preservation of the isochronous relationship, correlation of 187Os/188Os with degree of melt depletion and lack of radiogenic Os addition puts tight constraints on the formation and subsequent evolution of Venetia lithosphere. First, melt depletion and remobilisation of Re and Os must have occurred within error of the 3.28 Ga mean TMA age. Second, the refractory peridotites contain significant Re despite recording >40 % melt extraction. Third, assuming that Si-enrichment and Re-Os mobility in the Venetia lithospheric mantle were linked, this process must have occurred within ∼100 Myr of initial melt depletion in order to preserve the isochronous relationship. Based on the regional geological evolution, we propose a rapid recycling model with initial melt depletion at ∼3.35 Ga to form a tholeiitic mafic crust that is recycled at ∼3.28 Ga, resulting in the intrusion of a TTG suite and Si-enrichment of the lithospheric mantle. The non-zero primary Re contents of the Venetia xenoliths imply that TRD model ages significantly underestimate the true depletion age even for highly depleted peridotites. The overlap of the ∼2.6 Ga TRD ages with the time of the Kaapvaal-Limpopo collision is purely fortuitous and has no geological significance. Hence, this study underlines the importance of scrutiny if age information is to be derived from whole rock Re-Os analyses.
Surface Wave Analysis of Regional Earthquakes in the Eastern Rift System (Africa)
Oliva, S. J. C.; Guidarelli, M.; Ebinger, C. J.; Roecker, S. W.; Tiberi, C.
2015-12-01
The Northern Tanzania Divergence (NTD), the youngest part of the East African Rift System, presents the opportunity to obtain insights about the birth and early stages of rifting before it progresses to mature rifting and seafloor spreading. This region is particularly interesting because the Eastern rift splits into three arms in this area and develops in a region of thick and cold lithosphere, amid the Archaean Tanzanian craton and the Proterozoic orogenic belt (the Masai block). We analyzed about two thousand seismic events recorded by the 39 broadband stations of the CRAFTI network during its two-year deployment in the NTD area in 2013 to 2014. We present the results of surface wave tomographic inversion obtained from fundamental-mode Rayleigh waves for short periods (between 4 to 14 seconds). Group velocity dispersion curves obtained via multiple filter analysis are path-averaged and inverted to produce 0.1º x 0.1º nodal grid tomographic maps for discrete periods using a 2D generalization of the Backus and Gilbert method. To quantify our results in terms of S-wave velocity structure the average group velocity dispersion curves are then inverted, using a linearized least-squares inversion scheme, in order to obtain the shear wave velocity structure for the upper 20 km of the crust. Low velocity anomalies are observed in the region 50 km south of Lake Natron, as well as in the area of the Ngorongoro crater. The implications of our results for the local tectonics and the development of the rifting system will be discussed in light of the growing geophysical database from this region.
Sulfate-Reducing Prokaryotes from North Sea Oil reservoirs; organisms, distribution and origin
Energy Technology Data Exchange (ETDEWEB)
Beeder, Janiche
1997-12-31
During oil production in the North Sea, anaerobic seawater is pumped in which stimulates the growth of sulphate-reducing prokaryotes that produce hydrogen sulphide. This sulphide causes major health hazards, economical and operational problems. As told in this thesis, several strains of sulphate reducers have been isolated from North Sea oil field waters. Antibodies have been produced against these strains and used to investigate the distribution of sulphate reducers in a North Sea oil reservoir. The result showed a high diversity among sulphate reducers, with different strains belonging to different parts of the reservoir. Some of these strains have been further characterized. The physiological and phylogenetic characterization showed that strain 7324 was an archaean. Strain A8444 was a bacterium, representing a new species of a new genus. A benzoate degrading sulphate reducing bacterium was isolated from injection water, and later the same strain was detected in produced water. This is the first field observations indicating that sulphate reducers are able to penetrate an oil reservoir. It was found that the oil reservoir contains a diverse population of thermophilic sulphate reducers able to grow on carbon sources in the oil reservoir, and to live and grow in this extreme environment of high temperature and pressure. The mesophilic sulphate reducers are established in the injection water system and in the reservoir near the injection well during oil production. The thermophilic sulphate reducers are able to grow in the reservoir prior to, as well as during production. It appears that the oil reservoir is a natural habitat for thermophilic sulphate reducers and that they have been present in the reservoir long before production started. 322 refs., 9 figs., 11 tabs.
Sulfate-Reducing Prokaryotes from North Sea Oil reservoirs; organisms, distribution and origin
Energy Technology Data Exchange (ETDEWEB)
Beeder, Janiche
1996-12-31
During oil production in the North Sea, anaerobic seawater is pumped in which stimulates the growth of sulphate-reducing prokaryotes that produce hydrogen sulphide. This sulphide causes major health hazards, economical and operational problems. As told in this thesis, several strains of sulphate reducers have been isolated from North Sea oil field waters. Antibodies have been produced against these strains and used to investigate the distribution of sulphate reducers in a North Sea oil reservoir. The result showed a high diversity among sulphate reducers, with different strains belonging to different parts of the reservoir. Some of these strains have been further characterized. The physiological and phylogenetic characterization showed that strain 7324 was an archaean. Strain A8444 was a bacterium, representing a new species of a new genus. A benzoate degrading sulphate reducing bacterium was isolated from injection water, and later the same strain was detected in produced water. This is the first field observations indicating that sulphate reducers are able to penetrate an oil reservoir. It was found that the oil reservoir contains a diverse population of thermophilic sulphate reducers able to grow on carbon sources in the oil reservoir, and to live and grow in this extreme environment of high temperature and pressure. The mesophilic sulphate reducers are established in the injection water system and in the reservoir near the injection well during oil production. The thermophilic sulphate reducers are able to grow in the reservoir prior to, as well as during production. It appears that the oil reservoir is a natural habitat for thermophilic sulphate reducers and that they have been present in the reservoir long before production started. 322 refs., 9 figs., 11 tabs.
Cawood, Peter A.; Johnson, Michael R. W.; Nemchin, Alexander A.
2007-03-01
SHRIMP U-Pb dating of zircons from a peralkaline S-type Lesser Himalayan granite from the Kathmandu region, Nepal indicate an age of emplacement of 475 Ma. The granites along with metasedimentary xenoliths show a similar signature of inherited detrital zircon ages ranging from Archaean to early Palaeozoic with prominent late Mesoproterozoic (Grenvillian) and Neoproterozoic (Pan-African) age peaks and have a maximum age of 500 Ma based on the youngest detrital grains. Deformation structures in xenoliths are truncated by the granite and along with the granites are assigned to a Cambro-Ordovician orogenic event, herein termed the Bhimphedian Orogeny that can be traced across the Himalaya from Pakistan to the eastern Himalaya and possibly extends west into Afghanistan. We interpret the orogeny as being related to Andean-type orogenic activity on the northern margin of the Indian continent, following Gondwana assembly. The magmatic arc was associated with andesitic and basaltic volcanism and was active from c. 530 to 490 Ma. The arc activity overlaps with, and is succeeded by, regional deformation, crustal melting and S-type granite emplacement that extended to 470 Ma. Orogenic activity was driven by coupling across the plate margin either during on-going subduction or through accretion of microcontinental ribbons, possibly represented by the Lhasa and Qiangtang blocks. It represents the termination of an orogenic cycle, termed the North Indian Orogen that commenced with Neoproterozoic rifting and passive margin development and terminated with the Bhimphedian Orogeny. This was succeeded by a return to passive margin setting along the northern Indian margin of Gondwana which continued until the Cenozoic Himalayan Orogeny.
Energy Technology Data Exchange (ETDEWEB)
Hansoti, S K; Sinha, D K [Department of Atomic Energy, Nagpur (India). Atomic Minerals Div.
1995-10-01
The Khairagarh basin having late Archaean- early Proterozoic basement is filled up by middle Proterozoic Khairagarh group volcano - sedimentary sequence, laid in the Kotri rift zone (KRZ) with imprints of repetitive volcanic, plutonic and tectonic activities. A strong thermal imprint of {approx} 1.5 Ga has been recorded in rocks of the basin that could be an effect of copious outpouring of basalts, dacites, ignimbrites, together with the emplacements of stocks of gabbros, gabbroic dolerites, dolerites, granites, granophyres, felsites, aplites, and quartz veins. Some of the basement rocks are enriched in Fe, Cu and other base metals and have been emplaced and assimilated by the volcano- plutonic rocks of the Nandgaon group and Malanjkhand granitoids. The Nandgaon group rocks and the Malanjkhand granitoids have anomalous intrinsic abundance of U, REE, Cu, Fe and quite a few metals in different sectors. Thermo-tectonic ({approx} 1.5 Ga) reactivation event(s) along the KRZ apart from facilitating formation of agglomerates, ignimbrites and tectonic breccias has promoted emplacement of plutonic and subvolcanic phases and their metasomatising and hydrothermal metal bearing fluids. In the Malanjkhand complex sector Cu{+-}Mo{+-}Fe{+-}Ag{+-}Au{+-}REE{+-}Zn metallisation and in the Dongargarh Massif sector U{+-}Th{+-}F{+-}Fe{+-}Pb{+-}Zn{+-}Cu{+-}REE{+-}Zr metallisation are manifested. The detection of Fe+U+REE {+-}Cu{+-}Ni metallisation in the Bortalao sandstones of the Dongargaon - Lohara area, located in between Malanjkhand ore zone and the Chandidongri (Dongargarh granite hosted) fluorite-rich and Pb{+-}Zn{+-}Cu{+-}U - bearing ore zone, considered to lie on the same (Malanjkhand - Chandidongri) fault/shear lineament is rated highly significant. (Abstract Truncated)
Lie, Thomas J; Wood, Gwendolyn E; Leigh, John A
2005-02-18
The methanogenic archaean Methanococcus maripaludis can use ammonia, alanine, or dinitrogen as a nitrogen source for growth. The euryarchaeal nitrogen repressor NrpR controls the expression of the nif (nitrogen fixation) operon, resulting in full repression with ammonia, intermediate repression with alanine, and derepression with dinitrogen. NrpR binds to two tandem operators in the nif promoter region, nifOR(1) and nifOR(2). Here we have undertaken both in vivo and in vitro approaches to study the way in which NrpR, nifOR(1), nifOR(2), and the effector 2-oxoglutarate (2OG) combine to regulate nif expression, leading to a comprehensive understanding of this archaeal regulatory system. We show that NrpR binds as a dimer to nifOR(1) and cooperatively as two dimers to both operators. Cooperative binding occurs only with both operators present. nifOR(1) has stronger binding and by itself can mediate the repression of nif transcription during growth on ammonia, unlike the weakly binding nifOR(2). However, nifOR(2) in combination with nifOR(1) is critical for intermediate repression during growth on alanine. Accordingly, NrpR binds to both operators together with higher affinity than to nifOR(1) alone. NrpR responds directly to 2OG, which weakens its binding to the operators. Hence, 2OG is an intracellular indicator of nitrogen deficiency and acts as an inducer of nif transcription via NrpR. This model is upheld by the recent finding (J. A. Dodsworth and J. A. Leigh, submitted for publication) in our laboratory that 2OG levels in M. maripaludis vary with growth on different nitrogen sources.
Heinson, G.
2005-12-01
The iron-oxide-copper-gold (IOCG) Olympic Dam (OD) deposit, situated along the margin of the Proterozoic Gawler Craton, South Australia, is the world's largest uranium deposit, and sixth largest copper deposit; it also contains significant reserves of gold, silver and rare-earth elements (REE). Gaining a better understanding of the mechanisms for genesis of the economic mineralisation is fundamental for defining exploration models in similar crustal-settings. To delineate crustal structures that may constrain mineral system fluid pathways, coincident deep crustal seismic and magnetotelluric (MT) transects were obtained along a 220 km section that crosses OD and the major crustal boundaries. We present results from 58 long-period (10-104 s) MT sites, with site spacing of 5 to 10 km. A 2D inversion of all MT data to a depth of 100 km shows four notable features: (a) sedimentary cover sequences with low resistivity (1000 Ω.m) Archaean crustal core, from a more conductive crust to the north (typically <500 Ω.m); (c) to the north of OD, the crust to about 20 km is quite resistive (~1000 Ω.m), but the lower crust is much more conductive (<100 Ω.m); and (d) beneath OD, we image a low-resistivity region (<100 Ω.m) throughout the crust, coincident with a seismically transparent region. We argue that the cause of the low-resistivity and low-reflectivity region beneath OD may be due to the upward movement of crustal-volatiles that have deposited conductive graphite mineralisation along grain boundaries, simultaneously annihilating acoustic impedance boundaries. The source of the volatiles may be from the mantle-degassing or retrograde metamorphism of the lower crust associated with Proterozoic crustal deformation.
International Nuclear Information System (INIS)
Paquette, J.L.; Eidgenoessische Technische Hochschule, Zurich; Menot, R.P.; Peucat, J.J.
1989-01-01
A geochemical and geochronological study of the Alpine External Crystalline Massifs (AECM) of Aiguilles Rouges, Belledonne and Argentera was undertaken in order to constrain the geodynamic evolution of this segment of the Variscan foldbelt. Another aim of the study is to characterize the behaviour of isotopic markers, in particular the U-Pb zircon system, under high-grade metamorphic conditions. The whole-rock geochemistry of eclogites and amphibolites was investigated using major and trace element (including the REE) analytical techniques; isotopic studies were performed by application of the Sm-Nd whole-rock and U-Pb zircon methods. In terms of regional geological history, the early development of metamorphic and magmatic activity in the AECM is typical of the extensional tectonic regime observed throughout the Variscan foldbelt during the Cambro-Ordovician (i.e. basic magmatism dated at 475-450 Ma). The composition of the metabasic rocks is closely similar to tholeiites emplaced into thinned continental crust which are generally associated with the initial stages of oceanic rifting. The source regions for these metabasics are characterized by initial ε Nd values between +6 and +8, suggesting depleted mantle sources influenced by a weak crustal component and/or the existence of a metasomatised lithosphere. The multi-stage eclogite-facies metamorphism is dated at 425-395 Ma (i.e. Silurian). An application of the U-Pb method, associated with the artificial abrasion of zircon grains, has led to the recognition of a weak crustal contamination in the metabasic protoliths. This is implied by the Archaean and Lower Proterozoic upper intercepts on Concordia - devoid of geological significance - which reflect the presence of a pre-existing basement to the AECM. (orig./WL)
Smith, Joseph V.
1998-01-01
Catalysis at mineral surfaces might generate replicating biopolymers from simple chemicals supplied by meteorites, volcanic gases, and photochemical gas reactions. Many ideas are implausible in detail because the proposed mineral surfaces strongly prefer water and other ionic species to organic ones. The molecular sieve silicalite (Union Carbide; = Al-free Mobil ZSM-5 zeolite) has a three-dimensional, 10-ring channel system whose electrically neutral Si-O surface strongly adsorbs organic species over water. Three -O-Si tetrahedral bonds lie in the surface, and the fourth Si-O points inwards. In contrast, the outward Si-OH of simple quartz and feldspar crystals generates their ionic organophobicity. The ZSM-5-type zeolite mutinaite occurs in Antarctica with boggsite and tschernichite (Al-analog of Mobil Beta). Archean mutinaite might have become de-aluminated toward silicalite during hot/cold/wet/dry cycles. Catalytic activity of silicalite increases linearly with Al-OH substitution for Si, and Al atoms tend to avoid each other. Adjacent organophilic and catalytic Al-OH regions in nanometer channels might have scavenged organic species for catalytic assembly into specific polymers protected from prompt photochemical destruction. Polymer migration along weathered silicic surfaces of micrometer-wide channels of feldspars might have led to assembly of replicating catalytic biomolecules and perhaps primitive cellular organisms. Silica-rich volcanic glasses should have been abundant on the early Earth, ready for crystallization into zeolites and feldspars, as in present continental basins. Abundant chert from weakly metamorphosed Archaean rocks might retain microscopic clues to the proposed mineral adsorbent/catalysts. Other framework silicas are possible, including ones with laevo/dextro one-dimensional channels. Organic molecules, transition-metal ions, and P occur inside modern feldspars. PMID:9520372
Giese, Jörg; Schreurs, Guido; Berger, Alfons; Herwegh, Marco
2017-09-01
Across the crystalline basement of Madagascar, late Archaean rocks of the Antananarivo Block are tectonically overlain by Proterozoic, predominantly metasedimentary units of the Ikalamavony and Itremo Groups of the Southwest Madagascar Block. The generally west-dipping tectonic contact can be traced for more than 750 km from NW to SE and is referred to here as the Itremo-Ikalamavony thrust. The basal units of the SW Madagascar Block comprise metasedimentary quartzites with the potential to preserve a multistage deformation history in their microstructures. Previous studies suggest contrasting structural evolutions for this contact, including eastward thrusting, top-to-the-west directed extension and right-lateral strike-slip deformation during the late Neoproterozoic/Ediacaran. In this study, we integrate remote sensing analyses, structural and petrological fieldwork, as well as microstructural investigations of predominantly quartz mylonites from the central southern segment of the contact between Ankaramena and Maropaika. In this area, two major phases of ductile deformation under high-grade metamorphic conditions occurred in latest Neoproterozoic/early Phanerozoic times. A first (Andreaba) phase produces a penetrative foliation, which is parallel to the contact between the two blocks and contemporaneous with widespread magmatism. A second (Ihosy) phase of deformation folds Andreaba-related structures. The investigated (micro-)structures indicate that (a) juxtaposition of both blocks possibly already occurred prior to the Andreaba phase, (b) (re-)activation with top-to-the-east thrusting took place during the latest stages of the Andreaba phase, (c) the Ihosy phase resulted in regional-scale open folding of the tectonic contact and (d) reactivation of parts of the contact took place at distinctively lower temperatures post-dating the major ductile deformations.
Cuddapah basin and its environs as first-order uranium target in the Proterozoics of India
International Nuclear Information System (INIS)
Sharma, Mithilesh; Rai, A.K.; Nagabhushana, J.C.; Vasudeva Rao, M.; Sinha, R.M.
1995-01-01
In peninsular India the middle Proterozoic intracratonic Cuddapah basin and its environs possess good geological favorability for several types of uranium deposits. Investigations so far have revealed the strata bound carbonate-hosted uranium mineralization in the Vempalle dolomitic limestone (e.g. Tummallapalle) and in the Pulivendla quartzite, confined to the lower part of the Cuddapah supergroup, and the structurally controlled uranium mineralization in the late Archaean/early Proterozoic granitoids and metamorphics along eastern (e.g. Kasturigattu), south-western (e.g. Sanipaya and T-Sanipaya and T-Sundapalle), and northern margins (e.g. Lambapur-Yellapur) of the Cuddapah basin. Based on the present level of work within the Cuddapah Basin and its environs, the following favourable locales and prospecting techniques have been suggested to identify the unconformity/vein-type high grade uranium deposits. (i) Detailed geological examination of the contact of basement with mid-Proterozoic Gulcheru/Nagari quartzite for locating unconformity-type uranium mineralisation. (ii) Extensive ground radiometric survey along the unconformity between basement granite and outliers of Srisailam formation, Banganpalle formation, Cumbum/Pullampet formation and Bairenkonda formation along northern and eastern margins of Cuddapah basin. (iii) Examination of the contact zone of the igneous intrusives (syenite and granite) into the Cumbum formation of central and northeastern parts of the basin e.g. Chelima - Giddalur area. (iv) Geophysical survey like resistivity (viz. SP, IP, TEM) to (a) delineate the concealed sulphide-rich zones along the prominent structures of the basinal margins and (b) study the possible existence under cover of quartzite and their subsurface behaviour for the fracture zones identified in the T. Sundapalle-Sanipaya, Pincha, Maddireddigaripalle, Chakrayapeta and Vepamanipeta areas. (author). 22 refs., 1 fig., 3 tabs
Biggin, A.J.; Wit, M.J. de; Langereis, C.G.; Zegers, T.E.; Voute, S.; Dekkers, M.J.; Drost, K.
2011-01-01
Palaeomagnetic data from the Palaeoarchaean Era (3.2–3.6 Ga) have the potential to provide us with a great deal of information about early conditions within, and processes affecting, the Earth's core, mantle, and surface environment. Here we present new data obtained from some of the oldest
International Nuclear Information System (INIS)
Borba Junior, Palvo J.; Azevedo, Heliana de; Ronqui, Leilane Barbosa
2011-01-01
Bortolan reservoir (BR), part of the Ribeirao das Antas Hydrographic Sub-Basin, is a dam located in the Pocos de Caldas Plateau region and characterized by the reception of industrial and domestic residue discharge from the city of Pocos de Caldas. Another important dam, found within the same hydrographic sub-basin and the focus of many studies as well, is Antas reservoir (AR), situated on the proximities of a uranium mine (Brazilian Nuclear Industries Ore Treatment Unit - UTM/INB), and the receiver of treated radioactive effluents originated there. The UTM/INB Pit Mine (PM) is an artificial pond characterized by its acidity and elevated electrical conductivity, besides the presence of radioactive and stable metals. The focus of this study is to determine the phylogenetic classification of the Bacteria and Archaea domains, in addition to quantify the bacterial community at points PM, BR and AR, seeking to compare the data to results from other analyzed water bodies. These microorganisms can be determined with the use of molecular techniques that allow their phylogenetic identification, such as the Fluorescent in situ Hybridization (FISH) that detects the presence of specific organisms' DNA or RNA. In the FISH method, probes produced from each domain's DNA fragments are used (EUB338 and ARC915), allowing the identification of oligonucleotide sequences with a higher degree of similarity. The bacterial cells quantification is verified by the use of the DAPI (4-6-diamidino-2-phenylindole) stain, allowing the density calculation of the bacteria found in the samples from AR and BR, as well as from the PM. (author)
Jang, Hyun Min; Ha, Jeong Hyub; Park, Jong Moon; Kim, Mi-Sun; Sommer, Sven G
2015-04-15
A combined mesophilic anaerobic-thermophilic aerobic process was used to treat high-strength food wastewater in this study. During the experimental period, most of solid residue from the mesophilic anaerobic reactor (R1) was separated by centrifugation and introduced into the thermophilic aerobic reactor (R2) for further digestion. Then, thermophilic aerobically-digested sludge was reintroduced into R1 to enhance reactor performance. The combined process was operated with two different Runs: Run I with hydraulic retention time (HRT) = 40 d (corresponding OLR = 3.5 kg COD/m(3) d) and Run II with HRT = 20 d (corresponding OLR = 7 kg COD/m(3)). For a comparison, a single-stage mesophilic anaerobic reactor (R3) was operated concurrently with same OLRs and HRTs as the combined process. During the overall digestion, all reactors showed high stability without pH control. The combined process demonstrated significantly higher organic matter removal efficiencies (over 90%) of TS, VS and COD and methane production than did R3. Quantitative real-time PCR (qPCR) results indicated that higher populations of both bacteria and archaea were maintained in R1 than in R3. Pyrosequencing analysis revealed relatively high abundance of phylum Actinobacteria in both R1 and R2, and a predominance of phyla Synergistetes and Firmicutes in R3 during Run II. Furthermore, R1 and R2 shared genera (Prevotella, Aminobacterium, Geobacillus and Unclassified Actinobacteria), which suggests synergy between mesophilic anaerobic digestion and thermophilic aerobic digestion. For archaea, in R1 methanogenic archaea shifted from genus Methanosaeta to Methanosarcina, whereas genera Methanosaeta, Methanobacterium and Methanoculleus were predominant in R3. The results demonstrated dynamics of key microbial populations that were highly consistent with an enhanced reactor performance of the combined process. Copyright © 2015 Elsevier Ltd. All rights reserved.
Walter, Andreas; Silberberger, Sandra; Juárez, Marina Fernández-Delgado; Insam, Heribert; Franke-Whittle, Ingrid H
2016-01-01
Cellulose-containing waste products from the agricultural or industrial sector are potentially one of the largest sources of renewable energy on earth. In this study, the biomethane potential (BMP) of two types of industrial paper wastes, wood and pulp residues (WR and PR, respectively), were evaluated under both mesophilic and thermophilic conditions, and various pretreatment methods were applied in the attempt to increase the methane potential during anaerobic digestion. The methanogenic community composition was investigated with denaturing gradient gel electrophoresis (DGGE) and the ANAEROCHIP microarray, and dominant methanogens were quantitated using quantitative PCR. All pretreatments investigated in this study with the exception of the alkaline pretreatment of PR were found to increase the BMP of two paper industry wastes. However, the low recalcitrance level of the PR resulted in the pretreatments being less effective in increasing BMP when compared with those for WR. These results were supported by the physico-chemical data. A combined application of ultrasound and enzymatic pretreatment was found to be the best strategy for increasing methane yields. The retention time of substrates in the reactors strongly influenced the BMP of wastes subjected to the different pretreatments. In sludges from both paper wastes subjected to the various pretreatments, mixotrophic Methanosarcina species were found to dominate the community, accompanied by a consortium of hydrogenotrophic genera. Pretreating industrial paper wastes could be a potentially viable option for increasing the overall degradation efficiency and decreasing reactor retention time for the digestion of complex organic matter such as lignocellulose or hemicellulose. This would help reduce the environmental burden generated from paper production. Although there were minor differences in the methanogenic communities depending on the temperature of anaerobic digestion, there was little effect of substrate
Directory of Open Access Journals (Sweden)
Jemaneh eZeleke
2013-08-01
Full Text Available The effect of plant invasion on the microorganisms of soil sediments is very important for estuary ecology. The community structures of methanogens and sulfate-reducing bacteria (SRB as a function of Spartina alterniflora invasion in Phragmites australis-vegetated sediments of the Dongtan wetland in the Yangtze River estuary, China, were investigated using 454 pyrosequencing and quantitative real-time PCR (qPCR of the methyl coenzyme M reductase A (mcrA and dissimilatory sulfite-reductase (dsrB genes. Sediment samples were collected from two replicate locations, and each location included three sampling stands each covered by monocultures of P. australis, S. alterniflora and both plants (transition stands, respectively. qPCR analysis revealed higher copy numbers of mcrA genes in sediments from S. alterniflora stands than P. australis stands (5- and 7.5-fold more in the spring and summer, respectively, which is consistent with the higher methane flux rates measured in the S. alterniflora stands (up to 8.01 ± 5.61 mg m-2 h-1. Similar trends were observed for SRB, and they were up to two orders of magnitude higher than the methanogens. Diversity indices indicated a lower diversity of methanogens in the S. alterniflora stands than the P. australis stands. In contrast, insignificant variations were observed in the diversity of SRB with the invasion. Although Methanomicrobiales and Methanococcales, the hydrogenotrophic methanogens, dominated in the salt marsh, Methanomicrobiales displayed a slight increase with the invasion and growth of S. alterniflora, whereas the later responded differently. Methanosarcina, the metabolically diverse methanogens, did not vary with the invasion of, but Methanosaeta, the exclusive acetate utilizers, appeared to increase with S. alterniflora invasion. In SRB, sequences closely related to the families Desulfobacteraceae and Desulfobulbaceae dominated in the salt marsh, although they displayed minimal changes with the S
Directory of Open Access Journals (Sweden)
Pei-Ling eWang
2014-03-01
Full Text Available This study analyzed cored sediments retrieved from sites distributed across a transect of the Lei-Gong-Hou mud volcanoes in eastern Taiwan to uncover the spatial distributions of biogeochemical processes and community assemblages involved in methane cycling. The profiles of methane concentration and carbon isotopic composition revealed various orders of the predominance of specific methane-related metabolisms along depth. At a site proximal to the bubbling pool, the methanogenic zone was sandwiched by the anaerobic methanotrophic zones. For two sites distributed toward the topographic depression, the methanogenic zone overlaid the anaerobic methanotrophic zone. The predominance of anaerobic methanotrophy at specific depth intervals is supported by the enhanced copy numbers of the ANME-2a 16S rRNA gene and coincides with high dissolved Fe/Mn concentrations and copy numbers of the Desulfuromonas/Pelobacter 16S rRNA gene. Assemblages of 16S rRNA and mcrA genes revealed that methanogenesis was mediated by Methanococcoides and Methanosarcina. pmoA genes and a few 16S rRNA genes related to aerobic methanotrophs were detected in limited numbers of subsurface samples. While dissolved Fe/Mn signifies the presence of anaerobic metabolisms near the surface, the correlations between geochemical characteristics and gene abundances, and the absence of aerobic methanotrophs in top sediments suggest that anaerobic methanotrophy is potentially dependent on iron/manganese reduction and dominates over aerobic methanotrophy for the removal of methane produced in situ or from a deep source. Near-surface methanogenesis contributes to the methane emissions from mud platform. The alternating arrangements of methanogenic and methanotrophic zones at different sites suggest that the interactions between mud deposition, evaporation, oxidation and fluid transport modulate the assemblages of microbial communities and methane cycling in different compartments of terrestrial
Directory of Open Access Journals (Sweden)
Yongcui Deng
Full Text Available The wetlands of the Qinghai-Tibetan Plateau are believed to play an important role in global nutrient cycling, but the composition and diversity of microorganisms in this ecosystem are poorly characterized. An understanding of the effects of geography and microtopography on microbial populations will provide clues to the underlying mechanisms that structure microbial communities. In this study, we used pyrosequencing-based analysis of 16S rRNA gene sequences to assess and compare the composition of soil microbial communities present in hummock and hollow soils from three wetlands (Dangxiong, Hongyuan and Maduo on the Qinghai-Tibetan Plateau, the world's highest plateau. A total of 36 bacterial phyla were detected. Proteobacteria (34.5% average relative abundance, Actinobacteria (17.3% and Bacteroidetes (11% had the highest relative abundances across all sites. Chloroflexi, Acidobacteria, Verrucomicrobia, Firmicutes, and Planctomycetes were also relatively abundant (1-10%. In addition, archaeal sequences belonging to Euryarchaea, Crenarchaea and Thaumarchaea were detected. Alphaproteobacteria sequences, especially of the order Rhodospirillales, were significantly more abundant in Maduo than Hongyuan and Dangxiong wetlands. Compared with Hongyuan soils, Dangxiong and Maduo had significantly higher relative abundances of Gammaproteobacteria sequences (mainly order Xanthomonadales. Hongyuan wetland had a relatively high abundance of methanogens (mainly genera Methanobacterium, Methanosarcina and Methanosaeta and methanotrophs (mainly Methylocystis compared with the other two wetlands. Principal coordinate analysis (PCoA indicated that the microbial community structure differed between locations and microtopographies and canonical correspondence analysis indicated an association between microbial community structure and soil properties or geography. These insights into the microbial community structure and the main controlling factors in wetlands of
Shi, Xuchuan; Guo, Xianglin; Zuo, Jiane; Wang, Yajiao; Zhang, Mengyu
2018-05-01
Renewable energy recovery from organic solid waste via anaerobic digestion is a promising way to provide sustainable energy supply and eliminate environmental pollution. However, poor efficiency and operational problems hinder its wide application of anaerobic digestion. The effects of two key parameters, i.e. temperature and substrate characteristics on process stability and microbial community structure were studied using two lab-scale anaerobic reactors under thermophilic and mesophilic conditions. Both the reactors were fed with food waste (FW) and wheat straw (WS). The organic loading rates (OLRs) were maintained at a constant level of 3 kg VS/(m 3 ·d). Five different FW:WS substrate ratios were utilized in different operational phases. The synergetic effects of co-digestion improved the stability and performance of the reactors. When FW was mono-digested, both reactors were unstable. The mesophilic reactor eventually failed due to volatile fatty acid accumulation. The thermophilic reactor had better performance compared to mesophilic one. The biogas production rate of the thermophilic reactor was 4.9-14.8% higher than that of mesophilic reactor throughout the experiment. The shifts in microbial community structures throughout the experiment in both thermophilic and mesophilic reactors were investigated. With increasing FW proportions, bacteria belonging to the phylum Thermotogae became predominant in the thermophilic reactor, while the phylum Bacteroidetes was predominant in the mesophilic reactor. The genus Methanosarcina was the predominant methanogen in the thermophilic reactor, while the genus Methanothrix remained predominant in the mesophilic reactor. The methanogenesis pathway shifted from acetoclastic to hydrogenotrophic when the mesophilic reactor experienced perturbations. Moreover, the population of lignocellulose-degrading microorganisms in the thermophilic reactor was higher than those in mesophilic reactor, which explained the better
Directory of Open Access Journals (Sweden)
Yaxin Pei
2018-01-01
Full Text Available The Yellow River is the most important water resource in northern China. In the recent past, heavy metal contamination has become severe due to industrial processes and other anthropogenic activities. In this study, riparian soil samples with varying levels of chromium (Cr pollution severity were collected along the Gansu industrial reach of the Yellow River, including samples from uncontaminated sites (XC, XGU, slightly contaminated sites (LJX, XGD, and heavily contaminated sites (CG, XG. The Cr concentrations of these samples varied from 83.83 mg⋅kg-1 (XGU to 506.58 mg⋅kg-1 (XG. The chromate [Cr (VI] reducing ability in the soils collected in this study followed the sequence of the heavily contaminated > slightly contaminated > the un-contaminated. Common Cr remediation genes chrA and yieF were detected in the XG and CG samples. qRT-PCR results showed that the expression of chrA was up-regulated four and threefold in XG and CG samples, respectively, whereas the expression of yieF was up-regulated 66- and 7-fold in the same samples after 30 min treatment with Cr (VI. The copy numbers of chrA and yieF didn’t change after 35 days incubation with Cr (VI. The microbial communities in the Cr contaminated sampling sites were different from those in the uncontaminated samples. Especially, the relative abundances of Firmicutes and Bacteroidetes were higher while Actinobacteria was lower in the contaminated group than uncontaminated group. Further, potential indicator species, related to Cr such as Cr-remediation genera (Geobacter, PSB-M-3, Flavobacterium, and Methanosarcina; the Cr-sensitive genera (Skermanella, Iamia, Arthrobacter, and Candidatus Nitrososphaera were also identified. These data revealed that Cr shifted microbial composition and function. Further, Cr (VI reducing ability could be related with the expression of Cr remediation genes.
International Nuclear Information System (INIS)
M Yazid; Aris Bastianudin
2011-01-01
Selection of methanogenic microbial by gamma irradiation as an effort on improvement of efficiency process on biogas formation has been done. The objectives of this research is to obtain the methanogenic microbial isolate with high specific growth constant (μ), there for will be applicable for increasing the efficiency of biogas formation process. The microbial content sludge sample was taken from the digester tank conventional biogas installation located in Marangan village, Bokoharjo, Prambanan, Sleman and the sludge was irradiated using Co-60 gamma irradiator with varied dosage dose of 0-25 KGy. Microbial culture formation is conducted in growing media with 30% liquid rumen content in un-aerobe condition by addition of 80% H2 and 20% CO_2 gas mixture. Analysis of colony growth was performed by observation using long-wave ultraviolet rays (UV rays), while the microbial growth was by spectro-photometric analysis. Determination of gas methane product was done using gas chromatographic method. The result shown that 4 isolated methanogenic microbial (RB10, RB15, RB20 and RB25) that grown on 10-25 kGy gamma irradiation. The identification result shows that isolate RB10 and RB25 are belong to Methanobacterium genus, while isolate RB15 and RB20 are belong to Methanosarcina and Methanospirillum genus respectively. The specific growth constant (μ) values of the 4 bacterial isolates are in the range between 0.022 - 0.031. On the other hand, the efficiency of methane gas production for each isolates is in the range of 53.4%. - 67.6%. It can be concluded that isolate RB25 was the isolate with the highest specific growth constant (μ) value 0.031 and its efficiency of methane gas production was 67.6%. (author)
Mulat, Daniel Girma; Jacobi, H Fabian; Feilberg, Anders; Adamsen, Anders Peter S; Richnow, Hans-Hermann; Nikolausz, Marcell
2016-01-15
Flexible biogas production that adapts biogas output to energy demand can be regulated by changing feeding regimes. In this study, the effect of changes in feeding intervals on process performance, microbial community structure, and the methanogenesis pathway was investigated. Three different feeding regimes (once daily, every second day, and every 2 h) at the same organic loading rate were studied in continuously stirred tank reactors treating distiller's dried grains with solubles. A larger amount of biogas was produced after feeding in the reactors fed less frequently (once per day and every second day), whereas the amount remained constant in the reactor fed more frequently (every 2 h), indicating the suitability of the former for the flexible production of biogas. Compared to the conventional more frequent feeding regimes, a methane yield that was up to 14% higher and an improved stability of the process against organic overloading were achieved by employing less frequent feeding regimes. The community structures of bacteria and methanogenic archaea were monitored by terminal restriction fragment length polymorphism (T-RFLP) analysis of 16S rRNA and mcrA genes, respectively. The results showed that the composition of the bacterial community varied under the different feeding regimes, and the observed T-RFLP patterns were best explained by the differences in the total ammonia nitrogen concentrations, H2 levels, and pH values. However, the methanogenic community remained stable under all feeding regimes, with the dominance of the Methanosarcina genus followed by that of the Methanobacterium genus. Stable isotope analysis showed that the average amount of methane produced during each feeding event by acetoclastic and hydrogenotrophic methanogenesis was not influenced by the three different feeding regimes. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
International Nuclear Information System (INIS)
Poh, P.E.; Chong, M.F.
2014-01-01
Upflow anaerobic sludge blanket-hollow centered packed bed (UASB-HCPB) reactor was developed with the aim to minimize operational problems in the anaerobic treatment of Palm Oil Mill Effluent (POME) under thermophilic conditions. The performance of UASB-HCPB reactor on POME treatment was investigated at 55 °C. Subsequent to start-up, the performance of the UASB-HCPB reactor was evaluated in terms of i) effect of hydraulic retention time (HRT); ii) effect of organic loading rate (OLR); and iii) effect of mixed liquor volatile suspended solid (MLVSS) concentration on thermophilic POME treatment. Start-up up of the UASB-HCPB reactor was completed in 36 days, removing 88% COD and 90% BOD respectively at an OLR of 28.12 g L −1 d −1 , producing biogas with 52% of methane. Results from the performance study of the UASB-HCPB reactor on thermophilic POME treatment indicated that HRT of 2 days, OLR of 27.65 g L −1 d −1 and MLVSS concentration of 14.7 g L −1 was required to remove 90% of COD and BOD, 80% of suspended solid and at the same time produce 60% of methane. - Highlights: • UASB-HCPB was proposed for POME treatment under thermophilic conditions. • Start-up up of the UASB-HCPB reactor was completed in 36 days. • 88% COD and 90% BOD were removed at an OLR of 28.12 g COD/L.day during start-up. • HRT of 2 days and OLR of 27.65 g COD/L.day was required to produce 60% methane. • Methanosarcina sp. forms the majority of microbial population in the UASB section
Arshad, Arslan; Speth, Daan R.; de Graaf, Rob M.; Op den Camp, Huub J. M.; Jetten, Mike S. M.; Welte, Cornelia U.
2015-01-01
Methane oxidation is an important process to mitigate the emission of the greenhouse gas methane and further exacerbating of climate forcing. Both aerobic and anaerobic microorganisms have been reported to catalyze methane oxidation with only a few possible electron acceptors. Recently, new microorganisms were identified that could couple the oxidation of methane to nitrate or nitrite reduction. Here we investigated such an enrichment culture at the (meta) genomic level to establish a metabolic model of nitrate-driven anaerobic oxidation of methane (nitrate-AOM). Nitrate-AOM is catalyzed by an archaeon closely related to (reverse) methanogens that belongs to the ANME-2d clade, tentatively named Methanoperedens nitroreducens. Methane may be activated by methyl-CoM reductase and subsequently undergo full oxidation to carbon dioxide via reverse methanogenesis. All enzymes of this pathway were present and expressed in the investigated culture. The genome of the archaeal enrichment culture encoded a variety of enzymes involved in an electron transport chain similar to those found in Methanosarcina species with additional features not previously found in methane-converting archaea. Nitrate reduction to nitrite seems to be located in the pseudoperiplasm and may be catalyzed by an unusual Nar-like protein complex. A small part of the resulting nitrite is reduced to ammonium which may be catalyzed by a Nrf-type nitrite reductase. One of the key questions is how electrons from cytoplasmically located reverse methanogenesis reach the nitrate reductase in the pseudoperiplasm. Electron transport in M. nitroreducens probably involves cofactor F420 in the cytoplasm, quinones in the cytoplasmic membrane and cytochrome c in the pseudoperiplasm. The membrane-bound electron transport chain includes F420H2 dehydrogenase and an unusual Rieske/cytochrome b complex. Based on genome and transcriptome studies a tentative model of how central energy metabolism of nitrate-AOM could work is
International Nuclear Information System (INIS)
Sandoval Lozano, Claudia Johanna; Vergara Mendoza, Marisol; Carreno de Arango, Mariela; Castillo Monroy, Edgar Fernando
2009-01-01
This study presents the microbiological characterization of the anaerobic sludge used in a two-stage anaerobic reactor for the treatment of organic fraction of urban solid waste (OFUSW). This treatment is one alternative for reducing solid waste in landfills at the same time producing a biogas (CH 4 and CO 2 ) and an effluent that can be used as biofertilizer. The system was inoculated with sludge from a wastewater treatment plant (WWTP) (Rio Frio Plant in Bucaramanga-Colombia) and a methanogenic anaerobic digester for the treatment of pig manure (Mesa de los Santos in Santander). Bacterial populations were evaluated by counting groups related to oxygen sensitivity, while metabolic groups were determined by most probable number (MPN) technique. Specific methanogenic activity (SMA) for acetate, formate, methanol and ethanol substrates was also determined. In the acidogenic reactor (R1), volatile fatty acids (VFA) reached values of 25,000 mg L -1 and a concentration of CO 2 of 90%. In this reactor, the fermentative population was predominant (10 5 -10 6 MPN mL -1 ). The acetogenic population was (10 5 MPN mL -1 ) and the sulphate-reducing population was (10 4 -10 5 MPN mL -1 ). In the methanogenic reactor (R2), levels of CH 4 (70%) were higher than CO 2 (25%), whereas the VFA values were lower than 4000 mg L -1 . Substrate competition between sulphate-reducing (10 4 -10 5 MPN mL -1 ) and methanogenic bacteria (10 5 MPN mL -1 ) was not detected. From the SMA results obtained, acetoclastic (2.39 g COD-CH 4 g -1 VSS -1 day -1 ) and hydrogenophilic (0.94 g COD-CH 4 g -1 VSS -1 day -1 ) transformations as possible metabolic pathways used by methanogenic bacteria is suggested from the SMA results obtained. Methanotrix sp., Methanosarcina sp., Methanoccocus sp. and Methanobacterium sp. were identified
Wang, Pei-Ling; Chiu, Yi-Ping; Cheng, Ting-Wen; Chang, Yung-Hsin; Tu, Wei-Xain; Lin, Li-Hung
2014-01-01
This study analyzed cored sediments retrieved from sites distributed across a transect of the Lei-Gong-Hou mud volcanoes in eastern Taiwan to uncover the spatial distributions of biogeochemical processes and community assemblages involved in methane cycling. The profiles of methane concentration and carbon isotopic composition revealed various orders of the predominance of specific methane-related metabolisms along depth. At a site proximal to the bubbling pool, the methanogenic zone was sandwiched by the anaerobic methanotrophic zones. For two sites distributed toward the topographic depression, the methanogenic zone overlaid the anaerobic methanotrophic zone. The predominance of anaerobic methanotrophy at specific depth intervals is supported by the enhanced copy numbers of the ANME-2a 16S rRNA gene and coincides with high dissolved Fe/Mn concentrations and copy numbers of the Desulfuromonas/Pelobacter 16S rRNA gene. Assemblages of 16S rRNA and mcrA genes revealed that methanogenesis was mediated by Methanococcoides and Methanosarcina. pmoA genes and a few 16S rRNA genes related to aerobic methanotrophs were detected in limited numbers of subsurface samples. While dissolved Fe/Mn signifies the presence of anaerobic metabolisms near the surface, the correlations between geochemical characteristics and gene abundances, and the absence of aerobic methanotrophs in top sediments suggest that anaerobic methanotrophy is potentially dependent on iron/manganese reduction and dominates over aerobic methanotrophy for the removal of methane produced in situ or from a deep source. Near-surface methanogenesis contributes to the methane emissions from mud platform. The alternating arrangements of methanogenic and methanotrophic zones at different sites suggest that the interactions between mud deposition, evaporation, oxidation and fluid transport modulate the assemblages of microbial communities and methane cycling in different compartments of terrestrial mud volcanoes.
Energy Technology Data Exchange (ETDEWEB)
Penner, Tara J.; Foght, Julia M. [Department of Biological Sciences, University of Alberta, Edmonton, Alberta (Canada); Budwill, Karen [Carbon and Energy Management, Alberta Innovates-Technology Futures, 250 Karl Clark Road, Edmonton, Alberta (Canada)
2010-05-01
Coalbed methane is an unconventional fuel source associated with certain coal seams. Biogenic methane can comprise a significant portion of the gas found in coal seams, yet the role of microbes in methanogenesis in situ is uncertain. The purpose of this study was to detect and identify major bacterial and archaeal species associated with coal sampled from sub-bituminous methane-producing coal beds in western Canada, and to examine the potential for methane biogenesis from coal. Enrichment cultures of coal samples were established to determine how nutrient amendment influenced the microbial community and methane production in the laboratory. 16S rRNA gene clone libraries were constructed using DNA extracted and amplified from uncultured coal samples and from methanogenic coal enrichment cultures. Libraries were screened using restriction fragment length polymorphism, and representative clones were sequenced. Most (> 50%) of the bacterial sequences amplified from uncultured coal samples were affiliated with Proteobacteria that exhibit nitrate reduction, nitrogen fixation and/or hydrogen utilization activities, including Pseudomonas, Thauera and Acidovorax spp., whereas enrichment cultures were dominated by Bacteroidetes, Clostridia and/or Lactobacillales. Archaeal 16S rRNA genes could not be amplified from uncultured coal, suggesting that methanogens are present in coal below the detection levels of our methods. However, enrichment cultures established with coal inocula produced significant volumes of methane and the archaeal clone libraries were dominated by sequences closely affiliated with Methanosarcina spp. Enrichment cultures incubated with coal plus organic nutrients produced more methane than either nutrient or coal supplements alone, implying that competent methanogenic consortia exist in coal beds but that nutrient limitations restrict their activity in situ. This report adds to the scant literature on coal bed microbiology and suggests how microbes may be
Kaur, Simarjot; Mishra, Mukti N; Tripathi, Anil K
2010-07-04
Carbonic anhydrase (CA) is a ubiquitous enzyme catalyzing the reversible hydration of CO2 to bicarbonate, a reaction underlying diverse biochemical and physiological processes. Gamma class carbonic anhydrases (gamma-CAs) are widespread in prokaryotes but their physiological roles remain elusive. At present, only gamma-CA of Methanosarcina thermophila (Cam) has been shown to have CA activity. Genome analysis of a rhizobacterium Azospirillum brasilense, revealed occurrence of ORFs encoding one beta-CA and two gamma-CAs. One of the putative gamma-CA encoding genes of A. brasilense was cloned and overexpressed in E. coli. Electrometric assays for CA activity of the whole cell extracts overexpressing recombinant GCA1 did not show CO2 hydration activity. Reverse transcription-PCR analysis indicated that gca1 in A. brasilense is co-transcribed with its upstream gene annotated as argC, which encodes a putative N-acetyl-gamma-glutamate-phosphate reductase. 5'-RACE also demonstrated that there was no transcription start site between argC and gca1, and the transcription start site located upstream of argC transcribed both the genes (argC-gca1). Using transcriptional fusions of argC-gca1 upstream region with promoterless lacZ, we further demonstrated that gca1 upstream region did not have any promoter and its transcription occurred from a promoter located in the argC upstream region. The transcription of argC-gca1 operon was upregulated in stationary phase and at elevated CO2 atmosphere. This study shows lack of CO2 hydration activity in a recombinant protein expressed from a gene predicted to encode a gamma-carbonic anhydrase in A. brasilense although it cross reacts with anti-Cam antibody raised against a well characterized gamma-CA. The organization and regulation of this gene along with the putative argC gene suggests its involvement in arginine biosynthetic pathway instead of the predicted CO2 hydration.
Support media can steer methanogenesis in the presence of phenol through biotic and abiotic effects.
Poirier, Simon; Déjean, Sébastien; Chapleur, Olivier
2018-09-01
A wide variety of inhibitors can induce anaerobic digester disruption. To avoid performance losses, support media can be used to mitigate inhibitions. However, distinguishing the physico-chemical from the biological mechanisms of such strategies remains delicate. In this framework, the impact of 10 g/L of different types of zeolites and activated carbons (AC) on microbial community dynamics during anaerobic digestion of biowaste in the presence of 1.3 g/L of phenol was evaluated with 16 S rRNA gene sequencing. In the presence of AC, methanogenesis inhibition was rapidly removed due to a decrease of phenol concentration. This abiotic effect related to the physico-chemical properties of AC led to increased final CH4 and CO2 productions by 29-31% compared to digesters incubated without support. Interestingly, although zeolite did not adsorb phenol, final CH4 and CO2 production reached comparable levels as with AC. Nevertheless, compared to digesters incubated without support, methanogenesis lag phase duration was less reduced in the presence of zeolites (5 ± 1 days) than in the presence of activated carbons (12 ± 2 days). Both types of support induced biotic effects. AC and zeolite both allowed the preservation of the major representative archaeal genus of the non-inhibited ecosystem, Methanosarcina. By contrast, they distinctly shaped bacterial populations. OTUs belonging to class W5 became dominant at the expense of OTUs assigned to orders Clostridiales, Bacteroidales and Anaerolinales in the presence of AC. Zeolite enhanced the implantation of OTUs assigned to bacterial phylum Cloacimonetes. This study highlighted that supports can induce biotic and abiotic effects within digesters inhibited with phenol, showing potentialities to enhance anaerobic digestion stability under disrupting conditions. Copyright © 2018 Elsevier Ltd. All rights reserved.
Teixeira, Mayara Fraeda Barbosa; Dall'Agnol, Roberto; Santos, João Orestes Schneider; de Sousa, Luan Alexandre Martins; Lafon, Jean-Michel
2017-12-01
The Gogó da Onça Granite (GOG) comprise a stock located in the Carajás Province in the southeastern part of Amazonian Craton near its border with the Araguaia Belt. Three facies were identified in the pluton: biotite-amphibole granodiorite, biotite-amphibole monzogranite and amphibole-biotite syenogranite. The GGO crosscut discordantly the Archean country rocks and are not foliated. All Gogó da Onça Granite varieties are metaluminous, ferroan A2-subtype granites with reduced character. The major and trace element behavior suggests that its different facies are related by fractional crystallization. Zircon and titanite U-Pb SHRIMP ages show that the pluton crystallized at ∼1880-1870 Ma and is related to the remarkable Paleoproterozoic magmatic event identified in the Carajás Province. Whole-rock Nd isotope data (TDM ages 2.78 to 2.81, εNd values of -9.07 to -9.48) indicate that the GOG magmas derived from an Archaean source compatible with that of some other Paleoproterozoic suites from Carajás Province. The GOG show significant contrasts with the Jamon and Velho Guilherme Paleoproterozoic suites from Carajás Province and the inclusion of the Gogó da Onça granite in any of these suites is not justified. The GOG is more akin to the Serra dos Carajás Suite and to the Seringa and São João granites of Carajás and to the Mesoproterozoic Sherman granite of USA and the Paleoproterozoic Suomenniemi Batholith of Finland. This study puts in evidence the relevance of precise geochronological data and estimation of magma oxidation state in the characterization and correlation of A-type granites.
Characterisation and genesis of the Singhbhum uranium province, India
International Nuclear Information System (INIS)
Mahadevan, T.M.
1988-01-01
The Singhbhum Uranium province is characterised by the late Archaean predominantly granitic Singhbhum Craton and the associated Proterozoic mobile belts, the boundaries of which are marked by major crustal dislocations. The Singhbhum craton had two-phase evolution during the time range 4000-2900 million years and its stabilisation around 2900 million years was marked by the emplacement of K-rich granitoids and the early crustal enrichment of uranium. Two distinctive types of uranium mineralisation occur in the Province - (i) the early Quartz Pebble Conglomerate (QPC) type and (ii) the later economically most significant shear-controlled hydrothermal type. The QPC type is confined to the cratonic volcano-sedimentary basins, characterised by basal fluvial high-energy deposits, near-continental volcanics and banded iron formations spanning the time band of 2900-2500 million years. The shear controlled hydrothermal mineralisation is predominantly developed in a 200 km-long arcuate zone of intense and deep tectonisation, acid-(?) alkaline-basic magmatism, hydrothermal activity and metallogenesis. This shear zone represents a belt of intense crust-mantle interaction. Uranium mineralisation is polyphasic, polymetallic. The mineralogy is complex and the chemistry of the ores is greatly influenced by the lithology of the host rocks involved in the shear. Part of the shear zone grazing the Dhanjori, predominantly volcanic supra-crustals is richer in U, Cu, Ni, Mo and also contains minor Bi, Au, Ag, Te and Se, while the western trans-Dhanjori sector of the shear zone characterised by schists and quartzites with lesser volcanic component is relatively poorer in these metals. The ore bodies in the trans-Dhanjori sector are more peneconcordant, gradational, stratabound and have spherical variograms, while those in the Dhanjori sector are transgressive, sharp, highly mobilised, vein type with Dewijsian variograms. A synthesis leads to the conclusion that uranium mineralisation is
Initiation of DNA replication: functional and evolutionary aspects
Bryant, John A.; Aves, Stephen J.
2011-01-01
Background The initiation of DNA replication is a very important and highly regulated step in the cell division cycle. It is of interest to compare different groups of eukaryotic organisms (a) to identify the essential molecular events that occur in all eukaryotes, (b) to start to identify higher-level regulatory mechanisms that are specific to particular groups and (c) to gain insights into the evolution of initiation mechanisms. Scope This review features a wide-ranging literature survey covering replication origins, origin recognition and usage, modification of origin usage (especially in response to plant hormones), assembly of the pre-replication complex, loading of the replisome, genomics, and the likely origin of these mechanisms and proteins in Archaea. Conclusions In all eukaryotes, chromatin is organized for DNA replication as multiple replicons. In each replicon, replication is initiated at an origin. With the exception of those in budding yeast, replication origins, including the only one to be isolated so far from a plant, do not appear to embody a specific sequence; rather, they are AT-rich, with short tracts of locally bent DNA. The proteins involved in initiation are remarkably similar across the range of eukaryotes. Nevertheless, their activity may be modified by plant-specific mechanisms, including regulation by plant hormones. The molecular features of initiation are seen in a much simpler form in the Archaea. In particular, where eukaryotes possess a number of closely related proteins that form ‘hetero-complexes’ (such as the origin recognition complex and the MCM complex), archaeans typically possess one type of protein (e.g. one MCM) that forms a homo-complex. This suggests that several eukaryotic initiation proteins have evolved from archaeal ancestors by gene duplication and divergence. PMID:21508040
Computation of groundwater resources and recharge in Chithar River Basin, South India.
Subramani, T; Babu, Savithri; Elango, L
2013-01-01
Groundwater recharge and available groundwater resources in Chithar River basin, Tamil Nadu, India spread over an area of 1,722 km(2) have been estimated by considering various hydrological, geological, and hydrogeological parameters, such as rainfall infiltration, drainage, geomorphic units, land use, rock types, depth of weathered and fractured zones, nature of soil, water level fluctuation, saturated thickness of aquifer, and groundwater abstraction. The digital ground elevation models indicate that the regional slope of the basin is towards east. The Proterozoic (Post-Archaean) basement of the study area consists of quartzite, calc-granulite, crystalline limestone, charnockite, and biotite gneiss with or without garnet. Three major soil types were identified namely, black cotton, deep red, and red sandy soils. The rainfall intensity gradually decreases from west to east. Groundwater occurs under water table conditions in the weathered zone and fluctuates between 0 and 25 m. The water table gains maximum during January after northeast monsoon and attains low during October. Groundwater abstraction for domestic/stock and irrigational needs in Chithar River basin has been estimated as 148.84 MCM (million m(3)). Groundwater recharge due to monsoon rainfall infiltration has been estimated as 170.05 MCM based on the water level rise during monsoon period. It is also estimated as 173.9 MCM using rainfall infiltration factor. An amount of 53.8 MCM of water is contributed to groundwater from surface water bodies. Recharge of groundwater due to return flow from irrigation has been computed as 147.6 MCM. The static groundwater reserve in Chithar River basin is estimated as 466.66 MCM and the dynamic reserve is about 187.7 MCM. In the present scenario, the aquifer is under safe condition for extraction of groundwater for domestic and irrigation purposes. If the existing water bodies are maintained properly, the extraction rate can be increased in future about 10% to 15%.
Smith, A J B; Beukes, N J; Gutzmer, J; Czaja, A D; Johnson, C M; Nhleko, N
2017-11-01
We document the discovery of the first granular iron formation (GIF) of Archaean age and present textural and geochemical results that suggest these formed through microbial iron oxidation. The GIF occurs in the Nconga Formation of the ca. 3.0-2.8 Ga Pongola Supergroup in South Africa and Swaziland. It is interbedded with oxide and silicate facies micritic iron formation (MIF). There is a strong textural control on iron mineralization in the GIF not observed in the associated MIF. The GIF is marked by oncoids with chert cores surrounded by magnetite and calcite rims. These rims show laminated domal textures, similar in appearance to microstromatolites. The GIF is enriched in silica and depleted in Fe relative to the interbedded MIF. Very low Al and trace element contents in the GIF indicate that chemically precipitated chert was reworked above wave base into granules in an environment devoid of siliciclastic input. Microbially mediated iron precipitation resulted in the formation of irregular, domal rims around the chert granules. During storm surges, oncoids were transported and deposited in deeper water environments. Textural features, along with positive δ 56 Fe values in magnetite, suggest that iron precipitation occurred through incomplete oxidation of hydrothermal Fe 2+ by iron-oxidizing bacteria. The initial Fe 3+ -oxyhydroxide precipitates were then post-depositionally transformed to magnetite. Comparison of the Fe isotope compositions of the oncoidal GIF with those reported for the interbedded deeper water iron formation (IF) illustrates that the Fe 2+ pathways and sources for these units were distinct. It is suggested that the deeper water IF was deposited from the evolved margin of a buoyant Fe 2+ aq -rich hydrothermal plume distal to its source. In contrast, oncolitic magnetite rims of chert granules were sourced from ambient Fe 2+ aq -depleted shallow ocean water beyond the plume. © 2017 John Wiley & Sons Ltd.
Coral, Thomas; Descostes, Michaël; De Boissezon, Hélène; Bernier-Latmani, Rizlan; de Alencastro, Luiz Felippe; Rossi, Pierre
2018-07-01
A large fraction (47%) of the world's uranium is mined by a technique called "In Situ Recovery" (ISR). This mining technique involves the injection of a leaching fluid (acidic or alkaline) into a uranium-bearing aquifer and the pumping of the resulting solution through cation exchange columns for the recovery of dissolved uranium. The present study reports the in-depth alterations brought to autochthonous microbial communities during acidic ISR activities. Water samples were collected from a uranium roll-front deposit that is part of an ISR mine in operation (Tortkuduk, Kazakhstan). Water samples were obtained at a depth of ca 500 m below ground level from several zones of the Uyuk aquifer following the natural redox zonation inherited from the roll front deposit, including the native mineralized orebody and both upstream and downstream adjacent locations. Samples were collected equally from both the entrance and the exit of the uranium concentration plant. Next-generation sequencing data showed that the redox gradient shaped the community structures, within the anaerobic, reduced, and oligotrophic habitats of the native aquifer zones. Acid injection induced drastic changes in the structures of these communities, with a large decrease in both cell numbers and diversity. Communities present in the acidified (pH values acid mine drainage, with the dominance of Sulfobacillus sp., Leptospirillum sp. and Acidithiobacillus sp., as well as the archaean Ferroplasma sp. Communities located up- and downstream of the mineralized zone under ISR and affected by acidic fluids were blended with additional facultative anaerobic and acidophilic microorganisms. These mixed biomes may be suitable communities for the natural attenuation of ISR mining-affected subsurface through the reduction of metals and sulfate. Assessing the effect of acidification on the microbial community is critical to evaluating the potential for natural attenuation or active bioremediation strategies
Barnes, Stephen J.
2004-11-01
The Black Swan komatiite sequence, in the Eastern Goldfields province of the Archaean Yilgarn Craton in Western Australia, is a body of dominantly olivine-rich cumulates with lesser volumes of spinifex textured rocks, interpreted as a section through an extensive komatiite lava flow field. The sequence hosts a number of nickel sulfide orebodies, including the Silver Swan massive shoot and the Cygnet and Black Swan disseminated orebodies. The massive sulfide orebodies of the Black Swan Succession are pervasively depleted in all platinum group elements (PGEs), particularly Pt and Pd, despite very high Ni contents. This depletion cannot be explained by R-factor variations, which would also require relatively low Ni tenors. The PGE depletion could be explained in part if the ores are enriched in a monosulfide solid solution (MSS) cumulate component, but requires some additional fractional segregation of sulfide melt upstream from the site of deposition. The Silver Swan orebody shows a remarkably consistent vertical zonation in PGE contents, particularly in Ir, Ru, Rh, Os, which increase systematically from very low levels at the stratigraphic base of the sulfide body to maxima corresponding roughly with the top of a lower layer of the orebody rich in silicate inclusions. Platinum shows the opposite trend, but is somewhat modified by remobilisation during talc carbonate alteration. A similar pattern is also observed in the adjacent White Swan orebody. This zonation is interpreted and modelled as the result of fractional crystallisation of MSS from the molten sulfide pool. The strong IPGE depletion towards the base of the orebody may be a consequence of sulfide liquid crystallisation in an inverted thermal gradient, between a thin rapidly cooling upper rind of komatiite lava and a hot substrate.
International Nuclear Information System (INIS)
Napier, R.W.; Guise, P.G.; Rex, D.C.
1998-01-01
The Southern Cross Greenstone Belt in Western Australia contains structurally controlled, hydrothermal gold deposits which are thought to have formed at or near the peak of amphibolite facies regional metamorphism during the Late Archaean. Although the geological features of deposits in the area are well documented. conflicting genetic models and ore-fluid sources have been used to explain the observed geological data. This paper presents new 40 Ar/ 39 Ar data which suggest that the thermal history of the Southern Cross area after the peak of regional metamorphism was more complex than has previously been suggested. After the main gold mineralisation event prior to ca 2620 Ma, the 40 Ar/ 39 Ar ages from amphiboles and biotites sampled from the alteration selvages of gold-bearing veins indicate that temperatures remained elevated in the region of 500 deg C for between 20 and 70 million years. These amphiboles and biotites from individual deposits yield ages that are in good agreement with one another to a high precision. implying increased cooling rates after the long period of elevated temperatures. Along the Southern Cross Greenstone Belt. however. amphibole-biotite pairs from the alteration selvages of gold-bearing quartz veins. while remaining in good agreement with one another, vary between deposits from ca 2560 Ma to ca 2440 Ma. Amphiboles from metabasalts that are associated with regional metamorphism and not hydrothermal alteration contain numerous exsolution lamellae that reduce the effective closure temperature of the amphiboles and yield geologically meaningless ages. These age relationships show that the thermal history of the area did not follow a simple cooling path and the area may have been tectonically active for a long period after the main gold mineralisation event before ca 2620 Ma. Such data may provide important constraints on subsequent genetic modelling of gold mineralisation and metamorphism. Copyright (1998) Blackwell Science Asia
Major uranium provinces: Yilgarn block and Gascoyne Province, Western Australia
International Nuclear Information System (INIS)
Butt, C.R.M.
1988-01-01
The Archaean Yilgarn Block and the adjacent Proterozoic Gascoyne Province, Western Australia, form the basement and source rocks for numerous occurrences of surficial uranium mineralization, the largest being the Yeelirrie deposit (35 million tonnes at 0.15% U 3 O 8 ). The mineralization, almost exclusively in the form of carnotite, has been deposited in the regolith and appears to be less than 1 Ma old, with some deposits still forming. The nature and distribution of the mineralization are controlled by basement and surface geology, geomorphology, hydrology and climate, being restricted to deeply weathered, semi-arid terrain with granitoid source rocks. A few small occurrences in the Gascoyne Province may be pedogenic in origin but the majority, in the north of Yilgarn Block, occur in unrejuvenated palaeodrainage channels now choked by colluvial, alluvial and chemical sediments. These sediments, which are aquifers for the present, predominantly sub-surface, drainage, can exceed 10-15 m. Uranium released from the weathering granitoids has been transported in groundwaters in uranyl carbonate complexes and precipitated as carnotite where, (i) concentrations of uranium and potassium have been elevated by evaporation and, (ii) dissolved vanadium has been oxidized to the 5-valent state. Precipitation is in calcretes and associated sediments in the drainage axes, in 'chemical deltas' where the drainages enter playas and in the playas themselves. This style of mineralization was first recognized in 1969-1970 as the result of investigations into the source of radiometric anomalies delineated by airborne surveys. The majority of discoveries have similarly been by radiometric surveys but hydrogeochemical surveys have promise and may become important in future search for blind mineralization and/or young deposits not in radioactive equilibrium. (author). 61 refs, 6 figs
(142)Nd evidence for an enriched Hadean reservoir in cratonic roots.
Upadhyay, Dewashish; Scherer, Erik E; Mezger, Klaus
2009-06-25
The isotope (146)Sm undergoes alpha-decay to (142)Nd, with a half-life of 103 million years. Measurable variations in the (142)Nd/(144)Nd values of rocks resulting from Sm-Nd fractionation could therefore only have been produced within about 400 million years of the Solar System's formation (that is, when (146)Sm was extant). The (142)Nd/(144)Nd compositions of terrestrial rocks are accordingly a sensitive monitor of the main silicate differentiation events that took place in the early Earth. High (142)Nd/(144)Nd values measured in some Archaean rocks from Greenland hint at the existence of an early incompatible-element-depleted mantle. Here we present measurements of low (142)Nd/(144)Nd values in 1.48-gigayear-(Gyr)-old lithospheric mantle-derived alkaline rocks from the Khariar nepheline syenite complex in southeastern India. These data suggest that a reservoir that was relatively enriched in incompatible elements formed at least 4.2 Gyr ago and traces of its isotopic signature persisted within the lithospheric root of the Bastar craton until at least 1.48 Gyr ago. These low (142)Nd/(144)Nd compositions may represent a diluted signature of a Hadean (4 to 4.57 Gyr ago) enriched reservoir that is characterized by even lower values. That no evidence of the early depleted mantle has been observed in rocks younger than 3.6 Gyr (refs 3, 4, 7) implies that such domains had effectively mixed back into the convecting mantle by then. In contrast, some early enriched components apparently escaped this fate. Thus, the mantle sampled by magmatism since 3.6 Gyr ago may be biased towards a depleted composition that would be balanced by relatively more enriched reservoirs that are 'hidden' in Hadean crust, the D'' layer of the lowermost mantle or, as we propose here, also within the roots of old cratons.
Composition of the Earth's interior: the importance of early events.
Carlson, Richard W; Boyet, Maud
2008-11-28
The detection of excess 142Nd caused by the decay of 103Ma half-life 146Sm in all terrestrial rocks compared with chondrites shows that the chondrite analogue compositional model cannot be strictly correct, at least for the accessible portion of the Earth. Both the continental crust (CC) and the mantle source of mid-ocean ridge basalts (MORB) originate from the material characterized by superchondritic 142Nd/144Nd. Thus, the mass balance of CC plus mantle depleted by crust extraction (the MORB-source mantle) does not sum back to chondritic compositions, but instead to a composition with Sm/Nd ratio sufficiently high to explain the superchondritic 142Nd/144Nd. This requires that the mass of mantle depleted by CC extraction expand to 75-100 per cent of the mantle depending on the composition assumed for average CC. If the bulk silicate Earth has chondritic relative abundances of the refractory lithophile elements, then there must exist within the Earth's interior an incompatible-element-enriched reservoir that contains roughly 40 per cent of the Earth's 40Ar and heat-producing radioactive elements. The existence of this enriched reservoir is demonstrated by time-varying 142Nd/144Nd in Archaean crustal rocks. Calculations of the mass of the enriched reservoir along with seismically determined properties of the D'' layer at the base of the mantle allow the speculation that this enriched reservoir formed by the sinking of dense melts deep in a terrestrial magma ocean. The enriched reservoir may now be confined to the base of the mantle owing to a combination of compositionally induced high density and low viscosity, both of which allow only minimal entrainment into the overlying convecting mantle.
Lithosphere structure in Madagascar as revealed from receiver functions and surface waves analysis.
Rindraharisaona, E. J.; Tilmann, F. J.; Yuan, X.; Dreiling, J.; Priestley, K. F.; Barruol, G.; Wysession, M. E.
2017-12-01
The geological history of Madagascar makes it an ideal place to study the lithospheric structure and its evolution. It comprises Archean to Proterozoic units on the central eastern part, which is surrounded by a Triassic to Jurassic basin formation in the west and Cretaceous volcanics along the coasts. Quaternary volcanic rocks have been embedded in crystalline and sedimentary rocks. The aim of the present work is to characterize the crustal structure and determine the imprint of the dominant geodynamic events that have affected Madagascar: the Pan-African orogeny, the breakup of Gondwanaland and Neogene tectonic activity. From 2011 to 2014 different temporary seismic arrays were deployed in Madagascar. We based the current study mostly on SELASOMA project, which is composed of 50 seismic stations that were installed traversing southern Madagascar from the west to the east, sampling the different geological units. To measured seismic dispersion curves, one a wide period ranges using ambient noise, Rayleigh and Love surface waves. To compute the average crustal Vp/Vs ratio internal crustal structure and discontinuities in the mantle, we use both P- and S-waves receiver functions. To better resolve of the crustal structure, we jointly inverted P-wave receiver functions and Rayleigh wave group velocity.The crustal extension during the Carboniferous to Cenozoic has thinned the igneous crust down to 15 km in the western Morondava basin by removing much of the lower crust, while the thickness of the upper crust is nearly identical in the sedimentary basin and under Proterozoic and Archaean rocks of the eastern two thirds of Southern Madagascar. In general, the Archean crust is thicker than the Proterozoic, because mafic component is missing in the Proterozoic domain while it forms the bottom of the Archean crust. The lithosphere thickness in the southern part of Madagascar is estimated to be between 90 and 125 km.
Thummes, Kathrin; Kämpfer, Peter; Jäckel, Udo
2007-07-01
To date, composting has been regarded as an aerobic process but it has been shown that composting piles are often sources of atmospheric methane. In order to gain a more comprehensive view on the diversity of methanogenic Archaea in compost, gas chromatographical methods and molecular cloning were used to study relationships of thermophilic archaeal communities and changes in methane production potential during compost maturation. According to the thermophilic methane production potential, wide differences could be detected between differently aged compost materials. In material derived from 3- and 4-week-old piles, low and no thermophilic methane production potential, respectively, was observed at 50 degrees C. Material from a 6-week-old pile showed the maximum methane production. With compost maturation, the production slowly decreased again with 6 weeks, 8 weeks, and mature compost showing an optimum methane production potential at 60 degrees C. At 70 degrees C, only 6-week-old material showed a comparable high production of methane. The 16S rRNA-based phylogenetic surveys revealed an increase of archaeal diversity with compost maturation. In the 6-week-old material, 86% of the sequences in the archaeal 16S rRNA library had the highest sequence similarities to Methanothermobacter spp. and the remaining 14% of the clones were related to Methanosarcina thermophila. Quantification of methanogens in 6-week-old material, on the basis of the methane production rate, resulted in values of about 2x10(7) cells per gram fresh weight. In 8-week-old and mature compost material, the proportion of sequences similar to Methanothermobacter spp. decreased to 34% and 0%, respectively. The mature compost material showed the highest variation in identified sequences, although 33% could be assigned to as yet uncultured Archaea (e.g. Rice cluster I, III, and IV). Our results indicate that compost harbours a diverse community of thermophilic methanogens, with changing composition
Energy Technology Data Exchange (ETDEWEB)
Allen, Michelle A.; Lauro, Federico M.; Williams, Timothy J.; Burg, Dominic; Siddiqui, Khawar S.; De Francisci, David; Chong, Kevin W.Y.; Pilak, Oliver; Chew, Hwee H.; De Maere, Matthew Z.; Ting, Lily; Katrib, Marilyn; Ng, Charmaine; Sowers, Kevin R.; Galperin, Michael Y.; Anderson, Iain J.; Ivanova, Natalia; Dalin, Eileen; Martinez, Michelle; Lapidus, Alla; Hauser, Loren; Land, Miriam; Thomas, Torsten; Cavicchioli, Ricardo
2009-04-01
Psychrophilic archaea are abundant and perform critical roles throughout the Earth's expansive cold biosphere. Here we report the first complete genome sequence for a psychrophilic methanogenic archaeon, Methanococcoides burtonii. The genome sequence was manually annotated including the use of a five tiered Evidence Rating system that ranked annotations from Evidence Rating (ER) 1 (gene product experimentally characterized from the parent organism) to ER5 (hypothetical gene product) to provide a rapid means of assessing the certainty of gene function predictions. The genome is characterized by a higher level of aberrant sequence composition (51%) than any other archaeon. In comparison to hyper/thermophilic archaea which are subject to selection of synonymous codon usage, M. burtonii has evolved cold adaptation through a genomic capacity to accommodate highly skewed amino acid content, while retaining codon usage in common with its mesophilic Methanosarcina cousins. Polysaccharide biosynthesis genes comprise at least 3.3% of protein coding genes in the genome, and Cell wall/membrane/envelope biogenesis COG genes are over-represented. Likewise, signal transduction (COG category T) genes are over-represented and M. burtonii has a high 'IQ' (a measure of adaptive potential) compared to many methanogens. Numerous genes in these two over-represented COG categories appear to have been acquired from {var_epsilon}- and {delta}-proteobacteria, as do specific genes involved in central metabolism such as a novel B form of aconitase. Transposases also distinguish M. burtonii from other archaea, and their genomic characteristics indicate they play an important role in evolving the M. burtonii genome. Our study reveals a capacity for this model psychrophile to evolve through genome plasticity (including nucleotide skew, horizontal gene transfer and transposase activity) that enables adaptation to the cold, and to the biological and physical changes that have
Comparative genomic analyses of nickel, cobalt and vitamin B12 utilization
Directory of Open Access Journals (Sweden)
Gelfand Mikhail S
2009-02-01
Full Text Available Abstract Background Nickel (Ni and cobalt (Co are trace elements required for a variety of biological processes. Ni is directly coordinated by proteins, whereas Co is mainly used as a component of vitamin B12. Although a number of Ni and Co-dependent enzymes have been characterized, systematic evolutionary analyses of utilization of these metals are limited. Results We carried out comparative genomic analyses to examine occurrence and evolutionary dynamics of the use of Ni and Co at the level of (i transport systems, and (ii metalloproteomes. Our data show that both metals are widely used in bacteria and archaea. Cbi/NikMNQO is the most common prokaryotic Ni/Co transporter, while Ni-dependent urease and Ni-Fe hydrogenase, and B12-dependent methionine synthase (MetH, ribonucleotide reductase and methylmalonyl-CoA mutase are the most widespread metalloproteins for Ni and Co, respectively. Occurrence of other metalloenzymes showed a mosaic distribution and a new B12-dependent protein family was predicted. Deltaproteobacteria and Methanosarcina generally have larger Ni- and Co-dependent proteomes. On the other hand, utilization of these two metals is limited in eukaryotes, and very few of these organisms utilize both of them. The Ni-utilizing eukaryotes are mostly fungi (except saccharomycotina and plants, whereas most B12-utilizing organisms are animals. The NiCoT transporter family is the most widespread eukaryotic Ni transporter, and eukaryotic urease and MetH are the most common Ni- and B12-dependent enzymes, respectively. Finally, investigation of environmental and other conditions and identity of organisms that show dependence on Ni or Co revealed that host-associated organisms (particularly obligate intracellular parasites and endosymbionts have a tendency for loss of Ni/Co utilization. Conclusion Our data provide information on the evolutionary dynamics of Ni and Co utilization and highlight widespread use of these metals in the three
The impact of permafrost-associated microorganisms on hydrate formation kinetics
Luzi-Helbing, Manja; Liebner, Susanne; Spangenberg, Erik; Wagner, Dirk; Schicks, Judith M.
2016-04-01
The relationship between gas hydrates, microorganisms and the surrounding sediment is extremely complex: On the one hand, microorganisms producing methane provide the prerequisite for gas hydrate formation. As it is known most of the gas incorporated into natural gas hydrates originates from biogenic sources. On the other hand, as a result of microbial activity gas hydrates are surrounded by a great variety of organic compounds which are not incorporated into the hydrate structure but may influence the formation or degradation process. For gas hydrate samples from marine environments such as the Gulf of Mexico a direct association between microbes and gas hydrates was shown by Lanoil et al. 2001. It is further assumed that microorganisms living within the gas hydrate stability zone produce biosurfactants which were found to enhance the hydrate formation process significantly and act as nucleation centres (Roger et al. 2007). Another source of organic compounds is sediment organic matter (SOM) originating from plant material or animal remains which may also enhance hydrate growth. So far, the studies regarding this relationship were focused on a marine environment. The scope of this work is to extend the investigations to microbes originating from permafrost areas. To understand the influence of microbial activity in a permafrost environment on the methane hydrate formation process and the stability conditions of the resulting hydrate phase we will perform laboratory studies. Thereby, we mimic gas hydrate formation in the presence and absence of methanogenic archaea (e.g. Methanosarcina soligelidi) and other psychrophilic bacteria isolated from permafrost environments of the Arctic and Antarctic to investigate their impact on hydrate induction time and formation rates. Our results may contribute to understand and predict the occurrences and behaviour of potential gas hydrates within or adjacent to the permafrost. Lanoil BD, Sassen R, La Duc MT, Sweet ST, Nealson KH
Oko, Bonahis J; Tao, Yu; Stuckey, David C
2017-01-01
Oil field produced water (OFPW) is widely produced in large volumes around the world. Transforming the organic matter in OFPW into bioenergy, such as biomethane, is one promising way to sustainability. However, OFPW is difficult to biologically degrade because it contains complex compounds such as naphthenic acids (NAs), or polycyclic aromatic hydrocarbons (PAHs). Although active microbial communities have been found in many oil reservoirs, little is known about how an exotic microbiome, e.g. the one which originates from municipal wastewater treatment plants, would evolve when incubated with OFPW. In this study, we harvested methanogenic biomass from two sources: a full-scale anaerobic digester (AD) treating oil and gas processing wastewater (named O&G sludge), and from a full-scale AD reactor treating multiple fractions of municipal solid wastes (named MS, short for mixed sludge). Both were incubated in replicate microcosms fed with PAHs, NAs, or OFPW. The results showed that the PAHs, NAs, and OFPW feeds could rapidly alter the methanogenic microbiomes, even after 14 days, while the O&G sludge adapted faster than the mixed sludge in all the incubations. Two rarely reported microorganisms, a hydrogenotrophic methanogen Candidatus methanoregula and a saccharolytic fermenter Kosmotoga , were found to be prevalent in the PAHs and OFPW microcosms, and are likely to play an important role in the syntrophic degradation of PAHs and OFPW, cooperating with methanogens such as Methanoregula, Methanosarcina, or Methanobacterium . The dominant phyla varied in certain patterns during the incubations, depending on the biomass source, feed type, and variation in nutrients. The sludge that originated from the oil and gas processing wastewater treatment (O&G) reactor adapted faster than the one from municipal solid waste reactors, almost certainly because the O&G biomass had been "pre-selected" by the environment. This study reveals the importance of biomass selection for other
2010-01-01
Background Carbonic anhydrase (CA) is a ubiquitous enzyme catalyzing the reversible hydration of CO2 to bicarbonate, a reaction underlying diverse biochemical and physiological processes. Gamma class carbonic anhydrases (γ-CAs) are widespread in prokaryotes but their physiological roles remain elusive. At present, only γ-CA of Methanosarcina thermophila (Cam) has been shown to have CA activity. Genome analysis of a rhizobacterium Azospirillum brasilense, revealed occurrence of ORFs encoding one β-CA and two γ-CAs. Results One of the putative γ-CA encoding genes of A. brasilense was cloned and overexpressed in E. coli. Electrometric assays for CA activity of the whole cell extracts overexpressing recombinant GCA1 did not show CO2 hydration activity. Reverse transcription-PCR analysis indicated that gca1 in A. brasilense is co-transcribed with its upstream gene annotated as argC, which encodes a putative N-acetyl-γ-glutamate-phosphate reductase. 5'-RACE also demonstrated that there was no transcription start site between argC and gca1, and the transcription start site located upstream of argC transcribed both the genes (argC-gca1). Using transcriptional fusions of argC-gca1 upstream region with promoterless lacZ, we further demonstrated that gca1 upstream region did not have any promoter and its transcription occurred from a promoter located in the argC upstream region. The transcription of argC-gca1 operon was upregulated in stationary phase and at elevated CO2 atmosphere. Conclusions This study shows lack of CO2 hydration activity in a recombinant protein expressed from a gene predicted to encode a γ-carbonic anhydrase in A. brasilense although it cross reacts with anti-Cam antibody raised against a well characterized γ-CA. The organization and regulation of this gene along with the putative argC gene suggests its involvement in arginine biosynthetic pathway instead of the predicted CO2 hydration. PMID:20598158
Directory of Open Access Journals (Sweden)
Mishra Mukti N
2010-07-01
Full Text Available Abstract Background Carbonic anhydrase (CA is a ubiquitous enzyme catalyzing the reversible hydration of CO2 to bicarbonate, a reaction underlying diverse biochemical and physiological processes. Gamma class carbonic anhydrases (γ-CAs are widespread in prokaryotes but their physiological roles remain elusive. At present, only γ-CA of Methanosarcina thermophila (Cam has been shown to have CA activity. Genome analysis of a rhizobacterium Azospirillum brasilense, revealed occurrence of ORFs encoding one β-CA and two γ-CAs. Results One of the putative γ-CA encoding genes of A. brasilense was cloned and overexpressed in E. coli. Electrometric assays for CA activity of the whole cell extracts overexpressing recombinant GCA1 did not show CO2 hydration activity. Reverse transcription-PCR analysis indicated that gca1 in A. brasilense is co-transcribed with its upstream gene annotated as argC, which encodes a putative N-acetyl-γ-glutamate-phosphate reductase. 5'-RACE also demonstrated that there was no transcription start site between argC and gca1, and the transcription start site located upstream of argC transcribed both the genes (argC-gca1. Using transcriptional fusions of argC-gca1 upstream region with promoterless lacZ, we further demonstrated that gca1 upstream region did not have any promoter and its transcription occurred from a promoter located in the argC upstream region. The transcription of argC-gca1 operon was upregulated in stationary phase and at elevated CO2 atmosphere. Conclusions This study shows lack of CO2 hydration activity in a recombinant protein expressed from a gene predicted to encode a γ-carbonic anhydrase in A. brasilense although it cross reacts with anti-Cam antibody raised against a well characterized γ-CA. The organization and regulation of this gene along with the putative argC gene suggests its involvement in arginine biosynthetic pathway instead of the predicted CO2 hydration.
Higashi, Y.; Sunamura, M.; Utsumi, M.; Urabe, T.; Maruyama, A.
2004-12-01
Subsurface of deep-sea hydrothermal vent environments is one of the most difficult fields on the Earth to approach and collect reliable samples for microbiological study. In our Archaean Park project, we developed in situ incubation instruments to directly collect microbes from sub-vent fields through a drilled borehole. After excavation using a portable submarine driller (BMS) around deep-sea hydrothermal vents in the Suiyo Seamount on the Izu-Bonin Arc (2001, 2002) and the South Mariana (2003), microbial diversity was examined in samples collected from the boreholes, as well as natural vents, using catheter- and column-type in situ growth chambers. In the catheter samples collected from the Suiyo Seamount, several novel phylotypes of microbial SSU rRNA genes were assigned within epsilon-Proteobacteria and hyperthermophile-related Euryarchaea groups. The former novel epsilon group (SSSV-BE1) was also detected in the South Mariana, but they only appeared in the catheter samples collected just below the venting seafloor. These suggest that the group must be significant in warm, shallow and microaerobic sub-vent layers over the sea, at least in the northwest Pacific Ocean. The column-type in situ growth chamber was specially designed for creating and maintaining physico-chemical gradients in a ca. 40-cm-long column situated on an active vent. In Suiyo Seamount samples (vent temp.: ca. 30-100 degree C), a unique vertical profile was found in the diversity of Archaea. At the column bottom, most of the clones were assigned to be members within the lithoautotrophic thermophilic Ignicoccus, while heterotrophic thermophilic Thermococcus were abundant at the column top. Similar vertical profile has also been appeared in the column samples from the South Mariana. Further quantitative population analysis is now under going using these samples. Our approach to the sub-vent biosphere by the combination of drilling and in situ incubation is almost sure to give us important clues
Ji-Yang, Wang; Mo-Xiang, Chen; Ji-An, Wang; Xiao, Deng; Jun, Wang; Hsien-Chieh, Shen; Liang-Ping, Hsiung; Shu-Zhen, Yan; Zhi-Cheng, Fan; Xiu-Wen, Liu; Ge-Shan, Huang; Wen-Ren, Zhang; Hai-Hui, Shao; Rong-Yan, Zhang
1981-01-01
Geothermal studies have been conducted in China continuously since the end of the 1950's with renewed activity since 1970. Three areas of research are defined: (1) fundamental theoretical research on geothermics, including subsurface temperatures, terrestrial heat flow and geothermal modeling; (2) exploration for geothermal resources and exploitation of geothermal energy; and (3) geothermal studies in mines. Regional geothermal studies have been conducted recently in North China and more than 2000 values of subsurface temperature have been obtained. Temperatures at a depth of 300 m generally range from 20 to 25°C with geothermal gradients from 20 to 40°C/km. These values are regarded as an average for the region with anomalies related to geological factors. To date, 22 reliable heat flow data from 17 sites have been obtained in North China and the data have been categorized according to fault block tectonics. The average heat flow value at 16 sites in the north is 1.3 HFU, varying from 0.7 to 1.8 HFU. It is apparent that the North China fault block is characterized by a relatively high heat flow with wide variations in magnitude compared to the mean value for similar tectonic units in other parts of the world. It is suggested that although the North China fault block can be traced back to the Archaean, the tectonic activity has been strengthening since the Mesozoic resulting in so-called "reactivation of platform" with large-scale faulting and magmatism. Geothermal resources in China are extensive; more than 2000 hot springs have been found and there are other manifestations including geysers, hydrothermal explosions, hydrothermal steam, fumaroles, high-temperature fountains, boiling springs, pools of boiling mud, etc. In addition, there are many Meso-Cenozoic sedimentary basins with widespread aquifers containing geothermal water resources in abundance. The extensive exploration and exploitation of these geothermal resources began early in the 1970's. Since then
Lithospheric Structure, Crustal Kinematics, and Earthquakes in North China: An Integrated Study
Liu, M.; Yang, Y.; Sandvol, E.; Chen, Y.; Wang, L.; Zhou, S.; Shen, Z.; Wang, Q.
2007-12-01
The North China block (NCB) is geologically part of the Archaean Sino-Korean craton. But unusual for a craton, it was thermally rejuvenated since late Mesozoic, and experienced widespread extension and volcanism through much of the Cenozoic. Today, the NCB is characterized by strong internal deformation and seismicity, including the 1976 Tangshan earthquake that killed ~250,000 people. We have started a multidisciplinary study to image the lithospheric and upper mantle structure using seismological methods, to delineate crustal kinematics and deformation via studies of neotectonics and space geodesy, and to investigate the driving forces, the stress states and evolution, and seismicity using geodynamic modeling. Both seismic imaging and GPS results indicate that the Ordos plateau, which is the western part of the NCB and a relic of the Sino-Korean craton, has been encroached around its southern margins by mantle flow and thus is experiencing active cratonic destruction. Some of the mantle flow may be driven by the Indo-Asian collision, although the cause of the broad mantle upwelling responsible for the Mesozoic thinning of the NCB lithosphere remains uncertain. At present, crustal deformation in the NCB is largely driven by gravitational spreading of the expanding Tibetan Plateau. Internal deformation within the NCB is further facilitated by the particular tectonic boundary conditions around the NCB, and the large lateral contrasts of lithospheric strength and rheology. Based on the crustal kinematics and lithospheric structure, we have developed a preliminary geodynamic model for stress states and strain energy in the crust of the NCB. The predicted long-term strain energy distribution is comparable with the spatial pattern of seismic energy release in the past 2000 years. We are exploring the cause of the spatiotemporal occurrence of large earthquakes in the NCB, especially the apparent migration of seismicity from the Weihe-Shanxi grabens around the Ordos to
International Nuclear Information System (INIS)
Hansoti, S.K.; Sinha, D.K.
1995-01-01
The Khairagarh basin having late Archaean- early Proterozoic basement is filled up by middle Proterozoic Khairagarh group volcano - sedimentary sequence, laid in the Kotri rift zone (KRZ) with imprints of repetitive volcanic, plutonic and tectonic activities. A strong thermal imprint of ∼ 1.5 Ga has been recorded in rocks of the basin that could be an effect of copious outpouring of basalts, dacites, ignimbrites, together with the emplacements of stocks of gabbros, gabbroic dolerites, dolerites, granites, granophyres, felsites, aplites, and quartz veins. Some of the basement rocks are enriched in Fe, Cu and other base metals and have been emplaced and assimilated by the volcano- plutonic rocks of the Nandgaon group and Malanjkhand granitoids. The Nandgaon group rocks and the Malanjkhand granitoids have anomalous intrinsic abundance of U, REE, Cu, Fe and quite a few metals in different sectors. Thermo-tectonic (∼ 1.5 Ga) reactivation event(s) along the KRZ apart from facilitating formation of agglomerates, ignimbrites and tectonic breccias has promoted emplacement of plutonic and subvolcanic phases and their metasomatising and hydrothermal metal bearing fluids. In the Malanjkhand complex sector Cu±Mo±Fe±Ag±Au±REE±Zn metallisation and in the Dongargarh Massif sector U±Th±F±Fe±Pb±Zn±Cu±REE±Zr metallisation are manifested. The detection of Fe+U+REE ±Cu±Ni metallisation in the Bortalao sandstones of the Dongargaon - Lohara area, located in between Malanjkhand ore zone and the Chandidongri (Dongargarh granite hosted) fluorite-rich and Pb±Zn±Cu±U - bearing ore zone, considered to lie on the same (Malanjkhand - Chandidongri) fault/shear lineament is rated highly significant. This observation supports the prognosis that the terrain lying in between the Dongargarh Massif and the Malanjkhand Granitoid complex should be the locus for the mixing of the respective metal bearing fluids and such a terrain therefore should be considered as a first order
Usoltseva, Olga; Kozlovskaya, Elena
2016-07-01
Earthquakes in areas within continental plates are still not completely understood, and progress on understanding intraplate seismicity is slow due to a short history of instrumental seismology and sparse regional seismic networks in seismically non-active areas. However, knowledge about position and depth of seismogenic structures in such areas is necessary in order to estimate seismic hazard for such critical facilities such as nuclear power plants and nuclear waste deposits. In the present paper we address the problem of seismicity in the intraplate area of northern Fennoscandia using the information on local events recorded by the POLENET/LAPNET (Polar Earth Observing Network) temporary seismic array during the International Polar Year 2007-2009. We relocate the seismic events using the program HYPOELLIPS (a computer program for determining local earthquake hypocentral parameters) and grid search method. We use the first arrivals of P waves of local events in order to calculate a 3-D tomographic P wave velocity model of the uppermost crust (down to 20 km) for a selected region inside the study area and show that the velocity heterogeneities in the upper crust correlate well with known tectonic units. We compare the position of the velocity heterogeneities with the seismogenic structures delineated by epicentres of relocated events and demonstrate that these structures generally do not correlate with the crustal units formed as a result of crustal evolution in the Archaean and Palaeoproterozoic. On the contrary, they correlate well with the postglacial faults located in the area of the Baltic-Bothnia Megashear (BBMS). Hypocentres of local events have depths down to 30 km. We also obtain the focal mechanism of a selected event with good data quality. The focal mechanism is of oblique type with strike-slip prevailing. Our results demonstrate that the Baltic-Bothnia Megashear is an important large-scale, reactivated tectonic structure that has to be taken into
Vijith, H.; Satheesh, R.
2007-09-01
Hydrogeochemistry of groundwater in upland sub-watersheds of Meenachil river, parts of Western Ghats, Kottayam, Kerala, India was used to assess the quality of groundwater for determining its suitability for drinking and agricultural purposes. The study area is dominated by rocks of Archaean age, and Charnonckite is dominated over other rocks. Rubber plantation dominated over other types of the vegetation in the area. Though the study area receives heavy rainfall, it frequently faces water scarcity as well as water quality problems. Hence, a Geographical Information System (GIS) based assessment of spatiotemporal behaviour of groundwater quality has been carried out in the region. Twenty-eight water samples were collected from different wells and analysed for major chemical constituents both in monsoon and post-monsoon seasons to determine the quality variation. Physical and chemical parameters of groundwater such as pH, dissolved oxygen (DO), total hardness (TH), chloride (Cl), nitrate (NO3) and phosphate (PO4) were determined. A surface map was prepared in the ArcGIS 8.3 (spatial analyst module) to assess the quality in terms of spatial variation, and it showed that the high and low regions of water quality varied spatially during the study period. The influence of lithology over the quality of groundwater is negligible in this region because majority of the area comes under single lithology, i.e. charnockite, and it was found that the extensive use of fertilizers and pesticides in the rubber, tea and other agricultural practices influenced the groundwater quality of the region. According to the overall assessment of the basin, all the parameters analysed are below the desirable limits of WHO and Indian standards for drinking water. Hence, considering the pH, the groundwater in the study area is not suitable for drinking but can be used for irrigation, industrial and domestic purposes. The spatial analysis of groundwater quality patterns of the study area shows
International Nuclear Information System (INIS)
Ferguson, J.
1988-01-01
In identifying uranium provinces, and, more importantly, mineralized zones within these provinces, it is of paramount importance to attempt to trace the geochemical behaviour of an element through all stages of Earth's evolution. Aspects that need to be addressed in this regard include solar abundance levels and fractionation processes during accretion, changing patterns of crustal evolution, effects of an evolving atmosphere, and the weathering cycle. Abundance patterns and partition coefficients of some of the siderophile elements in mantle rocks lend support to a multistage accretionary process. Lack of a terrestrial record in the first 500 Ma necessitates that lunar models be invoked, which suggests that early fractionation of a mafic/ultramafic magma resulted in an anorthositic crust. Fractionation of the mantle and transfer of materials to the upper levels must be central to any model invoked for development of the crust. Given high heat flow conditions in the early Archaean it would seem inescapable that the process of sea floor spreading and plate tectonics was an ongoing process. If the plate tectonic model is taken back to 3500 Ma, and assuming current speading rates, then about half of the mantle has passed through the irreversible differentiation cycle. Arguments in support of recycled material must be balanced against mantle metasomatism effects. With the associated advent of partial melting of the mantle material a partitioning of minor and trace elements into the melt fraction would take place. The early primitive mafic and ultramafic komatiites exemplify this feature by concentrating U and Th by a factor of 5 compared to chondritic abundances. It is of tantamount importance to understand the generation of the magmas in order to predict which are the 'fertile' bodies in terms of radioelement concentrations. In that the granitoid magmas image their source compositions, the association of high radioelements will primarily be source-dependent. Uranium
An autochthonous geological model for the eastern Andes of Ecuador
Pratt, Warren T.; Duque, Pablo; Ponce, Miguel
2005-04-01
We describe a traverse across the Cordillera Real and sub-Andean Zone of Ecuador, poorly known areas with very little detailed mapping and very little age control. The spine of the Cordillera comprises deeply eroded Triassic and Jurassic plutons, the roots of a major arc, emplaced into probable Palaeozoic pelites and metamorphosed volcanic rocks. The W flank comprises a Jurassic (?) submarine basaltic-andesitic volcanic sequence, which grades up into mixed Jurassic/Cretaceous volcanic and sedimentary rocks of the Inter-Andean Valley. The sub-Andean Zone, on the E flank of the Cordillera, comprises a newly recognized Cretaceous basin of cleaved mudrocks, quartz arenites and limestones. East of the syndepositional Cosanga Fault, the Cretaceous basin thins into a condensed sequence that is indistinguishable from the rocks of the adjacent hydrocarbon-bearing Oriente Basin. The principal penetrative deformation of the Cordillera Real was probably latest Cretaceous/Palaeocene. It telescoped the magmatic belts, but shortening was largely partitioned into the pelites between plutons. The plutons suffered inhomogenous deformation; some portions completely escaped tectonism. The pelites conserve two foliations. The earliest comprises slaty cleavage formed under low- or sub-greenschist conditions. The later is a strong schistosity defined by new mica growth. It largely transposed and obliterated the first. Both foliations may have developed during a single progressive deformation. We find inappropriate recent terrane models for the Cordillera Real and sub-Andean Zone of Ecuador. Instead we find remarkable similarities from one side of the Cordillera to the other, including a common structural history. In place of sutures, we find mostly intrusive contacts between major plutons and pelites. Triassic to Cretaceous events occurred on the autochthonous western edge of the Archaean Guyana Shield. The latest Cretaceous-Paleocene deformation is interpreted as the progressive
Directory of Open Access Journals (Sweden)
Ferenc Molnár
2017-09-01
Full Text Available The Peräpohja belt comprises a greenschist to amphibolite facies; multiply-folded supracrustal sequence of quartzites; mafic volcanics; carbonate rocks; black shales; mica schists and greywackes deposited from ca. 2.44 Ga to 1.92 Ga; during protracted rifting of the Archaean basement. Metamorphism and multiple folding of the basin fill occurred during the Svecofennian orogeny (1.92–1.80 Ga. The Rompas Au–U mineralization is hosted within deformed and metamorphosed calcsilicate veins in mafic volcanics. Textural evidence suggests that deposition and periods of uraninite re-mobilization were followed by localized hydrocarbon-bearing fluid flow which produced pyrobitumen crusts around grains of uraninite. Gold precipitated during the latest hydrothermal event at around 1.75 Ga. In situ U–Pb dating of uraninite by laser ablation inductively coupled mass spectroscopy (LA-ICP-MS, and Re–Os dating of molybdenite, indicate that primary hydrothermal uranium mineralization forms two age clusters; about 2.03–2.01 and 1.95–1.94 Ga. Resetting of the U–Pb system and precipitation of new generations of uraninite are associated with major deformation and metamorphic stages of the Svecofennian orogeny at 1.91–1.89 Ga, 1.85 Ga, and 1.80 Ga. Gold deposition was synchronous with the emplacement of the 1.75–1.78 Ga late/post-orogenic granitoids. The gold-producing hydrothermal event is also recorded by Re–Os dating of molybdenite from the gold-bearing Mg-metasomatized metasedimentary and metavolcanic units at the Palokas prospect; a few kilometres from Rompas. Results of this study confirm that some domains in the structure of uraninite may preserve the original crystallization age, despite an overprinting amphibolite facies metamorphic and other hydrothermal events. The study supports the utility of in situ U–Pb dating of uraninite and the ability of Re–Os dating to assist in sorting out different hydrothermal events in areas with complex
U-series isotopes in arc magma
Energy Technology Data Exchange (ETDEWEB)
Hawkesworth, C.; Turner, S.; McDermott, F.; Peate, D.; Van Calsteren, P.
1997-12-31
Thorium is not readily mobilized in the fluid component along destructive plate margins. Uranium is mobilized, and the resultant fractionation in U/Th can be used to estimate the rates of transfer slab derived components through the mantle wedge. The variations in Th/Yb, and by implication in the fractionation-corrected Th abundances of arc magmas largely depend on the contributions from subducted sediments. It is inferred that the distinctive high Th/Ta ratios of subduction related magmas primarily reflect the Th/Ta ratios of the subducted sediments, and that such high Th/Ta ratios are generated by processes other than those associated with recent subduction-related magmatism. Uranium and thorium isotopes have also been used to evaluate magma residence times within the crust. Thus, separated minerals and groundmass from six rocks erupted in the last 4,000 years from Soufriere on St. Vincent in the Lesser Antilles, scatter about a 50,000 year errorchron on the U-Th equiline diagram (Heath et al., 1977). Models are currently being developed to investigate how such apparent ages may relate to calculated replenishment times in steady state systems. Bulk continental crust has a lower U/Th ratio (0.25) than at least some estimates for the bulk Earth (0.26) and the depleted upper mantle (0.39). However, the island arc rocks with low U/Th ratios appear to have inherited those from subducted sediments, and arc rocks with a low sediment contribution have significantly higher U/Th. Consequently, the U/Th ratios of new crustal material generated along destructive plate margins are significantly higher than those of bulk continental crust. The low average U/Th of bulk crust may be primarily due to different crust generation processes in the Archaean, when U would be less mobile because conditions were less oxidising, and when residual garnet may have had more of a role in crust generation processes. Extended abstract. 4 figs., 23 refs.
Liebermann, C.; Hall, R.; Gough, A.
2017-12-01
The island of Sumatra is situated at the southwestern margin of the Indonesian archipelago. Although it is the sixth largest island in the world, the geology of the Sumatra sedimentary basins and their underlying basement is relatively poorly understood in terms of their provenance. This work is a multi-proxy provenance study utilizing U-Pb detrital zircon dating by LA-ICP-MS combined with optical and Raman spectroscopy-based heavy mineral analysis. It will help to unravel the stratigraphy of Sumatra, contribute to paleogeographic reconstruction of western SE Asia, and aid a wider understanding of Sumatran petroleum plays. Thin section analyses, heavy mineral assemblages, and >3500 concordant U-Pb zircon ages, from samples acquired during two fieldwork seasons indicate a mixed provenance for Cenozoic sedimentary formations, including both local igneous sources and mature basement rocks. Characteristic Precambrian zircon age spectra are found in all analysed Cenozoic sedimentary strata. These can be correlated with zircon age populations found in Sumatran basement rocks; Neoproterozoic and Mesoproterozoic age groups are dominant (c. 500-600 Ma, c. 850-1000 Ma, c. 1050-1200 Ma). Paleoproterozoic to Archaean zircons occur as minor populations. The Phanerozoic age spectra of the Cenozoic formations are characterised by distinct Carboniferous, Permo-Triassic, and Jurassic-Cretaceous zircon populations. Permo-Triassic zircons are interpreted to come from granitoids in the Malay peninsula or Sumatra itself. Eocene to Lower Miocene strata are characterised by ultrastable heavy minerals such as zircon, tourmaline, and rutile, which together with garnet, suggest the principal sources were igneous and metamorphic basement rocks. Cenozoic zircons appear only from the Middle Miocene onwards. This change is interpreted to indicate a new contribution from a local volcanic arc, and is supported by the occurrence of unstable heavy minerals such as apatite and clinopyroxene, and the
Hafnium isotope evidence for a transition in the dynamics of continental growth 3.2 Gyr ago.
Næraa, T; Scherstén, A; Rosing, M T; Kemp, A I S; Hoffmann, J E; Kokfelt, T F; Whitehouse, M J
2012-05-30
Earth's lithosphere probably experienced an evolution towards the modern plate tectonic regime, owing to secular changes in mantle temperature. Radiogenic isotope variations are interpreted as evidence for the declining rates of continental crustal growth over time, with some estimates suggesting that over 70% of the present continental crustal reservoir was extracted by the end of the Archaean eon. Patterns of crustal growth and reworking in rocks younger than three billion years (Gyr) are thought to reflect the assembly and break-up of supercontinents by Wilson cycle processes and mark an important change in lithosphere dynamics. In southern West Greenland numerous studies have, however, argued for subduction settings and crust growth by arc accretion back to 3.8 Gyr ago, suggesting that modern-day tectonic regimes operated during the formation of the earliest crustal rock record. Here we report in situ uranium-lead, hafnium and oxygen isotope data from zircons of basement rocks in southern West Greenland across the critical time period during which modern-like tectonic regimes could have initiated. Our data show pronounced differences in the hafnium isotope-time patterns across this interval, requiring changes in the characteristics of the magmatic protolith. The observations suggest that 3.9-3.5-Gyr-old rocks differentiated from a >3.9-Gyr-old source reservoir with a chondritic to slightly depleted hafnium isotope composition. In contrast, rocks formed after 3.2 Gyr ago register the first additions of juvenile depleted material (that is, new mantle-derived crust) since 3.9 Gyr ago, and are characterized by striking shifts in hafnium isotope ratios similar to those shown by Phanerozoic subduction-related orogens. These data suggest a transitional period 3.5-3.2 Gyr ago from an ancient (3.9-3.5 Gyr old) crustal evolutionary regime unlike that of modern plate tectonics to a geodynamic setting after 3.2 Gyr ago that involved juvenile crust generation by plate
Environmental health impacts of dispersed mineralisation in South Africa
Davies, T. C.; Mundalamo, H. R.
2010-11-01
The crust of South Africa has undergone various episodes and styles of mineralisation, dating as far back as the Archaean. The suite of minerals produced is diverse and includes metals, non-metals and industrial minerals. Since the Pleistocene, substantial quantities of elements, both nutritional and toxic, that were involved in ore forming processes, have been remobilised and redistributed by surficial processes of intense tropical weathering, leaching, eluviation, podsolisation and gleying; and more recently, by mining and related processes, as well as by other urban and industrial activities. As a result of this "dispersion" it is not uncommon to find large tracts of the country containing anomalous trace element contents or deficiencies in essential micro-nutrient elements. Through water and food crops, extremes in trace element variation in soils are transmitted into the food chain, with often undesirable consequences for human and animal health. But the known variations are not as yet adequately documented. Nor is there sufficient knowledge on the implications of these variations for the health of the environment and its ecosystems. Nutrient deficient soils may be the principal causative factor in the devastating endemic osteoarthritic disease that afflicts two-thirds of the women in Maputaland, for instance. The generally low Se status of agricultural soils could represent an important co-factor in the relatively high diffusion rates of HIV-AIDS in the country. The impact of geology on animal health also remains an area of critical concern to both farmers and managers of the hugely important wildlife game reserves. This paper discusses a few known relationships between trace element excess/deficiency stemming originally from mineralisation processes, and the local and regional distribution of diseases in man and animals in South Africa. It is submitted that the challenge for future research in medical geology would lie in an organised effort aimed at
Directory of Open Access Journals (Sweden)
Giuseppina Rea
2011-01-01
more sensitive to oxidative damage in the eukaryotic/cyanobacterial proteins compared to their bacterial orthologs. These results led us to hypothesize an archaean atmosphere less challenging in terms of ionizing radiation than the present one.
International Nuclear Information System (INIS)
Oliveira, Elson Paiva
2000-01-01
U-Pb ages of deformed mafic dyke and host migmatitic grey gneiss from the transition zone between the Archaen Uaua Block and the Caldeirao Belt are presented. Titanites from the metamorphic dyke's margin and zircons from the gneiss were dated at 2,039 ± 2 Ma and 2,956 ± 39 Ma, respectively. The Sm-Nd data (T DM =2,965 Ma and ε Nd(t) =1.69) on the gneiss, coupled with the U-Pb data on both dyke and gneiss, suggest than an Archaen granodioritic batholith, probably originated at an andean-type continental margin, was intruded by mafic dykes, and subsequently was reworked during the Paleoproterozoic collisional event associated with the development of the Salvador-Curaca Orogen. (author)
International Nuclear Information System (INIS)
Ahmad, Anwar; Ghufran, Rumana; Wahid, Zularisam Abd.
2011-01-01
Graphical abstract: SEM micrograph of granules; Outer surface of the granule; Scanning electron micrographs of the granule: Archaea (Methanosarcina sp.) showing the arrangement of bacterial cells in granule surrounded by extracellular polymeric substances (EPS), the seed sludge and granules sampled on day 150. Highlights: ► Examine the treatability of POME and effects of CaO–CKD on the granulation process in UASB reactors. ► The main objective was to determine the influent CaO–CKD concentration and the relationship between the CaO concentration in the feed and biomass accumulation, specific granulation, methanogenic activity, and the density and composition of granules. ► The biomass concentration profiles along the reactors and the size distribution of granules were also measured to track and to assess granulation, methanogenesis, and COD removal on levels at the industrial scale. ► SEM micrograph are showing smooth surface of granule with a large opening cavities likely for biogas escape. - Abstract: The granulation process in palm oil mill effluent using calcium oxide-cement kiln dust (CaO–CKD) provides an attractive and cost effective treatment option. In this study the efficiency of CaO–CKD at doses of 1.5–20 g/l was tested in batch experiments and found that 10 g of CaO/l caused the greatest degradation of VFA, butyrate and acetate. An upflow anaerobic sludge blanket (UASB) reactor was operated continuously at 35 °C for 150 days to investigate the effect of CaO–CKD on sludge granulation and methanogenesis during start-up. The treatment of POME emphasized the influence of varying organic loading rates (OLR). Up to 94.9% of COD was removed when the reactor was fed with the 15.5–65.5 g-COD g/l at an OLR of 4.5–12.5 kg-COD/m 3 d, suggesting the feasibility of using CaO in an UASB process to treat POME. The ratio of volatile solids/total solids (VS/TS) and volatile fatty acids in the anaerobic sludge in the UASB reactor decreased
Final Report Systems Level Analysis of the Function and Adaptive Responses of Methanogenic Consortia
Energy Technology Data Exchange (ETDEWEB)
Lovley, Derek R. [Univ. of Massachusetts, Amherst, MA (United States)
2015-03-09
The purpose of this research was to determine whether the syntrophic microbial associations that are central to the functioning of methane-producing terrestrial wetlands can be predictively modeled with coupled multi-species genome-scale metabolic models. Such models are important because methane is an important greenhouse gas and there is a need to predictively model how the methane-producing microbial communities will respond to environmental perturbations, such as global climate change. The research discovered that the most prodigious methane-producing microorganisms on earth participate in a previously unrecognized form of energy exchange. The methane-producers Methanosaeta and Methanosarcina forge biological electrical connections with other microbes in order to obtain electrons to reduce carbon dioxide to methane. This direct interspecies electron transfer (DIET) was demonstrated in complex microbial communities as well as in defined co-cultures. For example, metatranscriptomic analysis of gene expression in both natural communities and defined co-cultures demonstrated that Methanosaeta species highly expressed genes for the enzymes for the reduction of carbon dioxide to methane. Furthermore, Methanosaeta’s electron-donating partners highly expressed genes for the biological electrical connections known as microbial nanowires. A series of studies involving transcriptomics, genome resequencing, and analysis of the metabolism of a series of strains with targeted gene deletions, further elucidated the mechanisms and energetics of DIET in methane-producing co-cultures, as well as in a co-culture of Geobacter metallireducens and Geobacter sulfurreducens, which provided a system for studying DIET with two genetically tractable partners. Genome-scale modeling of DIET in the G. metallireducens/G. sulfurreducens co-culture suggested that DIET provides more energy to the electron-donating partner that electron exchange via interspecies hydrogen transfer, but that the
Directory of Open Access Journals (Sweden)
Andreas Reim
2017-05-01
mostly detected on the level of operational taxonomic units (OTUs; 97% sequence similarity. The treatments resulted in change of the relative abundance of several archaeal OTUs. Some OTUs of Methanobacterium, Methanosaeta, Methanosarcina, Methanocella and Methanomassiliicoccus increased, while some of Methanolinea and Methanosaeta decreased. Bacterial OTUs within Firmicutes, Cyanobacteria, Planctomycetes and Deltaproteobacteria increased, while OTUs within other proteobacterial classes decreased.
Methane production potential and microbial community structure for different forest soils
Matsumoto, Y.; Ueyama, M.; Kominami, Y.; Endo, R.; Tokumoto, H.; Hirano, T.; Takagi, K.; Takahashi, Y.; Iwata, H.; Harazono, Y.
2017-12-01
Forest soils are often considered as a methane (CH4) sink, but anaerobic microsites potentially decrease the sink at the ecosystem scale. In this study, we measured biological CH4 production potential of soils at various ecosystems, including upland forests, a lowland forest, and a bog, and analyzed microbial community structure using 16S ribosomal RNA (rRNA) genes. Three different types of soil samples (upland, bank of the stream, and center of the stream) were collected from Yamashiro forest meteorology research site (YMS) at Kyoto, Japan, on 11 May 2017. The soils were incubated at dark and anaerobic conditions under three different temperatures (37°C, 25°C, and 10°C) from 9 June 2017. The upland soils emitted CH4 with largest yields among the three soils at 37°C and 25°C, although no CH4 emission was observed at 10°C. For all temperature ranges, the emission started to increase with a 14- to 20-days lag after the start of the incubation. The lag indicates a slow transition to anaerobic conditions; as dissolved oxygen in water decreased, the number and/or activity of anaerobic bacteria like methanogens increased. The soils at the bank and center of the stream emitted CH4 with smaller yields than the upland soils in the three temperature ranges. The microbial community analyses indicate that methanogenic archaea presented at the three soils including the aerobic upland soil, but compositions of methanogenic archaea were different among the soils. In upland soils, hydrogenotrophic methanogens, such as Methanobacterium and Methanothermobacter, consisted almost all of the total methanogen detected. In the bank and center of the stream, soils contained approximately 10-25% of acetoclastic methanogens, such as Methanosarcina and Methanosaeta, among the total methanogen detected. Methanotrophs, a genus of Methanobacteriaceae, was appeared in the all types of soils. We will present results from same incubation and 16S rRNA analyses for other ecosystems, including
Golynsky, Alexander; Golynsky, Dmitry; Kiselev, Alexander; Masolov, Valery
2014-05-01
Russian aeromagnetic investigations in the Prince Charles Mountains (PCM) and surrounding areas, seek to contribute data on the tectonics of Precambrian igneous belts and cratonic fragments, the crustal structure of the Lambert Rift system and other major aspects of Antarctic geology, critical to understanding continental growth processes (Golynsky et al., 2006). Over the past decade, the Polar Marine Geoscience Expedition projects acquired approximately 77,400 line-km of aeromagnetic data over the largely ice-covered regions of MacRobertson Land and Princess Elizabeth Land. The airborne surveys were performed with a standard profile spacing of 5 km and tie-line interval of 15-25 km. The total amount of the Russian aeromagnetic data collected in this region exceeded more than 165,000 line-km. Together with the PCMEGA and AGAP surveys (Damaske and McLean, 2005; Ferraccioli et al., 2011) the PMGE dataset forms the longest transect ever mapped in East Antarctica exceeding 1950 km in length. Several distinct crustal subdivisions are clearly differentiated in the magnetic data. The high-amplitude positive anomalies that extend around the Vestfold Hills and Rauer Islands are likely be attributed to the southern boundary of high-grade metamorphic Late Archean craton. The northern PCM that are composed by ~1 Ga orthogneiss and charnockite display a predominantly northeasterly trending magnetic fabric that continues to the eastern shoulder of the Lambert Rift. The aeromagnetic data from the Southern PCM reveal the spatial boundary of the Archaean Ruker Terrane that is characterized by a short-wavelength anomalies and the prominent Ruker Anomaly that is associated with a banded iron formation. The prominent alternating system of linear NE-SW positive and negative anomalies over the eastern shoulder of the Lambert Rift may reflect the western boundary of the Princess Elizabeth Land cratonic(?) block, although its relationships and tectonic origin remained largely ambiguous
Şengör, A. M. Celâl; Özeren, Mehmet Sinan; Keskin, Mehmet; Sakınç, Mehmet; Özbakır, Ali Değer; Kayan, İlhan
Turkic-type orogens as the Altaids of Central Asia, the late Devonian-early Carboniferous Lachlan Belt in southeastern Australia, and the Pan-African collage of northeast Afro-Arabia. It is likely that Archaean collisions were dominated by Turkic-type post-collisional events rather than Tibetan ones that only became common in the Proterozoic.