Sample records for arca zebra comercializada

  1. [Mollusc diversity in an Arca zebra (Mollusca: Bivalvia) community, Chacopata, Sucre, Venezuela].

    Prieto, A S; Ruiz, L J; García, N; Alvarez, M


    The diversity of a subtidal epifaunal mollusk community was studied from September, 1990 to September, 1991 in Chacopata, Sucre State, Venezuela. There were 40 species (24 bivalves and 16 gastropods). The diversity indexes (H' = 2.087, J' = 0.392, 1/D = 0.528) were low when compared with other tropical zones. Monthly diversity reached its maximum in September, 1990 (1.63 bits/ind.) and July, 1991 (1.60 bits/ind.); minimum diversity occurred in June, 1991 (0.52 bits/ind.). A Log series model applied to species abundance data showed a straight line with a diversity index alpha of 5.56. Of 40 species identified, the turkeywing Arca zebra was dominant (69% in number of individuals and 72% of biomass) followed by Pinctada imbricata, Modiolus squamosus, Chama macerophyla and Anadara notabilis. The predatory snails Phyllonotus pomum, Chicoreus brevifrons and Murex recurvirostris seemed to have trophic relationships with A. zebra. The total mean biomass in wet weight (469.20 +/- 263 g m-2, shell included) was high which indicates that A. zebra, a species with a rapid growth rate, occupies a central role in the assemblage as an efficient filter feeder that converts planktonic food into available biomass, supporting one of the most important fisheries in Venezuela. PMID:11935909

  2. Zebra mussel monitoring

    Hennagir, T.


    In less than a decade, zebra mussels have become the latest environmental scourge to plague the North American power industry. Infestations in the Great Lakes region have already reached natural disaster proportions. The invasion shows little sign of subsiding; Michigan's inland waters are the next most likely threatened area. In the southern United States, the mussles' migration has extended about 50 miles deeper than experts had originally predicted. By the year 2000, zebra mussel monitoring and control efforts will cost business and industry $5 billion, according to the federal Aquatic Nuisance Prevention and Control Act of 1990. Estimates of more than $1 million to control mussel fouling are projected for the Great Lakes area alone. While small independent hydropower stations are not as susceptible to zebra mussles as coal or nuclear facilities, there is cause for concern. Infestations can quickly foul hydropower plant components, hampering equipment operation and reducing facility efficiency. In extreme cases, leaving the mussels unchecked can result in stoplog gate flow blockage or false water level gauge readings. Advance prevention is often an effective first-line of defense against this troublesome, rapidly spreading and extremely prolific mollusk. Mussel monitoring efforts should begin a year in advance of when zebra mussels are expected to appear in a given location. Hydropower facility components that come into contact or rely exclusively on raw water are at greatest risk, as are other external components such as embayment walls, screens, trashracks and fish ladders.

  3. A Zebra in the Classroom.

    Leake, Devin; Morvillo, Nancy


    Describes the care and breeding of zebra fish, suggests various experiments and observations easily performed in a classroom setting, and provides some ideas to further student interest and exploration of these organisms. (DDR)

  4. Intracardiac thrombosis in the Cape Mountain Zebra

    G.F. Bath


    Full Text Available The Cape mountain zebra (Equus zebra zebra is one of the rarest species of mammals in South Africa, and is threatened with extinction. At present there are less than 200 in existence, of which approximately 160 occur in the Mountain Zebra National Park near Cradock. Because of the rarity of the species and the undesirable concentration of the majority in an area of only 6 536 ha, a post-mortem examination is performed, if possible, on all animals to establish cause of death with the purpose of preventing large-scale mortalities. This is done even if the carcass is in a fairly advanced state of decomposition. Amongst the examinations so performed were two zebra which were believed to have died as a result of intraventricular thrombosis. The rarity of this condition and of the Cape mountain zebra makes a report on these cases necessary.

  5. Zebra: Searching for Rare Diseases

    Dragusin, Radu; Petcu, Paula; Lioma, Christina;


    disease diagnostic hypotheses in the domain of medical IR. In this work, we build upon an existing vertical medical search engine, Zebra, that is focused on rare disease diagnosis. In previous work, Zebra has been evaluated using real-life medical cases of rare and difficult diseases, and has been found...... to be a useful and competitive tool for clinicians. In this work, we extend Zebra’s functionalities to optimise the task of medical diagnosis through search as follows: we add the option of grouping retrieved documents into clusters based on disease name occurrence, and we offer a ‘disease......Task-based search addresses situations where standard off-the-shelf Information Retrieval (IR) technology may not suffice to satisfy users in their tasks. In these situations, IR systems should be tailored to the user’s task-specific needs and requirements. One such task is searching for rare...

  6. Last news on zebra pattern

    Chernov, Gennady


    The publications of the last three years concerning to studying of the most intriguing fine structure in type IV solar radio bursts - zebra pattern (ZP), are surveyed. The main attention is paid to new observations, irrespective of whether a paper does include detailed interpretation of an event or simply reports about the beginning of operation of a new tool. The radiation mechanism of the ZP on a double plasma resonance (DPR) remains the most widespread and standard, though ten alternative mechanisms were offered. However, in a number of works difficulties with the explanation of a complex zebra are noted, especially in a combination with fiber bursts and spikes. Therefore, several papers in which the radiation mechanism of a zebra on the DPR is improved, are considered in more detail. Without positional observations we have a great opportunity to follow the dynamics of flare processes using SDO / AIA images in several EUV lines. In the discussion, the debatable questions with the comparison of mechanism on...

  7. Androgen receptor gene polymorphism in zebra species

    Hideyuki Ito


    Full Text Available Androgen receptor genes (AR have been found to have associations with reproductive development, behavioral traits, and disorders in humans. However, the influence of similar genetic effects on the behavior of other animals is scarce. We examined the loci AR glutamine repeat (ARQ in 44 Grevy's zebras, 23 plains zebras, and three mountain zebras, and compared them with those of domesticated horses. We observed polymorphism among zebra species and between zebra and horse. As androgens such as testosterone influence aggressiveness, AR polymorphism among equid species may be associated with differences in levels of aggression and tameness. Our findings indicate that it would be useful to conduct further studies focusing on the potential association between AR and personality traits, and to understand domestication of equid species.

  8. Zebra Stripes through the Eyes of Their Predators, Zebras, and Humans.

    Amanda D Melin

    Full Text Available The century-old idea that stripes make zebras cryptic to large carnivores has never been examined systematically. We evaluated this hypothesis by passing digital images of zebras through species-specific spatial and colour filters to simulate their appearance for the visual systems of zebras' primary predators and zebras themselves. We also measured stripe widths and luminance contrast to estimate the maximum distances from which lions, spotted hyaenas, and zebras can resolve stripes. We found that beyond ca. 50 m (daylight and 30 m (twilight zebra stripes are difficult for the estimated visual systems of large carnivores to resolve, but not humans. On moonless nights, stripes are difficult for all species to resolve beyond ca. 9 m. In open treeless habitats where zebras spend most time, zebras are as clearly identified by the lion visual system as are similar-sized ungulates, suggesting that stripes cannot confer crypsis by disrupting the zebra's outline. Stripes confer a minor advantage over solid pelage in masking body shape in woodlands, but the effect is stronger for humans than for predators. Zebras appear to be less able than humans to resolve stripes although they are better than their chief predators. In conclusion, compared to the uniform pelage of other sympatric herbivores it appears highly unlikely that stripes are a form of anti-predator camouflage.

  9. ZEBRA battery meets USABC goals

    Dustmann, Cord-H.

    In 1990, the California Air Resources Board has established a mandate to introduce electric vehicles in order to improve air quality in Los Angeles and other capitals. The United States Advanced Battery Consortium has been formed by the big car companies, Electric Power Research Institute (EPRI) and the Department of Energy in order to establish the requirements on EV-batteries and to support battery development. The ZEBRA battery system is a candidate to power future electric vehicles. Not only because its energy density is three-fold that of lead acid batteries (50% more than NiMH) but also because of all the other EV requirements such as power density, no maintenance, summer and winter operation, safety, failure tolerance and low cost potential are fulfilled. The electrode material is plain salt and nickel in combination with a ceramic electrolyte. The cell voltage is 2.58 V and the capacity of a standard cell is 32 Ah. Some hundred cells are connected in series and parallel to form a battery with about 300 V OCV. The battery system including battery controller, main circuit-breaker and cooling system is engineered for vehicle integration and ready to be mounted in a vehicle [J. Gaub, A. van Zyl, Mercedes-Benz Electric Vehicles with ZEBRA Batteries, EVS-14, Orlando, FL, Dec. 1997]. The background of these features are described.

  10. Social organisation of the Cape Mountain Zebra Equus Z. Zebra in the Mountain Zebra National Park*

    B. L Penzhorn


    Full Text Available The social structure of Cape mountain zebras con- sists of breeding herds of one stallion, one to five mares and their offspring, as well as bachelor groups. Breeding herds remain stable over many years and when the stallion is displaced by another, the mares remain together. A dominance hierarchy exists, but leadership is random. Foals leave their maternal herds at a mean age of 22,3 months. The herd stallion tries to prevent the foals from leaving the herd. Bachelor groups are not as well defined as breeding herds, but core groups could be identified through a principal components analysis ordination. Family ties may be important in the establishment of core groups. Bachelors succeed in becoming herd stallions when about five years old. Aspects of the possible evolution of the social structure are discussed.

  11. EPRI's zebra mussel monitoring and control guidelines

    The Electric Power Research Institute (EPRI) Zebra Mussel Monitoring and Control Guidelines is a comprehensive compilation of US and European practices. The zebra mussel has infested all the Great Lakes and is positioned to spread to the adjoining river basins. The impact of the zebra mussel on power plants is as a biofouler clogging water systems and heat exchangers. The EPRI guidelines discuss the distribution of the zebra mussel in the US, identification of the zebra mussel, potential threats to power plants, and methods to initiate the monitoring and control program. Both preventive and corrective measures are presented. Preventive measures include various monitoring methods to initiate control techniques. The control techniques include both chemical and nonchemical together with combining techniques. Corrective methods include operational considerations, chemical cleaning, and mechanical/physical cleaning. It may also be possible to incorporate design changes, such as open to closed-loop backfit, backflushing, or pretreatment for closed systems. Table 1 shows a matrix of the monitoring methods. Table 2 presents a control matrix related to nuclear, fossil, and hydro raw water systems. Table 3 is a summary of the applicability of treatments to the various raw water systems. Appendixes are included that contain specifications to aid utilities in implementing several of the control technologies

  12. El "Arca" de No?? en las fuentes ??rabes

    Castillo Castillo, Concepci??n


    El conocido tema b??blico del Arca de No?? fue asimilado, como otros tantos, por la tradici??n musulmana. Espigando en las distintas fuentes ??rabes hemos reunido unos datos acerca del Arca bajo los apartados de descripci??n, habitantes, y recorrido y asentam.Umto, llegando a la conclusi??n de c??mo a trav??s de los siglos la tradici??n musulmana se ha encargado de a??adir datos que en la mayor??a de los casos se alejan bastante de su punto de origen.

  13. 77 FR 27817 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Approving a Proposed Rule Change To List...


    ... (``Valuation Agent''). \\4\\ Each Unit will represent an equal, undivided interest in the net assets of the Trust... calculation of the value of the net assets of the Trust and the NAV.\\20\\ NYSE Arca Equities Rule 8.201(e)(2... Arca's ``circuit breaker'' rule. See NYSE Arca Equities Rule 7.12. \\20\\ See Notice, supra note 3, 77...

  14. Cave crawling in zebra finch skulls

    Larsen, Ole Næsbye; Salomon, Rasmus; Jensen, Kenneth Kragh;

    Cave crawling in zebra finch skulls: what is the functional interaural canal? Ole Næsbye Larsen, Rasmus Salomon, Kenneth Kragh Jensen, and Jakob Christensen-Dalsgaard Department of Biology, University of Southern Denmark, Campusvej 55, DK-5230 Odense M, Denmark The middle ears of birds are...... gains and delays in the IAC can produce very different directionalities of the ears but it is still uncertain how interaural transmission gain and delay can be shaped by evolution by anatomical adaptations. A closer inspection of the zebra finch cranium using micro-CT scanning reveals that not only is...

  15. Research continues on zebra mussel control

    Researchers are working on many fronts to learn methods for controlling and combatting zebra mussels, a species of mussel that can attach to the inside of water intakes at hydroelectric and thermal power plants, and can reduce or block water flow. Biologists at the University of Toledo in Ohio report that compounds from the African soapberry plant called lemmatoxins are lethal to zebra mussels. In laboratory tests, researchers have determined 1 to 2 milligrams of purified lemmatoxins per liter will kill the mussels. In field tests, biologist Harold Lee flushed water through a mussel-infested pipe. He found that the berry extract killed mussels in four to eight hours, making continuous treatment of water intake pipes unnecessary, according to a report in New Scientists. The University of Toledo participated in another project, funded by the American Water Works Association Research Foundation. That project team included the cities of Toledo and Cleveland, Ohio, Finkbeiner, Pettis ampersand Strout, Ltd. consulting engineers, and researchers from Ohio's Case Western Reserve University. The team identified a chemical oxidant, sodium hypochlorite, as a cost-effective agent for controlling zebra mussels at water treatment plant intakes. Toledo has used the sodium hypochlorite and reports the chemical has cleared colonies of zebra mussels that had attached to the intake of its water treatment plant

  16. Dynamics of zebra finch and mockingbird vocalizations

    Cimenser, Aylin

    Along with humans, whales, and bats, three groups of birds which include songbirds (oscines) such as the Zebra Finch (Taeniopygia guttata) and Mockingbird (Mimus polyglottos) are the only creatures known to learn sounds by imitation. Numerous similarities between human and songbird vocalizations exist and, recently, it has been shown that Zebra Finch in particular possesses a gene, FoxP2, known to be involved in human language. This thesis investigates song development in Zebra Finches, as well as the temporal dynamics of song in Mockingbirds. Zebra Finches have long been the system of choice for studying vocal development, ontogeny, and complexity in birdsong. Physicists find them intriguing because the spectrally complex vocalizations of the Zebra Finch can exhibit sudden transitions to chaotic dynamics, period doubling & mode-locking phenomena. Mockingbirds, by contrast, provide an ideal system to examine the richness of an avian repertoire, since these musically versatile songbirds typically know upwards of 200 songs. To analyse birdsong data, we have developed a novel clustering algorithm that can be applied to the bird's syllables, tracing their dynamics back to the earliest stages of vocal development. To characterize birdsong we have used Fourier techniques, based upon multitaper spectral analysis, to optimally work around the constraints imposed by (Heisenberg's) time-frequency uncertainty principle. Furthermore, estimates that provide optimal compromise between frequency and temporal resolution have beautiful connections with solutions to the Helmholtz wave equation in prolate spheroidal coordinates. We have used this connection to provide firm foundation for certain heuristics used in the literature to compute associated spectral derivatives and supply a pedagogical account here in this thesis. They are of interest because spectral derivatives emphasize sudden changes in the dynamics of the underlying phenomenon, and often provide a nice way to visualize

  17. Physical Conditions in the Source Region of a Zebra Structure

    Yasnov, L. V.; Karlický, M.; Stupishin, A. G.


    We analyze the physical conditions in the source region of a zebra structure, observed with the Ondřejov radiospectrograph during the 1 August 2010 solar flare. To determine the gyro-frequency harmonic numbers of the observed zebra lines, we compute the magnetic field strength, the electron density, and their spatial scales in the source region of the zebra structure. The region where the flare occurred is analyzed using EUV (171 Å and 335 Å) observations. To determine the conditions in the zebra source region, the magnetic field structure is reconstructed using observed photospheric magnetic field data. By computing the dependence of the magnetic field vs. height in this reconstruction and by comparing the magnetic field strength derived from the zebra structure, we determine the dependence of the electron density vs. height in the zebra source-region. We identify the loops where the zebra structure was generated at heights of about 2.5 - 3.3 Mm. Assuming the barometric law for the electron density, we determine the temperature in the zebra source-region to be T ≈ 2.0 × 104 K. Comparing the obtained values of the temperature and electron density in the zebra source-region with a model of the solar atmosphere, we find that the zebra structure was generated in the transition region, in agreement with our previous results.

  18. CA/CPS: A Communications ZEBRA implementation using CPS

    CZ/CPS is an implementation of the Communications ZEBRA distributed computing environment utilizing the CPS communications protocol. CZ/CPS is intended for parallelization of high energy physics application programs using the CERN Program Library memory and data structure management features. CZ/CPS provides transparent communication of ZEBRA data structures among cooperative processes using standard interfaces for ZEBRA I/O. Examples of usage in a CPS HBOOK4 and GEANT3 application are provided

  19. Female Zebra Finches Smell Their Eggs.

    Sarah Golüke

    Full Text Available Parental investment in unrelated offspring seems maladaptive from an evolutionary perspective, due to the costs of energy and resources that cannot be invested in related offspring at the same time. Therefore selection should favour mechanisms to discriminate between own and foreign offspring. In birds, much emphasis has been placed on understanding the visual mechanisms underlying egg recognition. However, olfactory egg recognition has almost been completely ignored. Here, we investigated whether female zebra finches (Taeniopygia guttata are able to discriminate between their own and a conspecific egg based on olfactory cues alone. Zebra finches are colonial-breeding songbirds. Eggs are monomorphic, i.e. without any spotting pattern, and intraspecific brood parasitism frequently occurs. In a binary choice experiment, female zebra finches were given the choice between the scent of their own and a conspecific egg. After the onset of incubation, females chose randomly and showed no sign of discrimination. However, shortly before hatching, females preferred significantly the odour of their own egg. The finding that females are capable to smell their own egg may inspire more research on the potential of olfaction involved in egg recognition, especially in cases where visual cues might be limited.

  20. Female Zebra Finches Smell Their Eggs.

    Golüke, Sarah; Dörrenberg, Sebastian; Krause, E Tobias; Caspers, Barbara A


    Parental investment in unrelated offspring seems maladaptive from an evolutionary perspective, due to the costs of energy and resources that cannot be invested in related offspring at the same time. Therefore selection should favour mechanisms to discriminate between own and foreign offspring. In birds, much emphasis has been placed on understanding the visual mechanisms underlying egg recognition. However, olfactory egg recognition has almost been completely ignored. Here, we investigated whether female zebra finches (Taeniopygia guttata) are able to discriminate between their own and a conspecific egg based on olfactory cues alone. Zebra finches are colonial-breeding songbirds. Eggs are monomorphic, i.e. without any spotting pattern, and intraspecific brood parasitism frequently occurs. In a binary choice experiment, female zebra finches were given the choice between the scent of their own and a conspecific egg. After the onset of incubation, females chose randomly and showed no sign of discrimination. However, shortly before hatching, females preferred significantly the odour of their own egg. The finding that females are capable to smell their own egg may inspire more research on the potential of olfaction involved in egg recognition, especially in cases where visual cues might be limited. PMID:27192061


    GALDIANO, Lívia Cordaro


    Full Text Available On the survey of the use and the trade of medicinal plants is necessary in first place differentiatemany category of the yield. Some plants are traded such as, usually in dryness full kind or pulverized, others comelike extracts, others like distils oils or express and finally many of them are traded on the one chemical componentdefined kind. Then, the present work, has like achievement to rise all the varieties of medicinal plants cultivatedand traded by market gardeners of the municipal district Ituverava-SP. Were visited 15 market gardens, whichof them were applied a questionary to the responsible of the same, in period from July to August/2006.Amongthe cultivated plants, the kinds quotations are: Mint(Hortelã, Watercress(Agrião, Balm-mint (Erva-cidreira,”Capim-limão”, Cabbage (Couve,” Belladona”,” Picão”,” Mentrasso””, Erva Santa-maria”,” Boldo”,” Alfavaca”,”Canforim”, Basil( Manjericão, Wormwood ( Losna,Rosemary( Alecrim, Saffron (Açafrão.Mint was the plantthat showed higher eminence between the quotations above, being this cultivated and traded in 13 of 15 marketgarden studied. All of the market gardeners didn’t know how to answer, surely, the question about the utility ofeach plant traded, what shows the importance for information about the such subject. In agreement with the gainedfigures, could decide that the information about the medicinal plant’s cultivation are of huge importance for thecommunity, being that the same are cultivated and commercialized by the market gardeners of the municipal district Ituverava-SP, with eminence for mint.No levantamento do uso e comércio de plantas medicinais, é necessário, em primeiro lugar,distinguir diversas classes de produto. Algumas plantas são comercializadas como tais, geralmente em forma seca,inteiras ou pulverizadas, outras vêm como extratos, outras, como óleos destilados ou expressos, e finalmente váriassão comercializadas na forma de um

  2. FindZebra: A search engine for rare diseases

    Dragusin, Radu; Petcu, Paula; Lioma, Christina Amalia; Larsen, Birger; Jørgensen, Hans Henrik; Cox, Ingemar; Hansen, Lars Kai; Ingwersen, Peter; Winther, Ole


    Background: The web has become a primary information resource about illnesses and treatments for both medical and non-medical users. Standard web search is by far the most common interface for such information. It is therefore of interest to find out how well web search engines work for diagnostic...... approach for web search engines for rare disease diagnosis which includes 56 real life diagnostic cases, state-of-the-art evaluation measures, and curated information resources. In addition, we introduce FindZebra, a specialized (vertical) rare disease search engine. FindZebra is powered by open source...... search technology and uses curated freely available online medical information. Results: FindZebra outperforms Google Search in both default setup and customised to the resources used by FindZebra. We extend FindZebra with specialized functionalities exploiting medical ontological information and UMLS...

  3. The complete mitochondrial genome of the Metriaclima zebra.

    Chen, Xi; Song, Xiao-Lei; Chen, Ling-Yun; Li, Yong


    Cichlid fish from East Africa are remarkable for phenotypic and behavioral diversity on a backdrop of genomic similarity. Metriaclima zebra is a member of the Cichlidae family. Here, we reported the complete mitogenome sequence of M. zebra, which was 16 582 bp and contained 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes and 1 non-coding control region. A phylogenetic tree was constructed based on complete mitogenomes of M. zebra and 11 closely related Cichlidae species to approve the accuracy. The complete mitochondrial genome of the M. zebra would provide more information for the research of M. zebra and the evolution of Cichlidae family. PMID:26273916

  4. Análise de amostras de flores de Calêndula (Calendula officinalis L., Asteraceae) comercializadas na grande Curitiba

    Lais Mondadori Otramario Santos; Luciana Aparecida de Oliveira; Eliane Patrícia Sichinel Tibulo; Cristina Peitz de Lima


    A espécie Calendula officinalis L. é uma planta herbácea pertencente à família Asteraceae, suas flores apresentam propriedades antimicrobianas, emolientes, antiinflamatórias e tonificantes da pele. Os flavonoides são utilizados como marcadores para avaliar a qualidade da droga vegetal. O objetivo do presente trabalho foi avaliar a identidade e qualidade de seis amostras de flores de C. officinalis L. comercializadas na Grande Curitiba (PR). Foram realizados os ensaios de identificação macrosc...

  5. Cave crawling in zebra Finch skulls

    Larsen, Ole Næsbye; Salomon, Rasmus; Jensen, Kenneth Kragh;


    The middle ears of birds are acoustically coupled through an air-filled interaural canal, often illustrated and modelled as a simple tube. It allows sound to propagate through the skull from one ear to the other and considerably enhance the cues for directional hearing by interaction with the...... by anatomical adaptations during evolution. A closer inspection of the zebra finch cranium using micro-CT scanning reveals that not only is IAC trabeculated and irregularly shaped but it also communicates with a set of highly complex, air-filled canals in the skull extending to the base of the beak...

  6. Environmentally Safe Control of Zebra Mussel Fouling

    Daniel Molloy


    The two primary objectives of this USDOE-NETL contract were successfully achieved during the project: (1) to accelerate research on the development of the bacterium Pseudomonas fluorescens strain CL145A (Pf-CL145A) as a biocontrol agent for zebra mussels (Dreissena polymorpha) and quagga mussels (Dreissena rostriformis bugensis)--two invasive freshwater bivalve species that are infesting water pipes in power plants; and (2) to identify a private-sector company that would move forward to commercialize Pf-CL145A as a substitute for the current polluting use of biocide chemicals for control of these dreissenid mussels in power plant pipes.

  7. Analysis of the ArcA regulon in anaerobically grown Salmonella enterica sv. Typhimurium

    Porwollik Steffen


    Full Text Available Abstract Background Salmonella enterica serovar Typhimurium (S. Typhimurium is a Gram-negative pathogen that must successfully adapt to the broad fluctuations in the concentration of dissolved dioxygen encountered in the host. In Escherichia coli, ArcA (Aerobic Respiratory Control helps the cells to sense and respond to the presence of dioxygen. The global role of ArcA in E. coli is well characterized; however, little is known about its role in anaerobically grown S. Typhimurium. Results We compared the transcriptional profiles of the virulent wild-type (WT strain (ATCC 14028s and its isogenic arcA mutant grown under anaerobic conditions. We found that ArcA directly or indirectly regulates 392 genes (8.5% of the genome; of these, 138 genes are poorly characterized. Regulation by ArcA in S. Typhimurium is similar, but distinct from that in E. coli. Thus, genes/operons involved in core metabolic pathways (e.g., succinyl-CoA, fatty acid degradation, cytochrome oxidase complexes, flagellar biosynthesis, motility, and chemotaxis were regulated similarly in the two organisms. However, genes/operons present in both organisms, but regulated differently by ArcA in S. Typhimurium included those coding for ethanolamine utilization, lactate transport and metabolism, and succinate dehydrogenases. Salmonella-specific genes/operons regulated by ArcA included those required for propanediol utilization, flagellar genes (mcpAC, cheV, Gifsy-1 prophage genes, and three SPI-3 genes (mgtBC, slsA, STM3784. In agreement with our microarray data, the arcA mutant was non-motile, lacked flagella, and was as virulent in mice as the WT. Additionally, we identified a set of 120 genes whose regulation was shared with the anaerobic redox regulator, Fnr. Conclusion(s We have identified the ArcA regulon in anaerobically grown S. Typhimurium. Our results demonstrated that in S. Typhimurium, ArcA serves as a transcriptional regulator coordinating cellular metabolism, flagella

  8. The zebra mussel: US utility implications

    Dreissena polymorpha, the freshwater macrofouling zebra mussel, was introduced to Lake St. Clair, near Detroit, Michigan, in 1985. It has since spread throughout Lake Erie. Its planktonic veliger larval stage disperses on water currents and adults are transported by human and natural vectors, making it likely to spread throughout most of the United States and southern Canada except for the southwestern and southern United State, where summer water temperatures are above tolerated levels. Veligers enter raw water systems on intake currents to settle and grow to adults attached by secreted byssal threads to hard surfaces. Accumulations of adults impede flow, aggravate sedimentation and corrosion, and foul small-diameter components. Settlement occurs at flow velocities less than 1.5--2.0 m/sec. Mussels can reduce effective pipe diameters and foul intake structures, steam condensers, heat exchangers, fire protection systems, and cooling tower basins. Establishment of mussels in raw water systems should be prevented because subsequent removal is difficult and expensive. Mitigation procedures include manual removal, robotic cleaning, thermal backwashing, water jetting, application of molluscicides, and possibly line pigging and acidic chemical cleaning. Control technologies include oxidizing and non-oxidizing molluscicides, robotic cleaning, shell strainers, exposure of veligers to high voltage electrical fields, thermal backwashing and sand-filtration. The United States power industry can utilize extensive European experience with this species and domestic experience with the Asian clam in its development of effective controls for zebra mussel fouling

  9. [Application of zebra fishes in studies on traditional Chinese medicines].

    Tian, Li-li; Zhu, Guo-fu


    The zebra fish model, as an integral animal model, features small volume, high throughput, low cost, short cycle and reliable experimental results, thus has been widely used in medical studies. Traditional Chinese medicines (TCM) constitute a complex system, their active ingredients and action mechanisms are among study hotspots in during the development of modern TCMs. Along with the constant improvement of advanced technologies and methods, zebra fishes have been increasingly applied in studies on TCMs and shown advantages in active screening, and toxicity and metabolism studies. In this paper, TCM studies by using zebra fishes in recent years are summarized to provide new ideas and methods for basic studies on TCMs. PMID:26087540

  10. El sentido de la historia en El Arca Rusa.

    Nicolás Ocaranza


    El Arca Rusa de Alexandr Sokurov es un magnífico espejismo, una imagen histórica evocada en una sola toma y secuencia audiovisual que no necesitó de montaje para el registro cinematográfico. La película, rodada en video de alta definición en el actual museo Hermitage de San Petersburgo, se despliega en un continuum, sin interrupciones ni quiebres de lo que parece ser la evocación de un tiempo perdido. Esta obra se convirtió en el largometraje filmado ininterrumpidamente más extenso de la hist...

  11. Protandric hermaphroditism in the bivalve Arca noae (Mollusca: Arcidae

    G. BELLO


    Full Text Available Following the histological analysis of Arca noae samples from the south-western Adriatic Sea, five hermaphroditic specimens were found out of 168 sexed individuals (3.0%. The hermaphrodite gonads showed the co-occurrence of male and female germ cells within the same acini, i.e. both spermatozoa in the lumen and oogonia lining its wall. Oogonia increased in size through winter, thus suggesting that the direction of sex change is from male to female. Both the biometrical analyses and theoretical considerations strongly suggest that A. noae is an obligate protandric species.

  12. Zebra and Quagga Mussel Distribution in North America - Direct Download

    U.S. Geological Survey, Department of the Interior — The concern caused by the explosive spread of the zebra mussel, (Dreissena polymorpha), within the United States resulted in passage of the Nonindigenous Aquatic...

  13. 77 FR 68163 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change To Amend the NYSE Arca Options Fee Schedule Relating to Pricing Applicable to Electronic Transactions in Non-Penny...

  14. 78 FR 10233 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Relating...


    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Relating to the Listing and Trading of the SPDR Blackstone/GSO Senior Loan ETF Under NYSE Arca Equities Rule 8.600 February 7, 2013. Pursuant to...

  15. 78 FR 19766 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...


    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change Relating to the Listing and Trading of the SPDR Blackstone/GSO Senior Loan ETF Under NYSE Arca Equities Rule 8.600 March 27, 2013. I....

  16. Prevention of zebra mussel infestation and dispersal during aquaculture operations

    Waller, D.L.; Fisher, S.W.; Dabrowska, H.


    The zebra mussel Dreissena polymorpha, an exotic invasive species, poses a major threat to North American fish management programs and the aquaculture industry. Fish hatcheries may become infected with zebra mussels from a variety of sources, including the water supply, fish shipments, boats, and equipment. The hatcheries could then serve as agents for the overland dispersal of zebra mussels into stocked waters and to other fish hatcheries. We evaluated the effectiveness and safety of aquaculture chemicals for use in controlling zebra mussels in fish hatcheries and preventing dispersal of veligers during fish transport. Chemicals were evaluated for use in fish transport and as disinfectants for ponds and equipment. Standardized static toxicity tests were conducted with representative species of warmwater, coolwater, and coldwater fishes and with larval (3-d-old veligers), early juvenile (settling larvae), and adult zebra mussels. Chemical concentrations and exposure durations were based on recommended treatment levels for fish, eggs, and ponds. Recommended treatment levels were also exceeded, if necessary, to establish lethal levels for zebra mussels of different developmental stages. Our results indicate that some chemicals currently in use in hatcheries may be effective for controlling zebra mussels in various operations. Chloride salts were the safest and most effective therapeutants tested for use in fish transport. The toxicity of chloride salts to fish varied among species and with temperature; only one treatment regime (sodium chloride at 10,000 mg/L) was safe to all fish species that we tested, but it was only effective on veliger and settler stages of the zebra mussel. Effective disinfectants were benzalkonium chloride for use on equipment and rotenone for use in ponds after fish are harvested. The regulatory status of the identified chemicals is discussed as well as several nonchemical control alternatives.

  17. Zebra battery technologies for all electric smart car

    O'Sullivan, T M; Bingham, Chris; Clark, R E


    This paper describes the operational behaviour and advantages of the high temperature, sodium nickel chloride (Zebra) battery, for use in all electric urban (city) vehicles. It is shown that an equivalent parallel electrical circuit can be employed to accurately simulate the electrochemical behaviour inherent in the most recent generation of Zebra cells. The experimental procedure is outlined and summary attributes of the investigation validated by both simulation studies, and experimentally,...

  18. A Minimally-Invasive Procedure for Sexing Young Zebra Finches

    Soderstrom, Ken; Qin, Weixi; Leggett, Matthew H.


    Zebra finches have been widely used to study neurobiology underlying vocal development. Because only male zebra finches learn song, efficient developmental use of these animals requires early determination of sex at ages that precede maturation of secondary sex characteristics. We have developed a sex determination method that combines a forensics method of genomic DNA isolation (from very small blood samples) with PCR amplification from Z and W sex chromosomes (males are ZZ, females ZW). Thi...


    Nádia Maria Lopes AMORIM


    Full Text Available Em países em desenvolvimento, como o Brasil, a maior parte da vitamina A da dieta é proveniente de carotenoides pró-vitamínicos A como Į-caroteno e, principalmente, ȕ-caroteno presentes em frutas e hortaliças. O conteúdo de carotenoides nas frutas pode ser afetado por diversos fatores, entre eles o local de comercialização. Assim, foram investigados a ocorrência e o conteúdo de Į- e ȕ-caroteno em cinco frutas (goiaba Paluma, kiwi, mamão Formosa, manga Haden e maracujá azedo comercializadas em três mercados e uma feira livre do município de Viçosa, Minas Gerais. Os carotenoides foram extraídos em acetona e analisados por cromatografia líquida de alta eficiência, utilizando detector de arranjo de diodos. O Į-caroteno não foi encontrado em nenhuma amostra. O ȕ-caroteno foi identificado e quantificado em todas as frutas. Os teores de ȕ-caroteno e os valores de vitamina A das frutas comercializadas na feira livre, exceto no mamão, foram estatisticamente superiores aos daquelas comercializadas nos mercados. O maior conteúdo de ȕ-caroteno foi observado no maracujá (1,97mg/100g, seguido da manga Haden (1,47mg/100g, goiaba Paluma (1,05mg/100g, mamão Formosa (0,38mg/100g e kiwi (0,20mg/100g. O maracujá, a manga Haden e a goiaba Paluma mostraram-se excelentes fontes de pró-vitamina A para crianças e boas fontes para homens adultos. O mamão Formosa mostrou-se fonte de vitamina A para crianças. O maracujá, a manga Haden, a goiaba Paluma e o mamão Formosa mostraram-se fontes de ȕ-caroteno e contribuíram de forma importante para o suprimento das recomendações de vitamina A para homens adultos e crianças.

  20. Zebra: An advanced PWR lattice code

    Cao, L.; Wu, H.; Zheng, Y. [School of Nuclear Science and Technology, Xi' an Jiaotong Univ., No. 28, Xianning West Road, Xi' an, ShannXi, 710049 (China)


    This paper presents an overview of an advanced PWR lattice code ZEBRA developed at NECP laboratory in Xi'an Jiaotong Univ.. The multi-group cross-section library is generated from the ENDF/B-VII library by NJOY and the 361-group SHEM structure is employed. The resonance calculation module is developed based on sub-group method. The transport solver is Auto-MOC code, which is a self-developed code based on the Method of Characteristic and the customization of AutoCAD software. The whole code is well organized in a modular software structure. Some numerical results during the validation of the code demonstrate that this code has a good precision and a high efficiency. (authors)

  1. Zebra: An advanced PWR lattice code

    This paper presents an overview of an advanced PWR lattice code ZEBRA developed at NECP laboratory in Xi'an Jiaotong Univ.. The multi-group cross-section library is generated from the ENDF/B-VII library by NJOY and the 361-group SHEM structure is employed. The resonance calculation module is developed based on sub-group method. The transport solver is Auto-MOC code, which is a self-developed code based on the Method of Characteristic and the customization of AutoCAD software. The whole code is well organized in a modular software structure. Some numerical results during the validation of the code demonstrate that this code has a good precision and a high efficiency. (authors)

  2. Doppler coefficient measurements in Zebra Core 5

    Measurements using a central hot loop in Zebra Core 5 are described. Results are given for the Doppler coefficients found in a number of assemblies with PuO2 and 16% PuO2/84% depleted UO2 pins, loaded with different combinations of steel, sodium or void pins. The mixed oxide results are in general about 20% more negative than was calculated using the FD2 data set, but agreement is good if the plutonium contributions in the calculations are omitted. The small positive Doppler coefficient calculated for Pu239 was not observed, and two measurements indicated instead a small negative effect. The Doppler effect in the mixed oxide systems was found to vary approximately as 1/T. The results from the empty loop and non-fissile assemblies indicate either a small negative Doppler effect in steel or alternatively the presence of an unexplained expansion effect. (author)

  3. The zebra finch neuropeptidome: prediction, detection and expression

    Annangudi Suresh P


    Full Text Available Abstract Background Among songbirds, the zebra finch (Taeniopygia guttata is an excellent model system for investigating the neural mechanisms underlying complex behaviours such as vocal communication, learning and social interactions. Neuropeptides and peptide hormones are cell-to-cell signalling molecules known to mediate similar behaviours in other animals. However, in the zebra finch, this information is limited. With the newly-released zebra finch genome as a foundation, we combined bioinformatics, mass-spectrometry (MS-enabled peptidomics and molecular techniques to identify the complete suite of neuropeptide prohormones and final peptide products and their distributions. Results Complementary bioinformatic resources were integrated to survey the zebra finch genome, identifying 70 putative prohormones. Ninety peptides derived from 24 predicted prohormones were characterized using several MS platforms; tandem MS confirmed a majority of the sequences. Most of the peptides described here were not known in the zebra finch or other avian species, although homologous prohormones exist in the chicken genome. Among the zebra finch peptides discovered were several unique vasoactive intestinal and adenylate cyclase activating polypeptide 1 peptides created by cleavage at sites previously unreported in mammalian prohormones. MS-based profiling of brain areas required for singing detected 13 peptides within one brain nucleus, HVC; in situ hybridization detected 13 of the 15 prohormone genes examined within at least one major song control nucleus. Expression mapping also identified prohormone messenger RNAs in areas associated with spatial learning and social behaviours. Based on the whole-genome analysis, 40 prohormone probes were found on a commonly used zebra finch brain microarray. Analysis of these newly annotated transcripts revealed that six prohormone probes showed altered expression after birds heard song playbacks in a paradigm of song

  4. Song Recognition in Zebra Finches: Are There Sensitive Periods for Song Memorization?

    Braaten, Richard F.


    Male zebra finches learn to sing songs that they hear between 25 and 65 days of age, the sensitive period for song learning. In this experiment, male and female zebra finches were exposed to zebra finch songs either before (n = 9) or during (n = 4) the sensitive period. Following song exposure, recognition memory for the songs was assessed with an…

  5. Zebra finch as a developmental model.

    Mak, Siu-Shan; Wrabel, Anna; Nagai, Hiroki; Ladher, Raj K; Sheng, Guojun


    The domesticated zebra finch (Taeniopygia guttata) is a well-established animal model for studying vocal learning. It is also a tractable model for developmental analyses. The finch genome has been sequenced and methods for its transgenesis have been reported. Hatching and sexual maturation in this species takes only two weeks and three months, respectively. Finch colonies can be established relatively easily and its eggs are laid at a stage earlier than in other common avian experimental models, facilitating the analysis of very early avian development. Representing the Neoaves to which 95% of all bird species belong, the finch can potentially complement two existing, Galloanserae developmental models, the chick, and quail. Here, we provide a step-by-step guide for how to set up a finch colony in a conventional laboratory environment. Technical tips are offered to optimize hens' productivity and ensure a constant supply of fertilized finch eggs. Methods of handling finch eggs and embryos for subsequent embryological, cellular, or molecular analyses are also discussed. We conclude by emphasizing scientific values and cost effectiveness of maintaining a finch colony for avian developmental studies. genesis 53:669-677, 2015. © 2015 Wiley Periodicals, Inc. PMID:26385755

  6. Mechanisms of copying behaviour in zebra finches.

    Guillette, Lauren M; Healy, Susan D


    When an individual is faced with choosing between unfamiliar food options, it may benefit initially by choosing the option chosen by other animals so avoiding potentially poisonous food. It is not clear which cues the naïve forager learns from the demonstrator for choosing between food options. To determine firstly which birds (zebra finches, Taeniopygia guttata) would copy a demonstrator's choice, in Experiment 1 we presented each observer with a demonstrator feeding from one of two differently coloured feeders and then tested the observer's feeder colour preference. Of the same-sex/mixed-sex demonstrator-observer pairs tested only females copied male demonstrators. In Experiment 2, birds did not prefer either feeder colour in the absence of demonstrators confirming the social learning effect observed in Experiment 1. In Experiment 3, copying females fed significantly more at the feeder of the demonstrated colour, rather than at the location of the demonstrated feeder. These data point not just to the identity of the individual to be copied but also to the kind of information learned. PMID:25444776

  7. Vocal tract articulation in zebra finches.

    Verena R Ohms

    Full Text Available BACKGROUND: Birdsong and human vocal communication are both complex behaviours which show striking similarities mainly thought to be present in the area of development and learning. Recent studies, however, suggest that there are also parallels in vocal production mechanisms. While it has been long thought that vocal tract filtering, as it occurs in human speech, only plays a minor role in birdsong there is an increasing number of studies indicating the presence of sound filtering mechanisms in bird vocalizations as well. METHODOLOGY/PRINCIPAL FINDINGS: Correlating high-speed X-ray cinematographic imaging of singing zebra finches (Taeniopygia guttata to song structures we identified beak gape and the expansion of the oropharyngeal-esophageal cavity (OEC as potential articulators. We subsequently manipulated both structures in an experiment in which we played sound through the vocal tract of dead birds. Comparing acoustic input with acoustic output showed that OEC expansion causes an energy shift towards lower frequencies and an amplitude increase whereas a wide beak gape emphasizes frequencies around 5 kilohertz and above. CONCLUSION: These findings confirm that birds can modulate their song by using vocal tract filtering and demonstrate how OEC and beak gape contribute to this modulation.

  8. KM3NeT-ARCA project status and plan

    Coniglione R.


    Full Text Available The KM3NeT Collaboration aims at building a research infrastructure in the depths of the Mediterranean Sea hosting a cubic kilometre neutrino telescope. The KM3NeT/ARCA detector is the ideal instrument to look for high-energy neutrino sources thanks to the latitude of the detector and to the optical characteristics of the sea water. The detector latitude allows for a wide coverage of the observable sky including the region of the Galactic centre and the optical sea water properties allow for the measure of the neutrino direction with excellent angular resolution also for cascade events. The technologically innovative components of the detector and the status of construction will be presented as well as the capability it offers to discover neutrinos.


    The experiments conducted this past quarter have suggested that the bacterium Pseudomonas fluorescens strain CL0145A is effective at killing zebra mussels throughout the entire range of pH values tested (7.2 to 8.6). Highest mortality was achieved at pH values characteristic of preferred zebra mussel waterbodies, i.e., hard waters with a range of 7.8 to 8.6. In all water types tested, however, ranging from very soft to very hard, considerable mussel kill was achieved (83 to 99% mean mortality), suggesting that regardless of the pH or hardness of the treated water, significant mussel kill can be achieved upon treatment with P. fluorescens strain CL0145A. These results further support the concept that this bacterium has significant potential for use as a zebra mussel control agent in power plant pipes receiving waters with a wide range of physical and chemical characteristics

  10. Halicephalobus gingivalis (Nematoda) infection in a Grevy's zebra (Equus grevyi).

    Isaza, R; Schiller, C A; Stover, J; Smith, P J; Greiner, E C


    A 6-yr-old female Grevy's zebra (Equus grevyi) with a disseminated rhabditiform nematode infection is described. Antemortem clinical signs were limited to blindness and abnormal behavior believed to be caused by a recurrent nematode-induced uveitis. Histologic examination of the kidneys, heart, eyes, uterus, and lymph nodes revealed granulomas containing multiple sections of rhabditiform nematodes. Most of the recovered nematodes were larval stages with only a few adult females noted. The adults measured 243-297 microm x 11-16 microm (x = 269 x 14 microm). The distinctive rhabditiform esophagi had corpus:isthmus:bulb proportions of 19:11:5. On the basis of adult morphology, the nematode was identified as Halicephalobus gingivalis. This is the first report of this parasite in a zebra and indicates that this parasitic granulomatous disease should be considered in zebras with neurologic disease. PMID:10884129

  11. 78 FR 48920 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... corporate governance and notice requirements. This current policy is appropriate in light of NYSE Arca... summarizing important Exchange corporate governance and notice requirements disseminated to all listed issuers... which have been altered by merger, acquisition, consolidation or other corporate action,...

  12. Heart synchronization for SPIM microscopy of living zebra fish

    Taylor, J. M.; Saunter, C. D.; Chaudhry, B.; Henderson, D. J.; Love, G. D.; Girkin, J. M.


    We describe work on producing a selective plane illumination microscope for cardiac imaging in zebra fish embryos. The system has a novel synchronization system for imaging oscillating structures (e.g. the heart) and will have adaptive optics for image optimization.

  13. Potato psyllid vector density and zebra chip disease

    Zebra chip disease (ZC), which is caused by ‘Candidatus Liberibacter solanacearum’ (Lso) and vectored by potato psyllids Bactericera cockerelli, is a continuing threat to the North American potato industry. Current management entails frequent insecticide sprays for the vectors as thresholds for spra...

  14. Complete genome sequence of a novel circovirus from zebra finch.

    Rinder, Monika; Schmitz, Anna; Peschel, Andrea; Korbel, Rüdiger


    A novel circovirus was identified in zebra finches (Taeniopygia guttata). The genome of the circovirus strain, designated 8454V25-1, comprised 1,982 nucleotides with two major open reading frames encoding a replication-associated protein and a viral capsid protein. PMID:26021933

  15. Endophytic bacteria in potato tubers affected by zebra chip disease

    Potato zebra chip disease (ZCD) could drastically reduce quality and value of all market classes of potato, costing growers and processors millions of dollars in losses in North America. Endophytic bacteria colonize the internal tissue and could have both positive and negative effects on host plants...

  16. Monitoramento da contaminação por elementos traço em ostras comercializadas em Recife, Pernambuco, Brasil

    André Dias Cavalcanti


    Full Text Available Amostras de ostras comercializadas em Recife, Pernambuco, Brasil, foram monitoradas em relação ao conteúdo de elementos traço (Hg, Zn, Fe, Cu e Mn durante o período de um ano (março/2001 a fevereiro/2002. Mercúrio foi o principal contaminante encontrado nas ostras e o elemento que apresenta maior risco à saúde pública. Foram encontrados valores de concentração de Hg em ostras de até 551,12µg/kg (peso úmido. Esses valores sugerem que a ingestão de ostras deve ser feita com restrições, principalmente, pela população que vive de sua coleta como forma de subsistência, por crianças, e mulheres grávidas. A avaliação dos níveis de mercúrio em frutos do mar é um importante fator para avaliar o risco de contaminação por mercúrio em pessoas não ocupacionalmente expostas.


    Mariza FARIA; Laila Brasil Domingues OLIVEIRA; Francisco Eduardo de Carvalho COSTA


    A demanda por açaí tem crescido gradativamente nos mercados nacional e internacional, devido seu caráter energético e nutritivo. No entanto, o fruto é extremamente manipulado durante toda cadeia de produção da polpa, o que propicia a presença de uma elevada carga microbiana, sendo este um dos fatores responsáveis pela sua deterioração. O objetivo deste trabalho foi avaliar a qualidade microbiológica de polpas de açaí congeladas comercializadas em 12 estabelecimentos, n...

  18. A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

    Qin Zheng


    Full Text Available A new antitumor and antioxidant peptide (H3 was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS. The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl-2,5-diphenyl-2H-tetrazolium bromide (MTT assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH and hydroxyl radicals were 56.8% and 47.5%, respectively.

  19. Predation on exotic zebra mussels by native fishes: Effects on predator and prey

    Magoulick, D.D.; Lewis, L.C.


    1. Exotic zebra mussels, Dreissena polymorpha, occur in southern U.S. waterways in high densities, but little is known about the interaction between native fish predators and zebra mussels. Previous studies have suggested that exotic zebra mussels are low profitability prey items and native vertebrate predators are unlikely to reduce zebra mussel densities. We tested these hypotheses by observing prey use of fishes, determining energy content of primary prey species of fishes, and conducting predator exclusion experiments in Lake Dardanelle, Arkansas. 2. Zebra mussels were the primary prey eaten by 52.9% of blue catfish, Ictalurus furcatus; 48.2% of freshwater drum, Aplodinotus grunniens; and 100% of adult redear sunfish, Lepomis microlophus. Blue catfish showed distinct seasonal prey shifts, feeding on zebra mussels in summer and shad, Dorosoma spp., during winter. Energy content (joules g-1) of blue catfish prey (threadfin shad, Dorosoma petenense; gizzard shad, D. cepedianum; zebra mussels; and asiatic clams, Corbicula fluminea) showed a significant species by season interaction, but shad were always significantly greater in energy content than bivalves examined as either ash-free dry mass or whole organism dry mass. Fish predators significantly reduced densities of large zebra mussels (>5 mm length) colonising clay tiles in the summers of 1997 and 1998, but predation effects on small zebra mussels (???5 mm length) were less clear. 3. Freshwater drum and redear sunfish process bivalve prey by crushing shells and obtain low amounts of higher-energy food (only the flesh), whereas blue catfish lack a shell-crushing apparatus and ingest large amounts of low-energy food per unit time (bivalves with their shells). Blue catfish appeared to select the abundant zebra mussel over the more energetically rich shad during summer, then shifted to shad during winter when shad experienced temperature-dependent stress and mortality. Native fish predators can suppress adult zebra

  20. Optimal Management of a Potential Invader: The Case of Zebra Mussels in Florida

    Lee, Donna J.; Damian C. Adams; Rossi, Frederick J.


    Dominant users of Lake Okeechobee water resources are agricultural producers and recreational anglers. These uses will be directly affected, should the lake become infested with zebra mussels. We employ a probabilistic bioeconomic simulation model to estimate the potential impact of zebra mussels on consumptive water uses, recreational angling, and wetland ecosystem services under alternative public management scenarios. Without public management, the expected net economic impact from zebra m...

  1. FindZebra: A search engine for rare diseases

    Dragusin, Radu; Petcu, Paula; Lioma, Christina Amalia;


    Background: The web has become a primary information resource about illnesses and treatments for both medical and non-medical users. Standard web search is by far the most common interface for such information. It is therefore of interest to find out how well web search engines work for diagnostic...... approach for web search engines for rare disease diagnosis which includes 56 real life diagnostic cases, state-of-the-art evaluation measures, and curated information resources. In addition, we introduce FindZebra, a specialized (vertical) rare disease search engine. FindZebra is powered by open source...... medical concepts to demonstrate different ways of displaying the retrieved results to medical experts. Conclusions: Our results indicate that a specialized search engine can improve the diagnostic quality without compromising the ease of use of the currently widely popular web search engines. The proposed...

  2. Factors limiting song acquisition in adult zebra finches.

    Funabiki, Yasuko; Funabiki, Kazuo


    Song learning takes place in two separate or partially overlapping periods, a sensory phase in which a tutor song is memorized and a sensorimotor phase in which a copy of the model is produced. The stage of song development where song becomes stable and stereotyped is called crystallization. Adult birds usually do not learn new song in many species including the zebra finch. However, it is not known whether song crystallization as such or aging impedes adult learning. Exposure to loud noises prevents birds from developing and crystallizing their song, because they cannot control their voice by auditory feedback. Zebra finches even without previous experience of hearing or singing a song failed to learn a song model provided in adulthood. Thus, neither the absence of a tutor song nor the lack of song crystallization enables new song learning in adulthood, but age per se limits the ability or motivation to learn song. PMID:19623623

  3. Drinking Songs: Alcohol Effects on Learned Song of Zebra Finches

    Olson, Christopher R.; Owen, Devin C.; Ryabinin, Andrey E.; MELLO, CLAUDIO V.


    Speech impairment is one of the most intriguing and least understood effects of alcohol on cognitive function, largely due to the lack of data on alcohol effects on vocalizations in the context of an appropriate experimental model organism. Zebra finches, a representative songbird and a premier model for understanding the neurobiology of vocal production and learning, learn song in a manner analogous to how humans learn speech. Here we show that when allowed access, finches readily drink alco...

  4. Mortality of zebra mussel, Dreissena polymorpha, veligers during downstream transport

    Horvath, T.G.; Lamberti, G.A.


    1. Streams flowing from lakes which contain zebra mussels, Dreissena polymorpha, provide apparently suitable habitats for mussel colonization and downstream range expansion, yet most such streams contain few adult mussels. We postulated that mussel veligers experience high mortality during dispersal via downstream transport. They tested this hypothesis in Christiana Creek, a lake-outlet stream in south-western Michigan, U.S.A., in which adult mussel density declined exponentially with distance downstream. 2. A staining technique using neutral red was developed and tested to distinguish quickly live and dead veligers. Live and dead veligers were distinguishable after an exposure of fresh samples to 13.3 mg L-1 of neutral red for 3 h. 3. Neutral red was used to determine the proportion of live veligers in samples taken longitudinally along Christiana Creek. The proportion of live veligers (mean ?? SE) declined from 90 ?? 3% at the lake outlet to 40 ?? 8% 18 km downstream. 4. Veligers appear to be highly susceptible to damage by physical forces (e.g. shear), and therefore, mortality in turbulent streams could be an important mechanism limiting zebra mussel dispersal to downstream reaches. Predictions of zebra mussel spread and population growth should consider lake-stream linkages and high mortality in running waters.

  5. The first complete mitochondrial genome of the Maylandia zebra.

    Xia, Yan; Dang, Xiao; Xu, Qiwu; Zhang, Dongya


    Maylandia zebra, a member of the family cichlid living in individual African lakes, are regarded as a significant evolution model. Recently the genome sequencing had been done, but there is no sufficient information about its mitochondria. Herein, we first assembled the complete mitochondrial genome sequence of Maylandia zebra. It is a 16 582 bp long sequence with most mitogenome's characteristic structure, 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 putative control region. The GC-content of our fresh sequence is 45.86%, similar to closely related species Oreochromis niloticus. The accuracy and utility of new determined mitogenome sequences can be verified by the phylogenetic analysis, based on whole mitogenome alignment with Neolamprologus brichardi, Pseudotropheus crabro, Oreochromis niloticu, which is closest relative to Maylandia zebra, and 6 others. Using the full mitogenome, we expect to address taxonomic issues and study the related evolution events. Moreover, this is the first report of the mitogenome of genus Maylandia. PMID:27158870

  6. DNA adduct measurements in zebra mussels, Dreissena polymorpha, Pallas

    The purpose of this study was to examine PAH accumulation and bulky DNA adduct formation in the digestive gland of zebra mussels exposed in their habitat or in controlled laboratory conditions to complex mixture of PAH. DNA adducts were measured using a 32P-postlabelling protocol with nuclease P1 enrichment adapted from Reddy and Randerath [Reddy, M.V., Randerath, K., 1986. Nuclease P1-mediated enhancement of sensitivity of 32P-postlabelling test for structurally diverse DNA adducts. Carcinogenesis 7, 1543-1551]. Specimens collected in the upper part of the Seine estuary were shown to accumulate higher levels of PAH (up to 1.6 μg g-1 dry weight) in comparison to individuals from the reference site (0.053 μg g-1 dry weight). The former exhibited elevated levels of DNA adducts (up to 4.0/108 nucleotides) and higher diversity of individual adducts with five distinct spots being specifically detected in individuals originating from the Seine estuary. Zebra mussels exposed for 5 days to 0.01% (v/v) of organic extract of sediment from the Seine estuary were shown to accumulate high amounts of PAH (up to 138 μg g-1 dry weight) but exhibited relatively low levels of DNA adducts. Exposure to benzo[a]pyrene led to a dose-dependent accumulation of B[a]P (up to 7063 μg g-1 dry weight) and a clear induction of DNA adduct formation in the digestive gland of mussels (up to 1.13/108 nucleotides). Comparisons with other bivalves exposed to the same model PAH, revealed similar levels of adducts and comparable adduct profiles with a main adduct spot and a second faint one. This study clearly demonstrated that zebra mussels are able to biotransform B[a]P and probably other PAH into reactive metabolites with DNA-binding activity. This work also demonstrated the applicability of the nuclease P1 enhanced 32P-postlabelling method for bulky adduct detection in the digestive gland of zebra mussels. DNA adduct measurement in zebra mussels could be a suitable biomarker to monitor PAH

  7. Modelling the effects of diving ducks on zebra mussels Dreissena polymorpha in lakes

    Nes, van E.H.; Noordhuis, R.; Lammens, E.H.R.R.; Portielje, R.; Reeze, B.; Peeters, E.T.H.M.


    An individual-based model describing the growth of zebra mussels (Dreissena polymorpha) is presented. The model is spatially explicit and predicts length¿frequency distributions of zebra mussels. The parameters and model inputs with the strongest effect on the model outcomes were identified using a

  8. Newspaper Coverage of Zebra Mussels in North America : A Case of "Afghanistanism"?

    Roush, Donny; Fortner, Rosanne


    Few environmental issues have arisen so abruptly, spread so rapidly, and been so clearly linked to human activity as has the introduction of nonindigenous zebra mussels to the surface freshwater of North America. This research examines communication patterns in information about zebra mussels as an example of how the mass media deal with threats to the environment.

  9. Are Horses Like Zebras, or Vice Versa? Children's Sensitivity to the Asymmetries of Directional Comparisons

    Chestnut, Eleanor K.; Markman, Ellen M.


    Adults exhibit strong preferences when framing symmetrical relations. Adults prefer, for example, "A zebra is like a horse" to "A horse is like a zebra," and "The bicycle is near the building" to "The building is near the bicycle." This is because directional syntax requires more typical or prominent items…

  10. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    Liyan Song; Tingfei Li; Rongmin Yu; Chunyan Yan; Yu Zhao; Shengfang Ren


    In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditionswere investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonaldesign was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle ofreducing power, such as scavenging activities against α,α-diphen...

  11. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    Song, Liyan; Li, Tingfei; Yu, Rongmin; Yan, Chunyan; Ren, Shengfang; Zhao, Yu


    In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditions were investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonal design was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle of reducing power, such as scavenging activities against α,α-diphenyl-...

  12. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    Song, Liyan; Li, Tingfei; Yu, Rongmin; Yan, Chunyan; Ren, Shengfang; ZHAO Yu


    In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditionswere investigated in the paper. Three proteases (neutrase, alcalase and papain) were applied to hydrolyze the homogenate of A. subcrenata. An orthogonaldesign was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle ofreducing power, such as scavenging activities against α,α-diphenyl-β-p...

  13. Bioaccumulation of 239+240Pu in benthic organisms crab (Scylla serrata) and arca (Anadara granosa) : a case study from Trombay

    The study presents the concentration of (239+240)Pu in various size groups of crab (SCYLLA SERRATA) and arca (ANADARA GRANOSA). Around 96 crabs and 650 arcas were harvested from the Mumbai Harbour Bay. Crabs and arcas were grouped in different size groups as per their widths. The maximum concentration 239+240Pu is observed in case of crab for the lowest size group whereas for arca the same is observed in the highest size group. This difference in the uptake of (239+240)Pu is attributed to the difference in metabolic functions of the two species. Bio-accumulation factor (Bp) values in case of crab flesh ranged between 70 to 1140 kg-1 with a GM value of 180 and in arca the value ranged between 6 to 60 l kg-1 with a GM of 20. The values for shell were higher by factors of 2 to 9 in case of crab and 3 to 22 in case of arca. The smallest size group of crab shows maximum Bp value whereas for arca maximum Bp is observed for maximum size group. (author)

  14. Scanning electron microscopy of Strongylus spp. in zebra.

    Els, H J; Malan, F S; Scialdo-Krecek, R C


    The external ultrastructure of the anterior and posterior extremities of the nematodes, Strongylus asini , Strongylus vulgaris, Strongylus equinus and Strongylus edentatus, was studied with scanning electron microscopy (SEM). Fresh specimens of S. asini were collected from the caecum, ventral colon and vena portae of Equus burchelli and Equus zebra hartmannae ; S. vulgaris from the caecum, colon and arteria ileocolica of E. burchelli ; S. equinus from the ventral colon of E. z. hartmannae and S. edentatus from the caecum and ventral colon of both zebras , during surveys of parasites in zebras in the Etosha Game Reserve, South West Africa/Namibia, and the Kruger National Park, Republic of South Africa. The worms were cleaned, fixed and mounted by standard methods and photographed in a JEOL JSM - 35C scanning electron microscope (SEM) operating at 12kV . The SEM showed the following differences: the tips of the external leaf-crowns varied and were fine and delicate in S. asini , coarse and broad in S. vulgaris and, in S. equinus and S. edentatus, closely adherent, separating into single elements for half their length. The excretory pores showed only slight variation, and the morphology of the copulatory bursae did not differ from those seen with light microscopy. The genital cones differed markedly: S. asini had a ventral triangular projection and laterally 2 finger-like projections: in S. vulgaris there were numerous bosses on the lateral and ventral aspects of the cone; in S. equinus 2 finger-like processes projected laterocaudally ; and in S. edentatus 2 pairs of papilla-like processes projected laterally on the ventral aspects, and a pair of rounded projections and a pair of hair-like structures adorned the dorsal aspects.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:6676687

  15. Digital gene expression analysis of the zebra finch genome

    Burke Terry


    Full Text Available Abstract Background In order to understand patterns of adaptation and molecular evolution it is important to quantify both variation in gene expression and nucleotide sequence divergence. Gene expression profiling in non-model organisms has recently been facilitated by the advent of massively parallel sequencing technology. Here we investigate tissue specific gene expression patterns in the zebra finch (Taeniopygia guttata with special emphasis on the genes of the major histocompatibility complex (MHC. Results Almost 2 million 454-sequencing reads from cDNA of six different tissues were assembled and analysed. A total of 11,793 zebra finch transcripts were represented in this EST data, indicating a transcriptome coverage of about 65%. There was a positive correlation between the tissue specificity of gene expression and non-synonymous to synonymous nucleotide substitution ratio of genes, suggesting that genes with a specialised function are evolving at a higher rate (or with less constraint than genes with a more general function. In line with this, there was also a negative correlation between overall expression levels and expression specificity of contigs. We found evidence for expression of 10 different genes related to the MHC. MHC genes showed relatively tissue specific expression levels and were in general primarily expressed in spleen. Several MHC genes, including MHC class I also showed expression in brain. Furthermore, for all genes with highest levels of expression in spleen there was an overrepresentation of several gene ontology terms related to immune function. Conclusions Our study highlights the usefulness of next-generation sequence data for quantifying gene expression in the genome as a whole as well as in specific candidate genes. Overall, the data show predicted patterns of gene expression profiles and molecular evolution in the zebra finch genome. Expression of MHC genes in particular, corresponds well with expression

  16. Is the body condition of the invasive zebra mussel (Dreissena polymorpha) enhanced through attachment to native freshwater mussels (Bivalvia, Unionidae)?

    Pilotto, Francesca; Sousa, Ronaldo; Aldridge, David C


    The invasion of zebra mussels, Dreissena polymorpha, into Western Europe and North America has driven widespread ecological change. Attachment of zebra mussels to the shell of native unionoid mussels has resulted in reductions in unionoid abundance and, in extreme cases, their localised extirpations. While the impacts of zebra mussels on infested unionoids are well documented, the possible benefits of the association to the zebra mussel have been little considered. We collected zebra mussels attached to unionoids and to inanimate structures. Zebra mussels attached to unionoids had significantly larger shells, higher standardized body mass and glycogen content than those attached to inanimate substrates, suggesting that D. polymorpha benefits from settling upon unionoids. The body condition of individual zebra mussels was negatively correlated with the number of zebra mussels attached to the unionoid, indicating intraspecific competition. Therefore, zebra mussels seem positively affected through attachment to unionoid mussels, but that these benefits decrease at higher densities of fouling. This association may offer advantages to the spread of zebra mussels within unionoid-rich systems, especially at sites with soft substrates and at the early stages of the invasion process where intraspecific competition is likely to be lower and benefits to the zebra mussels are higher. PMID:26925735

  17. Factors Affecting Zebra Mussel Kill by the Bacterium Pseudomonas fluorescens

    Daniel P. Molloy


    The specific purpose of this research project was to identify factors that affect zebra mussel kill by the bacterium Pseudomonas fluorescens. Test results obtained during this three-year project identified the following key variables as affecting mussel kill: treatment concentration, treatment duration, mussel siphoning activity, dissolved oxygen concentration, water temperature, and naturally suspended particle load. Using this latter information, the project culminated in a series of pipe tests which achieved high mussel kill inside power plants under once-through conditions using service water in artificial pipes.

  18. La calidad de varias bebidas alcohólicas comercializadas en México y las consecuencias potenciales en la salud pública

    Francisco López-Naranjo; Israel Hanani Godínez-García; Reyes Flores-Hernández; Marina Altagracia-Martínez; Rebeca Córdova-Moreno


    México es uno de los países de Latino América con un alto consumo de alcohol. Cuarenta y ocho bebidas alcohólicas (BA) comercializadas en México fueron analizadas por métodos establecidos físico-químicos para la determinación de etanol y metanol; la espectroscopia de absorción atómica se utilizó para detectar la presencia en cantidades trazas de Cu, Pb y Cd. Las muestras BA analizadas para la determinación de metanol y para la detección de la presencia de los metales pesados tóxicos (cobre, p...

  19. Avaliação da qualidade de folhas de boldo-do-chile (Peumus boldus Molina comercializadas em Curitiba, PR

    M.C.S. Barbosa


    Full Text Available Foi realizada a avaliação da qualidade de amostras de boldo-do-chile (Peumus boldus Molina comercializadas na Região Metropolitana de Curitiba. Os resultados mostraram que todas as amostras são autênticas, mas os resultados das análises físico-químicas mostraram-se discrepantes em relação aos parametros da Farmacopéia Brasileira e outras bibliografias de referência.Samples of boldo-do-chile (Peumus boldus Molina commercialized at the metropolitan area of Curitiba/PR were evaluated to establish their quality control patterns. The results showed that all samples are authentic but the data obtained for the physico-chemical parameters differ from those related at the Brazilian Pharmacopoeia IV ed.

  20. Avaliação da concentração de flúor em águas minerais comercializadas no Brasil

    Villena Rita S.; Borges Denise G.; Cury Jaime A.


    A utilização de flúor sistêmico deve ser controlada em termos de risco/benefício, pois enquanto a subdosagem não trouxer benefício anticárie, a sobredosagem estará associada com fluorose dental. Assim, uma das preocupações é o consumo de águas minerais, o qual tem aumentado nos últimos anos. Deste modo, foi realizado estudo com o objetivo de analisar a concentração de flúor em águas minerais comercializadas no Brasil. Foram analisadas 104 marcas comerciais, de diferentes regiões do País. Util...

  1. Food habits of diving ducks in the Great Lakes after the zebra mussel invasion

    Custer, Christine M.; Custer, T.W.


    Zebra mussels (Dreissena polymorpha) invaded the Great Lakes in the mid-1980s and quickly reached high densities. The objective of this study was to determine current consumption of zebra mussels by waterfowl in the Great Lakes region. Feeding Lesser Scaups (Aythya affinis), Greater Scaups (A. marila), Canvasbacks (A. valisineria), Redheads (A. americana), Buffleheads (Bucephala albeola) and Common Goldeneyes (B. clangula) were collected in western Lake Erie and in Lake St. Clair between fall and spring, 1992-1993 to determine food habits. All 10 Redheads, 97% of Lesser Scaups, 83% of Goldeneyes, 60% of Buffleheads and 9% of Canvasbacks contained one or more zebra mussels in their upper gastrointestinal tracts. The aggregate percent of zebra mussels in the diet of Lesser Scaups was higher in Lake Erie (98.6%) than in Lake St. Clair (54.4%). Zebra mussels (aggregate percent) dominated the diet of Common Goldeneyes (79.2%) but not in Buffleheads (23.5%), Redheads (21%) or Canvasbacks (9%). Lesser Scaups from Lake Erie fed on larger zebra mussels ( = 10.7 i?? 0.66 mm SE) than did Lesser Scaups from Lake St. Clair ( = 4.4 i?? 0.22 mm). Lesser Scaups, Buffleheads and Common Goldeneyes from Lake Erie consumed zebra mussels of similar size.

  2. Economic impacts of zebra mussels on drinking water treatment and electric power generation facilities.

    Connelly, Nancy A; O'Neill, Charles R; Knuth, Barbara A; Brown, Tommy L


    Invasions of nonnative species such as zebra mussels can have both ecological and economic consequences. The economic impacts of zebra mussels have not been examined in detail since the mid-1990s. The purpose of this study was to quantify the annual and cumulative economic impact of zebra mussels on surface water-dependent drinking water treatment and electric power generation facilities (where previous research indicated the greatest impacts). The study time frame was from the first full year after discovery in North America (Lake St. Clair, 1989) to the present (2004); the study area was throughout the mussels' North American range. A mail survey resulted in a response rate of 31% for electric power companies and 41% for drinking water treatment plants. Telephone interviews with a sample of nonrespondents assessed nonresponse bias; only one difference was found and adjusted for. Over one-third (37%) of surveyed facilities reported finding zebra mussels in the facility and almost half (45%) have initiated preventive measures to prevent zebra mussels from entering the facility operations. Almost all surveyed facilities (91%) with zebra mussels have used control or mitigation alternatives to remove or control zebra mussels. We estimated that 36% of surveyed facilities experienced an economic impact. Expanding the sample to the population of the study area, we estimated 267 million dollars (BCa 95% CI = 161 million dollars - 467 million dollars) in total economic costs for electric generation and water treatment facilities through late 2004, since 1989. Annual costs were greater (44,000 dollars/facility) during the early years of zebra mussel infestation than in recent years (30,000 dollars). As a result of this and other factors, early predictions of the ultimate costs of the zebra mussel invasion may have been excessive. PMID:17530329

  3. A retrospective study of disease and mortality in zebra finches.

    Prattis, S M; Cioffee, C J; Reinhard, G; Zaoutis, T E


    Few published reports exist describing morbidity and mortality in domestic zebra finch colonies maintained in a laboratory animal setting. A retrospective study of clinical disease and mortality in quarantined adult zebra finches was performed. Animals were observed during the 2 week quarantine period and for at least 1 month afterwards (42 days). Signs of disease, including feather and beak abnormalities, oculonasal discharge, increased respiratory rate or stridor, abdominal enlargement, pasty vent, diarrhea, lameness and pectoral muscle loss, were evaluated in our colony during this time. History, physical examination, laboratory testing and postmortem evaluation were used to determine causes of clinical disease. Common clinical findings in sick finches included sudden death, ruffled feathers, increased respiratory rate or gape mouthed breathing, pasty vent or frank diarrhea, and beak discoloration. Organisms frequently isolated were Staphylococcus spp., E. coli, Enterobacter spp., and Coccidia spp. Of the finches that died while in the colony (29.5%), 23.0% died in the first week after arrival. Pathogens frequently isolated from tissues cultured at necropsy included: E. coli, Staphylococcus aureus, Enterobacter spp., and Candida albicans. When observed, pathological lesions consisted of air sacculitis, fibrinopurulent polyserositis and ventriculitis. PMID:2166869

  4. Copper Wire Arrays at the 1 MA Zebra Facility

    Coverdale, C. A.; Jones, B.; Ampleford, D. J.; Deeney, C.; Lepell, P. D.; Safronova, A. S.; Kantsyrev, V. L.; Ouart, N.; Ivanov, V. V.


    Experiments to study the implosion dynamics and radiation characteristics of copper z-pinches have been fielded at the 1 MA Zebra facility. At Zebra, load diameters ranged from 8mm to 16mm, with 6 to 14 wires, and load masses of 80 to 200 μg. All arrays utilized 10 micron diameter wire. The impact of initial load mass and initial load diameter on the precursor and the stagnated plasma has been evaluated through spectroscopy, shadowgraphy, and fluence measurements. Plasma parameters have been extracted from modeling of the time-integrated L-shell spectra to study temperature and density variations as a function of spatial position and initial load configuration. Comparisons will be made with harder x-ray spectra and pinhole images to identify regions of highest temperature and density. Shadowgraphy has been fielded to study the formation of the precursor and the main implosion; significant structure is observed. Substantial radiation is observed from the precursor, with variations in the precursor associated with initial load configuration. *Sandia is a multi-program laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL85000.

  5. Co-existence of zebra mussels and freshwater unionids: Population dynamics of Leptodea fragilis in a coastal wetland infested with zebra mussels

    Nichols, S. Jerrine; Amberg, Jon


    In 1996, thousands of live Leptodea fragilis were collected from a marsh located in the western basin of Lake Erie that was infested with zebra mussels (Dreissena polymorpha). Despite the presence of zebra mussels at this site for a number of years, this L. fragilis population showed no signs of competition-induced changes in population dynamics. Biofouling was limited: fewer than 1% of the L. fragilis showed evidence of recent or past zebra mussel colonization. Successful recruitment occurred yearly, with multiple year classes collected that ranged in age from 1 to 12 years. However, age and shell length were not well correlated. Seventy-one percent of the individuals collected were 51-80 mm long, but ranged in age from 2 to 4.5 years. Three different patterns of growth or shell deposition were found. Some individuals grew rapidly, reaching 105 mm in 3.5 years, while others grew only 4.5 mm over the same time period. A few grew poorly during some years but very rapidly in others. Individuals with a shell length of 41 mm or more were sexually mature and females were more common than males. The strong recruitment and steady growth of this population showed no change between the years before and after the zebra mussel invasion, indicating that this marsh is functioning as a natural refugium from potential problems caused by zebra mussels.

  6. 77 FR 49032 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Changes...


    ... Securities Exchange Act Release No. 67244 (June 22, 2012), 77 FR 38701 (SR-NYSEArca-2012-67) (the ``Notice''). II. Background NYSE Arca Rule 3.2 sets forth a process for the nomination and selection of fair... Rule 3.2 sets forth a similar process for the nomination and selection of fair representation...

  7. 78 FR 21650 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...


    ... (February 20, 2013), 78 FR 13103 (``Notice''). \\4\\ In approving the proposed rule changes, the Commission... Commission, along with other corporate governance documents.\\8\\ \\7\\ See Section 3(a)(27) of the Act, 15 U.S.C... NYSE Arca Holdings Bylaws, along with other corporate documents, are rules of the Exchange \\7\\ and...

  8. 77 FR 38116 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Designation of a Longer Period for...


    ... Exchange Act Release No. 66966 (May 11, 2012), 77 FR 29419. \\4\\ See Letter from Gus Sauter, Managing... Commission Action on Proposed Rule Change Proposing a Pilot Program To Create a Lead Market Maker Issuer Incentive Program for Issuers of Certain Exchange-Traded Products Listed on NYSE Arca, Inc. June 20,...

  9. 77 FR 65752 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... permit the firm to have at least one trader on the Floor of the Exchange as a Floor-based open outcry... for firms to acquire additional Market Maker OTPs. The Exchange believes that the proposed OTP pricing... Proposed Rule Change Amending the NYSE Arca Options Fee Schedule To Change the Monthly Cost for...

  10. 78 FR 16731 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... execution. \\4\\ See Securities Exchange Act Release No. 65730 (November 10, 2011), 76 FR 71410 (November 17... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Reduce the Floor Broker Rebate for Qualified Contingent Cross Transactions March 8, 2013. Pursuant...

  11. 78 FR 4508 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Amendment No. 2, and Order...


    ... composed entirely of ``Independent Directors'' \\19\\ and have a written charter.\\20\\ \\19\\ ``Independent... listed company be required to have a compensation committee composed entirely of Independent Directors... continues to have a majority of independent directors, as NYSE Arca believes this would ensure that...

  12. 77 FR 9278 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    .... 66115 (January 6, 2012), 77 FR 1969 (January 12, 2012) (SR-NYSEArca-2011-101) (notice of filing and... month, the minimum adding ADV requirement for Investor Tier 1 would be 38.25 million adding shares a day... Proposed Rule Change Amending the NYSE Arca Equities Fee Schedule To Increase the Investor Tier 1...

  13. 77 FR 27106 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Holder of the equipment, installation, and maintenance provided by the Exchange, and (2) the cost to the.... III. Date of Effectiveness of the Proposed Rule Change and Timing for Commission Action The...

  14. 78 FR 11261 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... related to the value to the Exchange's market quality associated with higher volumes in Customer order... Proposed Rule Change To Amend the NYSE Arca Options Fee Schedule To Introduce a New Electronic Customer... Options Fee Schedule (the ``Fee Schedule'') to introduce a new electronic Customer rate for...

  15. 75 FR 65041 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... Instruct NYSE Arca To Bypass Non-Regulation NMS Protected Market Centers When Routing Away October 15, 2010...-Regulation NMS protected market centers when routing away. The text of the proposed rule change is available... are not posting Protected Quotations within the meaning of Regulation NMS. In March 2008, NYSE...

  16. 78 FR 72955 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change, as...


    ... capitalization companies,\\10\\ by investing in exchange-traded funds (``ETFs''),\\11\\ and/or swap agreements... Fund Shares (as described in NYSE Arca Equities Rule 8.600). The ETFs all will be listed and traded in the U.S. on registered exchanges. The ETFs in which the Fund may invest will primarily be...

  17. 78 FR 21452 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... and have market maker obligations which require them to pay for equipment and connectivity. Customers... Effectiveness of the Proposed Rule Change and Timing for Commission Action The foregoing rule change...

  18. 77 FR 63362 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... platforms may choose from a range of possible, and equally reasonable, pricing strategies as the means of... FR 52769 (Aug. 30, 2012) (SR-NYSEArca-2012-89). Access and Redistribution Fees The Exchange proposes.... 62188 (May 27, 2010), 75 FR 31484 (June 3, 2010) (SR-NYSEArca-2010-23). Because the Arca...

  19. 77 FR 36307 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Amending...


    ... Corporate Governance Code that would be added, given that Holdco was formed under and subject to the laws of...-72), 77 FR 3297. NYSE Arca explained the reasons for incorporating the Proposed Amendments in Holdco... corporate governance and regulatory obligations that are addressed by means of ownership and...

  20. 75 FR 20030 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Schedule is available on the Commission's Website at . A copy of this filing is... comments were solicited or received with respect to the proposed rule change. III. Date of Effectiveness...

  1. 75 FR 63233 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ... COMMISSION Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of... Effectiveness of the Proposed Rule Change and Timing for Commission Action The foregoing rule change is... for website viewing and printing in the Commission's Public Reference Room, 100 F Street,...

  2. 77 FR 19401 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Amending...


    ... Securities/the Exchange associated with the liquidation of the error positions. \\15\\ If Arca Securities... the liquidation of error positions, as well as records associated with the liquidation of error... perfect the mechanism of a free and open market and a national market system and, in general, to...

  3. 75 FR 25892 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...


    ..., 2009), 74 FR 46272 (September 8, 2009) (Order approving (i) the removal of NYSE Arca Equities Rule 7.26... derivative instruments. The purpose of this filing is to eliminate the requirement that Market Makers must... Proposed Rule Change Amending Market Maker Requirements for Certain Covered Products April 30,...

  4. 75 FR 26304 - Self-Regulatory Organizations; Notice of Filing of Proposed Rule Change by NYSE Arca, Inc...


    ... governance committee.\\6\\ \\3\\ See Securities Exchange Act Release No. 53382 (February 27, 2006), 71 FR 11251... Audit Committee, Compensation Committee, and Regulatory Oversight Committee May 4, 2010. Pursuant to... eliminate its audit committee (the ``NYSE Arca Audit Committee''), its compensation committee (the......

  5. 77 FR 25218 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change To List...


    ..., flywheel, or micro turbines; Energy efficiency such as energy efficient building materials, power, lighting... (``Environmental Themes''): Alternative renewable power such as solar, wind, geothermal, hydro, or biomass... Arca Equities Rule 8.600. See, e.g., Securities Exchange Act Release Nos. 57801 (May 8, 2008), 73...

  6. "Bird Song Metronomics": Isochronous Organization of Zebra Finch Song Rhythm.

    Norton, Philipp; Scharff, Constance


    The human capacity for speech and vocal music depends on vocal imitation. Songbirds, in contrast to non-human primates, share this vocal production learning with humans. The process through which birds and humans learn many of their vocalizations as well as the underlying neural system exhibit a number of striking parallels and have been widely researched. In contrast, rhythm, a key feature of language, and music, has received surprisingly little attention in songbirds. Investigating temporal periodicity in bird song has the potential to inform the relationship between neural mechanisms and behavioral output and can also provide insight into the biology and evolution of musicality. Here we present a method to analyze birdsong for an underlying rhythmic regularity. Using the intervals from one note onset to the next as input, we found for each bird an isochronous sequence of time stamps, a "signal-derived pulse," or pulse(S), of which a subset aligned with all note onsets of the bird's song. Fourier analysis corroborated these results. To determine whether this finding was just a byproduct of the duration of notes and intervals typical for zebra finches but not dependent on the individual duration of elements and the sequence in which they are sung, we compared natural songs to models of artificial songs. Note onsets of natural song deviated from the pulse(S) significantly less than those of artificial songs with randomized note and gap durations. Thus, male zebra finch song has the regularity required for a listener to extract a perceived pulse (pulse(P)), as yet untested. Strikingly, in our study, pulses(S) that best fit note onsets often also coincided with the transitions between sub-note elements within complex notes, corresponding to neuromuscular gestures. Gesture durations often equaled one or more pulse(S) periods. This suggests that gesture duration constitutes the basic element of the temporal hierarchy of zebra finch song rhythm, an interesting parallel

  7. Effects of inbreeding on sperm quality in Zebra Finches Taeniopygia guttata

    Opatová, Pavlína; Ihle, M.; Albrechtová, Jana; Tomášek, Oldřich; Kempenaers, B.; Forstmeier, W.; Albrecht, Tomáš

    Badajoz: European Ornithologist's Union, 2015 - (Martin, G.; Marzal, A.). s. 017 [Conference of the European Ornithologist's Union /10./. 24.08.2015-28.08.2015, Badajoz] Institutional support: RVO:68081766 Keywords : zebra finches * sperm Subject RIV: EG - Zoology

  8. Genomic and neural analysis of the estradiol-synthetic pathway in the zebra finch

    London Sarah E; Clayton David F


    Abstract Background Steroids are small molecule hormones derived from cholesterol. Steroids affect many tissues, including the brain. In the zebra finch, estrogenic steroids are particularly interesting because they masculinize the neural circuit that controls singing and their synthesis in the brain is modulated by experience. Here, we analyzed the zebra finch genome assembly to assess the content, conservation, and organization of genes that code for components of the estrogen-synthetic pat...


    Peharda, Melita; Stagličić, Nika; Ezgeta, Daria; VRGOČ, Nedo; Isajlović, Igor; Krstulović–Šifner, Svjetlana


    Kunjka (Arca noae) jestivi je školjkaš koji se komercijalno sakuplja u istočnom dijelu Jadrana, primarno metodom autonomnog ronjenja. Nema pouzdanih statističkih podataka o sakupljanju ove vrste kao ni podataka o raspodjeli i sastavu populacija iskorištavanih »stokova«, što je nužno za uspostavu održive razine eksploatacije. Cilj je ovog istraživanja bio određivanje raspodjele i sastava populacije vrste A. noae u jednom od područja sakupljanja — Pašmanskom kanalu. Istraživanje je provedeno u ...

  10. Removal of algae by the zebra mussel (Dreissena polymorpha) population in western Lake Erie: a bioenergetics approach

    Madenjian, Charles P.


    A bioenergetics model for growth of a zebra mussel (Dreissena polymorpha) individual was verified with observations on zebra mussel growth in western Lake Erie. The bioenergetics model was then applied to the zebra mussel population in the western basin of Lake Erie to estimate the removal of phytoplankton by mussels. According to the modeling results, the zebra mussel population consumed 5.0 million tonnes of phytoplankton, while 1.4 million tonnes of phytoplankton was deposited in pseudofeces from the mussels. Thus, a total of 6.4 ± 2.4 million tonnes of phytoplankton was removed from the water column by zebra mussel in western Lake Erie during 1990. Primary production was estimated to be 24.8 million tonnes; therefore, zebra mussel removed the equivalent of 26 ± 10% of the primary production for western Lake Erie.

  11. Floristic analysis of the Mountain Zebra National Park, Eastern Cape

    U. Pond


    Full Text Available As part of a larger project to assess the vegetation dynamics and conservation potential of the enlarged Mountain Zebra National Park, a checklist was produced to determine the plant species richness for this area. Six hundred and eighty species, represented by 333 genera and 87 families were identified. One hundred and eighty species belong to the Monocotyledoneae and 479 species to the Dicotyledoneae. By far the largest families are the Asteraceae with 129 and the Poaceae with 82 species. Thirteen Red Data species were recorded. A number of fynbos elements were encountered, the most noteworthy being two families endemic to the Cape Floristic Region, the Penaeaceae and Grubbiaceae. A very high species to square kilometre ratio of 5.05 supports the area’s rich floristic composition.

  12. Ultrastructural and Histochemical Characterization of the Zebra Mussel Adhesive Apparatus

    Farsad, Nikrooz

    Since their accidental introduction into the Great Lakes in mid- to late-1980s, the freshwater zebra mussels, Dreissena polymorpha, have colonized most lakes and waterways across eastern North America. Their rapid spread is partly attributed to their ability to tenaciously attach to hard substrates via an adhesive apparatus called the byssus, resulting in serious environmental and economic impacts. A detailed ultrastructural study of the byssus revealed a 10 nm adhesive layer at the attachment interface. Distributions of the main adhesive amino acid, 3,4-dihydroxyphenylalanine (DOPA), and its oxidizing (cross-linking) enzyme, catechol oxidase, were determined histochemically. It was found that, upon aging, DOPA levels remained high in the portion of the byssus closest to the interface, consistent with an adhesive role. In contrast, reduced levels of DOPA corresponded well with high levels of catechol oxidase in the load-bearing component of the byssus, presumably forming cross-links and increasing the cohesive strength.

  13. Improving production of Zebra Fish Embryos in the lab

    Thomsen, Jens Peter; Adu, Robert Ohene


    The utilization of fish embryos in toxicity testing of hazardous chemicals has recently been adopted in order to satisfy stricter rules and regulations related to using adult animals in toxicity testing. This paper presents optimising steps towards improving zebra fish embryo production in the...... within an hour of onset of light, an improvement over the 50-60 eggs produced in the previous work. This result demonstrates that with the right culture conditions and proper optimisation of procedure the required number of embryos needed for toxicity testing can be obtained....... laboratory. Culture conditions were maintained in the aquaria as stipulated in the OECD draft proposal for a new guideline on fish embryo tests. Furthermore, a sequence of steps were adopted and followed to improve upon previous work done in the lab in 2006. About 200 eggs were produced in one spawn trap...

  14. Effect of acute stresses on zebra fish (Danio rerio) metabolome measured by NMR-based metabolomics.

    Mushtaq, Mian Yahya; Marçal, Rosilene Moretti; Champagne, Danielle L; van der Kooy, Frank; Verpoorte, Robert; Choi, Young Hae


    We applied an acute stress model to zebra fish in order to measure the changes in the metabolome due to biological stress. This was done by submitting the fish to fifteen minutes of acute confinement (netting) stress, and then five minutes for the open field and light/dark field tests. A polar extract of the zebra fish was then subjected to (1)H nuclear magnetic spectroscopy. Multivariate data analysis of the spectra showed a clear separation associated to a wide range of metabolites between zebra fish that were submitted to open field and light/dark field tests. Alanine, taurine, adenosine, creatine, lactate, and histidine were high in zebra fish to which the light/dark field test was applied, regardless of stress, while acetate and isoleucine/lipids appeared to be higher in zebra fish exposed to the open field test. These results show that any change in the environment, even for a small period of time, has a noticeable physiological impact. This research provides an insight of how different mechanisms are activated under different environments to maintain the homeostasis of the body. It should also contribute to establish zebra fish as a model for metabolomics studies. PMID:25098933

  15. Efficacy of Pseudomonas fluorescens (Pf-CL145A) spray dried powder for controlling zebra mussels adhering to test substrates

    Luoma, James A.; Severson, Todd J.; Weber, Kerry L.; Mayer, Denise A.


    A mobile bioassay trailer was used to assess the efficacy of Pseudomonas fluorescens (Pf-CL145A) spray dried powder (SDP) formulation for controlling zebra mussels (Dreissena polymorpha) from two midwestern lakes: Lake Carlos (Alexandria, Minnesota) and Shawano Lake (Shawano, Wisconsin). The effects of SDP exposure concentration and exposure duration on zebra mussel survival were evaluated along with the evaluation of a benthic injection application technique to reduce the amount of SDP required to induce zebra mortality.

  16. High variation and very low differentiation in wide ranging plains zebra (Equus quagga): insights from mtDNA and microsatellites

    Lorenzen, Eline D; Arctander, Peter; Siegismund, Hans R


    Patterns of genetic differentiation in the plains zebra (Equus quagga) were analysed using mitochondrial DNA control region variation and seven microsatellites. The six morphologically defined subspecies of plains zebra lacked the population genetic structure indicative of distinct evolutionary u...

  17. How well can fishes prey on zebra mussels in eastern North America?

    French, John R. P., III


    Literature on mollusk-eating fishes was reviewed to determine the potential for different species of fish to control zebra mussels in eastern North America. At least six species are potential predators of zebra mussels because they possess (1) both upper and lower pharyngeal teeth or (2) lower pharyngeal teeth and chewing pads located on the dorsal roof for crushing mollusk shells. Freshwater drum (Aplodinotus grunniens) and two centrarchids, redear sunfish (Lepomis microlophus) and pumpkinseed (L. gibbosus), possess both upper and lower pharyngeal teeth and are likely to consume more zebra mussels than fishes with only lower pharyngeal teeth. Only two catostomid species, copper and river redhorses (Moxostoma hubbsi and M. carinatum), have chewing pads that enable them to crush mollusks. The exotic omnivorous common carp (Cyprinus carpio), possessing lower teeth and a chewing pad, may prey on zebra mussels when aquatic insect larvae, its preferred food, become rare. Managing populations of drum, sunfishes and redhorses to reduce exploitation of large individuals and improve their habitats are suggested as means to intensify biological control of zebra mussels in eastern North America. Other Eurasian molluscivores, the roach (Rutilus rutilus) and the black carp (Mylopharyngodon piceus) should not be introduced into North America because research has shown repeatedly that an introduced biological controller usually does not forage for unwanted pests or reside only in preferred habitats of pests. Drum, sunfishes and redhorses should be preferred over these exotics as biological controllers of zebra mussels in North America because these native fishes will likely occupy newly established habitats of zebra mussels.

  18. The use of chlorine dioxide for zebra mussel control - A perspective of treatment histories

    Smolik, N.; Rusznak, L.; Anderson, J.; Hale, L. [Ashland Chemical Coman, Drew Division, Booton, NJ (United States)


    It is of utmost importance to provide updated performance results of various chemical treatments presently being utilized for zebra mussel control. Zebra mussels have a distinctive ability to endure environmental changes by reproducing effectively and attaching to various hard surfaces. These traits are cause for concern and have resulted in some operating difficulties for industries bordering infested waterways. Various methods are being employed by industries to deal with the problems associated with these species. One of the options is control via chemical treatment. Prior field test studies showed that chlorine dioxide was determined to be an effective molluscicidal agent for adult zebra mussel eradication. Continuous feed of chlorine dioxide at treatment levels ranging from 0.25 - 5.0 ppm above the oxidant demand provided 100% adult zebra mussel mortality which required between 2.9 - 8.8 days of treatment. Previous studies also showed that water temperature was an essential parameter in determining the time required to achieve 100% mortality of adult zebra mussels. Further field applications were undertaken at three electric utility sites located in the midwest. These facilities were concerned with the potential for zebra mussels to reduce efficiency and availability by blocking water flow or plugging equipment. Treatment applications at these facilities consisted of a continuous feed of chlorine dioxide ranging from 0.15 - 0.5 ppm above the oxidant demand. Significant mortality was achieved in monitored mussels tested at each utility in a period ranging from two to four days. This time period was directly related to a number of parameters, with the predominant one being water temperature. Data from these field applications is presented in this paper and confirms that chlorine dioxide is an effective molluscicide for adult zebra mussel control.

  19. Neuroendocrine regulation of long-term pair maintenance in the monogamous zebra finch.

    Prior, Nora H; Soma, Kiran K


    This article is part of a Special Issue "SBN 2014". Understanding affiliative behavior is critical to understanding social organisms. While affiliative behaviors are present across a wide range of taxa and contexts, much of what is known about the neuroendocrine regulation of affiliation comes from studies of pair-bond formation in prairie voles. This leaves at least three gaps in our current knowledge. First, little is known about long-term pair-bond maintenance. Second, few studies have examined non-mammalian systems, even though monogamy is much more common in birds than in mammals. Third, the influence of breeding condition on affiliation is largely unknown. The zebra finch (Taeniopygia guttata) is an excellent model system for examining the neuroendocrine regulation of affiliative behaviors, including the formation and maintenance of a long-term pair bond. Zebra finches form genetically monogamous pair bonds, which they actively maintain throughout the year. The genomic and neuroanatomical resources, combined with the wealth of knowledge on the ecology and ethology of wild zebra finches, give this model system unique advantages to study the neuroendocrine regulation of pair bonding. Here, we review the endocrinology of opportunistic breeding in zebra finches, the sex steroid profiles of breeding and non-breeding zebra finches (domesticated and wild), and the roles of sex steroids and other signaling molecules in pair-maintenance behaviors in the zebra finch and other monogamous species. Studies of zebra finches and other songbirds will be useful for broadly understanding the neuroendocrine regulation of affiliative behaviors, including pair bonding and monogamy. PMID:25935729

  20. Estudo da contaminação por enteroparasitas em hortaliças comercializadas nos supermercados da cidade do Rio de Janeiro

    Joaquim Pereira da Silva


    Full Text Available Através de métodos parasitológicos usuais avaliou-se a contaminação por cistos e ovos de enteroparasitas de 220 amostras de hortaliças que são consumidas cruas e comercializadas nas zonas norte (de menor poder aquisitivo e sul (de maior poder aquisitivo da Cidade do Rio de Janeiro. Apesar de não ter havido aparente diferença na procedência das hortaliças avaliadas, constatou-se maior grau de contaminação nas amostras procedentes da zotza norte e nas amostras de alface (Lactuca sativa. Discutiu-se a possibilidade de a diferença observada estar relacionada ao acondicionamento das hortaliças ou ser devido à manipulação das mesmas por vendedores e consumidores.Parasitological examinations were performed in material derived from 220 vegetables to detect cysts and eggs of intestinal parasites. This material was collected from supermarkets in northern and southern areas and from CEASA (Central Supply Market - 40 vegetables in Rio de Janeiro city. Vegetables proceeding from the northern areas presented a greater degree of contamination mostly of helminth eggs; lettuce was the most contaminated vegetable. The authors suggest that differences found between the northern and southern areas of the city may be due to either packing or manipulation by shop assistants and consumers.

  1. Qualidade microbiológica de salada de frutas comercializadas por ambulantes na cidade de Juazeiro do Norte – Ceará

    Jôcy Emanuela Ferreira dos Santos


    Full Text Available O presente trabalho avaliou a qualidade microbiológica de salada de frutas comercializadas por ambulantes na cidade de Juazeiro do Norte - Ceará. Foram coletadas seis amostras de salada de frutas, sendo duas em cada ponto de coleta. As amostras foram coletadas pela manhã no centro da cidade, as amostras foram mantidas em recipientes isotérmicos e levadas para o Laboratório de Microbiologia de Alimentos da FATEC – Cariri. Realizaram-se análises de coliformes a 45°C e Salmonella spp, segundo as Normas da APHA 2001. Os resultados foram interpretados de acordo com a RDC N°12, de janeiro de 2001 da ANVISA. Para coliformes a 45°C foram encontrados resultados iguais a 2,4x102 NMP/g; 1,5x102 NMP/g; 4,6x102 NMP/g; ≥2,4x102 NMP/g; 4,6x102 NMP/g e ≥2,4x102, para as amostras A1, A2, B1, B2, C1 e C2 respectivamente. Estes resultados revelam que 33,33% das amostras, encontra-se em desacordo com o padrão federal vigente que permite 5x102 NMP/g. Para Salmonella spp., os resultados encontrados foram de ausência em todas as amostras.

  2. Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie

    This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day-1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m-2·day-1) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)

  3. Bioaccumulation of human waterborne protozoa by zebra mussel (Dreissena polymorpha): interest for water biomonitoring.

    Palos Ladeiro, M; Aubert, D; Villena, I; Geffard, A; Bigot, A


    Cryptosporidium parvum, Giardia duodenalis and Toxoplasma gondii are ubiquitous pathogens, which waterborne transmission has been largely demonstrated. Since they can be found in various watercourses, interactions with aquatic organisms are possible. Protozoan detection for watercourses biomonitoring is currently based on large water filtration. The zebra mussel, Dreissena polymorpha, is a choice biological model in ecotoxicological studies which are already in use to detect chemical contaminations in watercourses. In the present study, the zebra mussel was tested as a new tool for detecting water contamination by protozoa. In vivo exposures were conducted in laboratory experiments. Zebra mussel was exposed to various protozoan concentrations for one week. Detection of protozoa was realized by Taqman real time qPCR. Our experiments evidenced C. parvum, G. duodenalis and T. gondii oocyst bioaccumulation by mussels proportionally to ambient contamination, and significant T. gondii prevalence was observed in muscle tissue. To our knowledge, this is the first study that demonstrates T. gondii oocyst accumulation by zebra mussel. The results from this study highlight the capacity of zebra mussels to reveal ambient biological contamination, and thus to be used as a new effective tool in sanitary biomonitoring of water bodies. PMID:24112626


    Daniel P. Molloy


    These experiments indicated that bacterial strain CL0145A of Pseudomonas fluorescens is equally lethal to the 2 zebra mussel species present in North America, Dreissena polymorpha and Dreissena bugensis. Thus, this bacterial strain should be equally effective at killing zebra mussels in power plant pipes, irrespective of which species is present.

  5. Modeling the Role of Zebra Mussels in the Proliferation of Blue-green Algae in Saginaw Bay, Lake Huron

    Under model assumptions from Saginaw Bay 1991, selective rejection of blue-green algae by zebra mussels appears to be a necessary factor in the enhancement of blue-green algae production in the presence of zebra mussels. Enhancement also appears to depend on the increased sedime...


    These experiments indicated that bacterial strain CL0145A of Pseudomonas fluorescens is equally lethal to the 2 zebra mussel species present in North America, Dreissena polymorpha and Dreissena bugensis. Thus, this bacterial strain should be equally effective at killing zebra mussels in power plant pipes, irrespective of which species is present

  7. Caracterização socio-econômico-cultural de raizeiros e procedimentos pós-colheita de plantas medicinais comercializadas em Maceió, AL Cultural, economic and social characterization of herb sellers and post-harvest procedures of medicinal plants commercialized in Maceió, Alagoas State, Brazil

    De Araújo, A. C.; J P Silva; J.L.X.L. Cunha; J.L.O. Araújo


    Objetivou-se, com este trabalho, estabelecer o perfil sócio-econômico-cultural de raizeiros, bem como executar um levantamento dos procedimentos pós-colheita para as plantas medicinais comercializadas em feiras e mercados ao ar livre na cidade de Maceió, AL. Foram abordados aspectos sociais, econômicos e culturais de 46 raizeiros, bem como os procedimentos pós-colheita adotados para a conservação das plantas medicinais comercializadas no município. Os raizeiros entrevistados eram, na maioria,...

  8. Rotationally driven 'zebra stripes' in Earth's inner radiation belt.

    Ukhorskiy, A Y; Sitnov, M I; Mitchell, D G; Takahashi, K; Lanzerotti, L J; Mauk, B H


    Structured features on top of nominally smooth distributions of radiation-belt particles at Earth have been previously associated with particle acceleration and transport mechanisms powered exclusively by enhanced solar-wind activity. Although planetary rotation is considered to be important for particle acceleration at Jupiter and Saturn, the electric field produced in the inner magnetosphere by Earth's rotation can change the velocity of trapped particles by only about 1-2 kilometres per second, so rotation has been thought inconsequential for radiation-belt electrons with velocities of about 100,000 kilometres per second. Here we report that the distributions of energetic electrons across the entire spatial extent of Earth's inner radiation belt are organized in regular, highly structured and unexpected 'zebra stripes', even when the solar-wind activity is low. Modelling reveals that the patterns are produced by Earth's rotation. Radiation-belt electrons are trapped in Earth's dipole-like magnetic field, where they undergo slow longitudinal drift motion around the planet because of the gradient and curvature of the magnetic field. Earth's rotation induces global diurnal variations of magnetic and electric fields that resonantly interact with electrons whose drift period is close to 24 hours, modifying electron fluxes over a broad energy range into regular patterns composed of multiple stripes extending over the entire span of the inner radiation belt. PMID:24646996

  9. Prevention and control of zebra mussels: proactive and reactive strategies

    Most plant people would agree that having zebra mussels in any raw water system is not desirable. System blockage, loss of heat transfer and other associated safety hazards are not pleasant to deal with. Therefore most industries strive to minimise the effect of infestation. Opinions differ as to how to do this most efficiently and economically. Some facilities are committed to preventing the settlement of veligers in their piping systems and on some of the external structures they consider critical. This is the proactive approach. Others allow settlement and only treat the system or surface after fouling has occurred. This is the reactive approach. Which is the best and most economical treatment will depend on the individual facility and sometimes on the individual system. The paper examines the different proactive and reactive strategies available to-date and how they are being used. It will also discuss some of the criteria for choosing a proactive vs. reactive approach and why the decision has to be made individually by each facility. (author)

  10. Drinking songs: alcohol effects on learned song of zebra finches.

    Christopher R Olson

    Full Text Available Speech impairment is one of the most intriguing and least understood effects of alcohol on cognitive function, largely due to the lack of data on alcohol effects on vocalizations in the context of an appropriate experimental model organism. Zebra finches, a representative songbird and a premier model for understanding the neurobiology of vocal production and learning, learn song in a manner analogous to how humans learn speech. Here we show that when allowed access, finches readily drink alcohol, increase their blood ethanol concentrations (BEC significantly, and sing a song with altered acoustic structure. The most pronounced effects were decreased amplitude and increased entropy, the latter likely reflecting a disruption in the birds' ability to maintain the spectral structure of song under alcohol. Furthermore, specific syllables, which have distinct acoustic structures, were differentially influenced by alcohol, likely reflecting a diversity in the neural mechanisms required for their production. Remarkably, these effects on vocalizations occurred without overt effects on general behavioral measures, and importantly, they occurred within a range of BEC that can be considered risky for humans. Our results suggest that the variable effects of alcohol on finch song reflect differential alcohol sensitivity of the brain circuitry elements that control different aspects of song production. They also point to finches as an informative model for understanding how alcohol affects the neuronal circuits that control the production of learned motor behaviors.

  11. Zebra mussels mitigation at Ontario Hydro's hydroelectric generating facilities

    The Great Lakes and their connecting channels have recently been invaded by a tiny freshwater mollusc that has already cost Ontario Hydro millions of dollars. Dreissena polymorpha, commonly known as the zebra mussel, entered the great lakes in ballast water carried by a ship from Europe in 1985. These mussels threaten to reduce or totally block the flow of water in auxiliary systems of any generating station, water treatment plant or municipal water facility that uses raw lake water and to cause accelerated corrosion of the metallic substrate to which they attach themselves. To satisfy the immediate need for control, chlorination was identified as the most effective interim measure to prevent the biofouling of the raw water systems. Detection and monitoring of mussels and the installation, operation, environmental constraints, benefits and deficiencies of the chemical treatment system are presented. Long term objectives for control of the mussels are to develop alternatives to chlorination (ozone, hydrogen peroxide, protective coatings, thermal shock, mechanical filtration, etc.) for application at existing facilities and for incorporation into the design of new facilities and rehabilitation programs. 3 refs., 5 figs

  12. Food preference and copying behaviour in zebra finches, Taeniopygia guttata.

    Guillette, Lauren M; Morgan, Kate V; Hall, Zachary J; Bailey, Ida E; Healy, Susan D


    As a social species zebra finches might be expected to copy the food choices of more experienced conspecifics. This prediction has been tested previously by presenting observers with two demonstrator birds that differ in some way (e.g., sex, familiarity), each feeding on a different colour food source. However, if the observer subsequently exhibits a preference, it is unclear whether it has copied the choice of one demonstrator or avoided the choice of the other. Furthermore, this choice may actually be influenced by pre-existing preferences, a potential bias that is rarely tested. Here we examine whether apparent copying or avoidance can be explained by pre-existing preferences. In Experiment 1, observers had the opportunity to watch a conspecific forage from one of the two differently coloured food hoppers. In Experiment 2, the observers did not have this opportunity. In both experiments observers were subsequently tested for their food hopper preference and all but one preferred one colour over the other. In Experiment 1 some observers showed evidence for copying, while others seemed to avoid the colour preferred by the demonstrator. In Experiment 2 females generally preferred the white hopper. Pre-existing colour preferences could, therefore, explain the apparent copying/avoidance we observed. This article is part of a Special Issue entitled: Cognition in the wild. PMID:24797456

  13. Association of Bactericera cockerelli (Homoptera: Psyllidae) with "zebra chip," a new potato disease in southwestern United States and Mexico.

    Munyaneza, J E; Crosslin, J M; Upton, J E


    A new defect of potato, Solanum tuberosum L., "zebra chip," so named for the characteristic symptoms that develop in fried chips from infected potato tubers, has recently been documented in several southwestern states of the United States, in Mexico, and in Central America. This defect is causing millions of dollars in losses to both potato producers and processors. Zebra chip plant symptoms resemble those caused by potato purple top and psyllid yellows diseases. Experiments were conducted to elucidate the association between the psyllid Bactericera cockerelli (Sulc) (Homoptera: Psyllidae) and zebra chip by exposing clean potato plants to this insect under greenhouse and field conditions. Potato plants and tubers exhibiting zebra chip symptoms were tested for phytoplasmas by polymerase chain reaction. Potato psyllids collected from infected potato fields also were tested. Results indicated that there was an association between the potato psyllid and zebra chip. Plants exposed to psyllids in the greenhouse and field developed zebra chip. In the greenhouse, 25.8 and 59.2% of tubers exhibited zebra chip symptoms in the raw tubers and fried chips, respectively. In the field, 15 and 57% of tubers showed symptoms in raw tubers and chips, respectively. No zebra chip was observed in tubers from plants that had not been exposed to psyllids, either in the greenhouse or field. No phytoplasmas were detected from potato plants or tubers with zebra chip symptoms, suggesting that these pathogens are not involved in zebra chip. Of the 47 samples of potato psyllids tested, only two tested positive for the Columbia Basin potato purple top phytoplasma. PMID:17598522




    Full Text Available The aim of this paper is to emphasize the main aspects of the ways in which lightinfluences the development of zebra fish (Danio rerio embryos.During the experiments 3 variants with natural light, continuous light and totally darkwere used to monitor the development of zebra fish embryos in 40 ml Nunk culturedishes at optimum density (1 embryo/ 3 ml and at 28,5oC temperature.It could be noticed that most embryos died in continuous light medium (57%. Thismeans that such mediums are not suitable to embryos’ development. For the controlvariant (natural light it was recorded the lowest mortality rate of only 17% and intotally dark variant the mortality was of 40%.Researches on the influence of light on zebra fish embryo development showed that themost suited medium for supporting, growing and developing the Danio rerio embryosit the medium having natural light.

  15. Lessons learned in over 100 zebra mussel control applications at industrial facilities

    McGough, C.M.; Gilland, P.H.; Muia, R.A. [Calgon Corp., Pittsburgh, PA (United States)


    Since their introduction into US waterways, Zebra Mussels (Dreissena polymorphae) have spread rapidly throughout the Great Lakes and Mississippi regions. These mussels have continued to colonize the intake pipes of industrial water supplies and water distribution systems throughout the affected areas. Their colonization has compromised plant safety and production efficiency, and steadily increased costs to water users. The design of each industrial plant water distribution system is unique. A comprehensive zebra mussel control strategy using the best available options must be considered in each specific situation. This paper discusses the successful use of one strategy (a quaternary ammonia-based molluscicide) in the battle against zebra mussels. The commercial life cycle of an industrial molluscicide began with initial toxicity screening in the laboratory. The evaluation continued at plant sites through field trials and applications. Lessons learned from these experiences helped direct the efforts toward the development of a second generation program.

  16. Scope of problem assessed at IVO. The zebra mussel`s campaign of world conquest

    Silvonen, J.; Oesch, P. [ed.


    The migrating shell - or `zebra mussel` as it is called on account of its black and white stripes - was originally a fresh-water mussel, but has since also adapted to brackish waters. As a result of human activity the species has spread quickly and widely from its native habitat. Operators of power plants and water treatment plants in particular have not been very happy about this. During its larval stage the zebra mussel can enter the cooling water systems; fasten itself to the pipes and - in the worst case - clog the system. The Environmental Protection Division of IVO has been assessing the spread of the zebra mussel and the resulting problems with the aid of reference literature and the assistance of Finnish researchers

  17. The perception of regularity in an isochronous stimulus in zebra finches (Taeniopygia guttata) and humans.

    van der Aa, Jeroen; Honing, Henkjan; ten Cate, Carel


    Perceiving temporal regularity in an auditory stimulus is considered one of the basic features of musicality. Here we examine whether zebra finches can detect regularity in an isochronous stimulus. Using a go/no go paradigm we show that zebra finches are able to distinguish between an isochronous and an irregular stimulus. However, when the tempo of the isochronous stimulus is changed, it is no longer treated as similar to the training stimulus. Training with three isochronous and three irregular stimuli did not result in improvement of the generalization. In contrast, humans, exposed to the same stimuli, readily generalized across tempo changes. Our results suggest that zebra finches distinguish the different stimuli by learning specific local temporal features of each individual stimulus rather than attending to the global structure of the stimuli, i.e., to the temporal regularity. PMID:25725348

  18. Home range sizes for burchell's zebra equus burchelli antiquorum from the Kruger National Park

    G.L. Smuts


    Full Text Available Annual home range sizes were determined for 49 marked zebra family groups in the Kruger National Park. Sizes varied from 49 to 566 sq. km, the mean for the Park being 164 square kilometre. Mean home range sizes for different zebra sub-populations and biotic areas were found to differ considerably. Present herbivore densities have not influenced intra- and inter-specific tolerance levels to the extent that home range sizes have increased. Local habitat conditions, and particularly seasonal vegetational changes, were found to have the most profound influence on the shape and mean size of home ranges. The large home range sizes obtained in the Kruger Park, when compared to an area such as the Ngorongoro Crater, can be ascribed to a lower carrying capacity with respect to zebra, large portions of the habitat being sub-optimal, either seasonally or annually.

  19. Predicted sensitivity of the KM3NeT/ARCA detector to a diffuse flux of cosmic neutrinos

    Coniglione R.


    Full Text Available The KM3NeT Collaboration has started the construction of a research infrastructure hosting a network of underwater neutrino detectors in the Mediterranean Sea. Two instruments based on the same technology are being built: KM3NeT/ORCA to measure the neutrino mass hierarchy and to study atmospheric neutrino oscillations and KM3NeT/ARCA to detect high-energy cosmic neutrinos both in diffuse and point source mode. The excellent angular resolution of the ARCA detector, with an instrumented volume of about one Gton, will allow for an unprecedented exploration of the neutrino sky searching for neutrinos coming from defined sources of sky regions, like the Galactic Plane and the Fermi Bubbles. It will also look for diffuse high energy neutrino fluxes following the indication provided by the IceCube signal. This contribution will report on the sensitivity of the KM3NeT/ARCA telescope with particular attention to the region of the Galactic Plane. Comparisons with theoretical expectations are also discussed.

  20. Freqüência de enteroparasitas em amostras de alface (Lactuca sativa) comercializadas em Lavras, Minas Gerais Frequency of intestinal parasites in samples of lettuce (Lactuca sativa) commercialized in Lavras, Minas Gerais State

    Antônio Marcos Guimarães; Endrigo Gabellini Leonel Alves; Henrique César Pereira Figueiredo; Geraldo Márcio da Costa; Luciano dos Santos Rodrigues


    O objetivo deste trabalho foi realizar uma avaliação parasitológica em amostras de alface (Lactuca sativa) comercializadas em Lavras, MG. As amostras de alfaces apresentaram baixos padrões higiênicos, indicados pela presença de formas parasitológicas de origem animal ou humana e alta concentração de coliformes fecais.The aim of this study was to evaluate the parasitological contamination in samples of lettuce (Lactuca sativa) commercialized in Lavras city, Minas Gerais. The samples of lettuce...

  1. Ocorrência e diferenciação de espécies de Listeria spp. em salsichas tipo hot dog a granel e em amostras de carne moída bovina comercializadas no Distrito Federal

    Rafael Rocha de Andrade; Patrícia Helena Caldeira da Silva; Nara Rúbia Souza; Luci Sayori Murata; Vitor Salvador Picão Gonçalves; Angela Patrícia Santana


    Listeria monocytogenes é um patógeno relevante veiculado por alimentos. Sua identificação precisa é importante para a correta determinação do risco associado à ingestão do alimento. O objetivo deste trabalho foi verificar a ocorrência das espécies de Listeria spp. em amostras de salsichas tipo hot dog e carne moída bovina, comercializadas a granel no Distrito Federal. Foram analisadas 162 amostras, sendo 127 de salsichas tipo hot dog e 35 amostras de carne moída bovina. O isolamento e a ident...


    Saidelles, Ana Paula Fleig; Rosane Maria KIRCHNER; Érico Marlon de Moraes FLORES; Nara Rejane Zamberlan dos SANTOS; Joana Kirchner BENEDETTI; Litiele Cezar da CRUZ


    Muito tempo antes de ser conhecida a composição da Ilex paraguariensis (erva-mate), os indígenas utilizavam a mesma não somente pelo seu paladar, mas principalmente por conhecerem seus benefícios. Neste trabalho foi feita a determinação e avaliação dos valores de concentração de metais na primeira e segunda infusão em erva-mate comercializadas e industrializadas nos estados da região sul do Brasil. Para as infusões das amostras foi utilizada água destilada deionizada a...

  3. Formation of zebra pattern in low-frequency Jovian radio emission

    Kuznetsov, A A


    We investigate the formation of zebra-like fine spectral structures (consisting of several parallel bands in the dynamic spectrum) in the Jovian broadband kilometric radiation; such radio bursts were observed by Cassini in 2000/2001. We assume that the emission is generated due to a plasma mechanism in the Io plasma torus. We have shown that the double plasma resonance effect (that was proposed earlier as a formation mechanism of the solar zebra patterns) is able to produce the observed spectral structures. The observed frequency drifts are caused, most likely, by the dynamics of the electron acceleration site. The required conditions in the emission source are discussed.

  4. Proper care, husbandry, and breeding guidelines for the zebra finch, Taeniopygia guttata.

    Olson, Christopher R; Wirthlin, Morgan; Lovell, Peter V; Mello, Claudio V


    The zebra finch Taeniopygia guttata castanotis is a songbird commonly used in the laboratory, particularly for studies of vocal learning, neurobiology, and physiology. Within the laboratory, it is important to adopt careful husbandry practices that allow for normal development of the birds. For example, their song is a learned trait, passed culturally from adult males to juveniles, and thus its learning can be influenced by the health and social conditions of the birds present in the laboratory. Here we present guidelines for the successful maintenance and breeding of captive zebra finches. PMID:25342067

  5. Developmental stress increases reproductive success in male zebra finches.

    Crino, Ondi L; Prather, Colin T; Driscoll, Stephanie C; Good, Jeffrey M; Breuner, Creagh W


    There is increasing evidence that exposure to stress during development can have sustained effects on animal phenotype and performance across life-history stages. For example, developmental stress has been shown to decrease the quality of sexually selected traits (e.g. bird song), and therefore is thought to decrease reproductive success. However, animals exposed to developmental stress may compensate for poor quality sexually selected traits by pursuing alternative reproductive tactics. Here, we examine the effects of developmental stress on adult male reproductive investment and success in the zebra finch (Taeniopygia guttata). We tested the hypothesis that males exposed to developmental stress sire fewer offspring through extra-pair copulations (EPCs), but invest more in parental care. To test this hypothesis, we fed nestlings corticosterone (CORT; the dominant avian stress hormone) during the nestling period and measured their adult reproductive success using common garden breeding experiments. We found that nestlings reared by CORT-fed fathers received more parental care compared with nestlings reared by control fathers. Consequently, males fed CORT during development reared nestlings in better condition compared with control males. Contrary to the prediction that developmental stress decreases male reproductive success, we found that CORT-fed males also sired more offspring and were less likely to rear non-genetic offspring compared with control males, and thus had greater overall reproductive success. These data are the first to demonstrate that developmental stress can have a positive effect on fitness via changes in reproductive success and provide support for an adaptive role of developmental stress in shaping animal phenotype. PMID:25297860

  6. The ZEBRA electric vehicle battery: power and energy improvements

    Galloway, Roy C.; Haslam, Steven

    Vehicle trials with the first sodium/nickel chloride ZEBRA batteries indicated that the pulse power capability of the battery needed to be improved towards the end of the discharge. A research programme led to several design changes to improve the cell which, in combination, have improved the power of the battery to greater than 150 W kg -1 at 80% depth of discharge. Bench and vehicle tests have established the stability of the high power battery over several years of cycling. The gravimetric energy density of the first generation of cells was less than 100 Wh kg -1. Optimisation of the design has led to a cell with a specific energy of 120 Wh kg -1 or 86 Wh kg -1 for a 30 kWh battery. Recently, the cell chemistry has been altered to improve the useful capacity. The cell is assembled in the over-discharged state and during the first charge the following reactions occur: at 1.6 V: Al+4NaCl=NaAlCl 4+3Na; at 2.35 V: Fe+2NaCl=FeCl 2+2Na; at 2.58 V: Ni+2NaCl=NiCl 2+2 Na. The first reaction serves to prime the negative sodium electrode but occurs at too low a voltage to be of use in providing useful capacity. By minimising the aluminium content more NaCl is released for the main reactions to improve the capacity of the cell. This, and further composition optimisation, have resulted in cells with specific energies in excess of 140 Wh kg -1, which equates to battery energies>100 Wh kg -1. The present production battery, as installed in a Mercedes Benz A class electric vehicle, gives a driving range of 205 km (128 miles) in city and hill climbing. The cells with improved capacity will extend the practical driving range to beyond 240 km (150 miles).

  7. Avaliação da concentração de flúor em águas minerais comercializadas no Brasil

    Rita S. Villena


    Full Text Available A utilização de flúor sistêmico deve ser controlada em termos de risco/benefício, pois enquanto a subdosagem não trouxer benefício anticárie, a sobredosagem estará associada com fluorose dental. Assim, uma das preocupações é o consumo de águas minerais, o qual tem aumentado nos últimos anos. Deste modo, foi realizado estudo com o objetivo de analisar a concentração de flúor em águas minerais comercializadas no Brasil. Foram analisadas 104 marcas comerciais, de diferentes regiões do País. Utilizou-se eletrodo específico Orion 96-09 e analisador de íons Orion EA 940, previamente calibrados com soluções padrões de flúor. Foram observadas concentrações de flúor variando de 0,0 a 4,4 ppm. Constataram-se: 1 Concentrações significativas de flúor não relatadas pelo produtor; 2 Concentrações de flúor sem significado preventivo anti-cárie, embora o produtor destaque na embalagem "Água Mineral Fluoretada"; 3 Concentrações de flúor capazes de provocar fluorose dental severa, embora o produtor não faça nenhuma referência que o mesmo existe. Conclui-se ser necessário um Sistema de Vigilância Sanitária para o controle de flúor nas águas minerais oferecidas à população brasileira, quer seja em termos de benefício como de risco.

  8. Avaliação farmacognostica e da rotulagem das drogas vegetais boldo-do-chile (Peumus boldus Molina e camomila (Matricaria recutita L. comercializadas em Fortaleza, CE



    Full Text Available RESUMO Boldo-do-chile (Peumus boldus e camomila (Matricaria recutita são plantas empregadas na fitoterapia principalmente para o tratamento de desordens hepáticas e intestinais, atuando também como anti-inflamatório e antiespasmódico, respectivamente. Por isso, o presente trabalho objetivou avaliar a qualidade farmacognostica dessas drogas vegetais comercializadas em Fortaleza (CE, além das informações de suas rotulagens. Quarenta e duas amostras de boldo, e quarenta e cinco amostras de camomila, procedentes de farmácias, de lojas de produtos naturais e de bancas de raizeiros, foram analisadas quanto à autenticidade, à pureza e às informações contidas na rotulagem desses produtos conforme legislação vigente. Na verificação de impurezas, 35,7% das amostras de boldo e 57,7% das amostras de camomila excederam o teor máximo de matéria estranha; no teor de cinzas totais, 33,3% das amostras de boldo foram reprovadas; rotulagens das amostras de boldo (100% e de camomila (96,6% apresentaram erros ou ausência de informações. Os resultados das análises confirmam, portanto, a necessidade urgente de melhor fiscalização e intervenção na produção e venda dessas e de outras drogas vegetais para adequação às normas vigentes.

  9. Review of techniques to prevent introduction of zebra mussels (Dreissena polymorpha) during native mussel (Unionoidea) conservation activities

    Cope, W.G.; Newton, T.J.; Gatenby, C.M.


    Because of the declines in diversity and abundance of native freshwater mussels (superfamily Unionoidea), and the potential decimation of populations of native mussels resulting from the rapid spread of the exotic zebra mussel Dreissena polymorpha, management options to eliminate or reduce the threat of the zebra mussel are needed. Relocating native mussels to refugia (artificial and natural) has been proposed to mitigate the threat of zebra mussels to native species. Relocation of native mussels to refugia such as fish hatchery facilities or natural habitats within their historic range. Which are unlikely to be infested by zebra mussels, necessitates that protocols be developed to prevent the inadvertent introduction of zebra mussels. Several recent studies have developed Such protocols, and have assessed their effectiveness on the health and survival of native mussels during subsequent relocation to various refugia. The purpose of this project is to synthesize and evaluate the current protocols and to develop a set of procedures that resource managers and researchers should consider before conducting conservation activities in zebra mussel infested waters. We found that the existing protocols have many common points of concern, such as facility modification and suitability, zebra mussel risk assessment and management procedures, and health and disease management procedures. These conservation protocols may have broad applicability to other situations and locations. A summary and evaluation of the information in these main areas, along with recommended guidelines, are presented in this article.

  10. A dominance shift from the zebra mussel to the invasive quagga mussel may alter the trophic transfer of metals

    Bioinvasions are a major cause of biodiversity and ecosystem changes. The rapid range expansion of the invasive quagga mussel (Dreissena rostriformis bugensis) causing a dominance shift from zebra mussels (Dreissena polymorpha) to quagga mussels, may alter the risk of secondary poisoning to predators. Mussel samples were collected from various water bodies in the Netherlands, divided into size classes, and analysed for metal concentrations. Concentrations of nickel and copper in quagga mussels were significantly lower than in zebra mussels overall. In lakes, quagga mussels contained significantly higher concentrations of aluminium, iron and lead yet significantly lower concentrations of zinc66, cadmium111, copper, nickel, cobalt and molybdenum than zebra mussels. In the river water type quagga mussel soft tissues contained significantly lower concentrations of zinc66. Our results suggest that a dominance shift from zebra to quagga mussels may reduce metal exposure of predator species. - Highlights: • Invading quagga mussels often displace existing zebra mussels. • Interspecies difference in metal concentration may alter exposure of predators. • Zebra and quagga mussel soft tissue were analysed for metal concentrations. • Generally, quagga mussels contained lower concentrations of metals. • A dominance shift to quagga mussels may reduce metal exposure of predators. - A shift in dominance from zebra mussels to invading quagga mussels may reduce the transfer of metals to predator species

  11. Ocorrência de Salmonella e coliformes de origem fecal na canela em pó (Cinnamomum cassia Blume a Cinnamomum zeylanicum Nees) comercializada em Florianópolis, Santa Catarina, Brasil Salmonella and fecal coliforms in cinnamon (Cinnamomum cassia Blume and Cinnamomum zeylanicum Nees) sold in the city of Florianópolis, Santa Catarina, Brazil

    Jane Maria de S. Philippi; Eliane Moretto


    Cem amostras de canela em pó de dez marcas diferentes comercializadas na cidade de Florianópolis, SC, foram submetidas à análise microbiológica, pesquisando-se Salmonella e coliformes de origem fecal. Em nenhuma amostra foi detectada Salmonella. Coliformes de origem fecal foram encontrados entre os valores

  12. Removal of enteric viruses and Escherichia coli from municipal treated effluent by zebra mussels.

    Mezzanotte, Valeria; Marazzi, Francesca; Bissa, Massimiliano; Pacchioni, Sole; Binelli, Andrea; Parolini, Marco; Magni, Stefano; Ruggeri, Franco M; De Giuli Morghen, Carlo; Zanotto, Carlo; Radaelli, Antonia


    Dreissena polymorpha is a widespread filter-feeder species, resistant to a broad range of environmental conditions and different types of pollutants,which has recently colonized Italian freshwaters. Although widely used to monitor pollution in freshwater environments, this species is also an important food source for some fish and water birds. It can also be used to concentrate or remove particulate organic matter to interrupt avian-to-human transmission of pollutants and control health risks for animals and humans. In this study, the accumulation/inactivation in D. polymorpha of human health-related spiked enteric viruses was described. The removal of endogenous Escherichia coli, the classical indicator of fecal contamination,was tested as well.Our preliminary lab-scale results demonstrate that zebra mussels can reduce significantly poliovirus titer after 24 h and rotavirus titer after 8 h. E. coli counts were also reduced in the presence of zebra mussels by about 1.5 log after 4 h and nearly completely after 24 h. The fate of the two enteric viruses after concentration by zebra mussels was also investigated after mechanical disruption of the tissues. To our knowledge, the accumulation from water and inactivation of human health-related enteric viruses by zebra mussels has never been reported. PMID:26372942


    In August, 1995 six rusty crayfish colonized with zebra mussels were captured in small-meshed fyke-nets sets set apart as of a fish sampling effort at Peter's Marsh and Long-Tail Point Wetland in lower Green Bay. Mussels colonized virtually all areas of the crayfish bodies, but ...

  14. Evaluation of several chemical disinfectants for removing zebra mussels from unionid mussels

    Waller, D.L.; Fisher, S.W.


    We evaluated the safety and effectiveness of chemical treatments for killing veliger and juvenile stages of the zebra mussel Dreissena polymorpha attached to unionid mussels. Static toxicity tests were conducted on eight unionid mussel species with common aquaculture chemicals (benzalkonium chloride, formalin, hydrogen peroxide, calcium chloride, potassium chloride, and sodium chloride). The concentration and duration of each chemical treatment tested had previously been found to kill zebra mussel veligers and juveniles. Several species (e.g., Elliptio dilatata, Lampsilis cardium, and Lasmigona complanata) incurred less than 10% mortality in chloride salt treatments, while in other species (e.g., Obliquaria reflexa and Leptodea fragilis) mortality varied greatly among treatment regimes. Treatments with benzalkonium chloride, formalin, and hydrogen peroxide were less than 90% effective on juvenile stages of zebra mussels and, therefore, were ruled out after preliminary trials. Limited application of specific chemical treatments may be feasible for more tolerant species; however, effective disinfection of unionid shells will require the use of chemical treatment followed by a quarantine period to completely remove zebra mussel larvae and juveniles.

  15. Wild at heart? : differential maternal investment in wild and domesticated zebra finches (Taeniopygia guttata)

    Pariser, Emma C


    Over the past twenty years there has been an exponential increase in the investigation of maternal effects. Understanding the adaptive function of maternal allocation strategies is integral to interpreting the evolutionary outcomes of sexual selection. Thus, model animal systems that facilitate experimental manipulation and controlled investigation of the physiological and behavioural mechanisms underlying maternal effects are important to evolutionary biologists. The zebra finch (Taeniopygia...

  16. Regulatory Differences in Natal Down Development between Altricial Zebra Finch and Precocial Chicken.

    Chen, Chih-Kuan; Ng, Chen Siang; Wu, Siao-Man; Chen, Jiun-Jie; Cheng, Po-Liang; Wu, Ping; Lu, Mei-Yeh Jade; Chen, Di-Rong; Chuong, Cheng-Ming; Cheng, Hsu-Chen; Ting, Chau-Ti; Li, Wen-Hsiung


    Birds can be classified into altricial and precocial. The hatchlings of altricial birds are almost naked, whereas those of precocial birds are covered with natal down. This regulatory divergence is thought to reflect environmental adaptation, but the molecular basis of the divergence is unclear. To address this issue, we chose the altricial zebra finch and the precocial chicken as the model animals. We noted that zebra finch hatchlings show natal down growth suppressed anterior dorsal (AD) skin but partially down-covered posterior dorsal (PD) skin. Comparing the transcriptomes of AD and PD skins, we found that the feather growth promoter SHH (sonic hedgehog) was expressed higher in PD skin than in AD skin. Moreover, the data suggested that the FGF (fibroblast growth factor)/Mitogen-activated protein kinase (MAPK) signaling pathway is involved in natal down growth suppression and that FGF16 is a candidate upstream signaling suppressor. Ectopic expression of FGF16 on chicken leg skin showed downregulation of SHH, upregulation of the feather growth suppressor FGF10, and suppression of feather bud elongation, similar to the phenotype found in zebra finch embryonic AD skin. Therefore, we propose that FGF16-related signals suppress natal down elongation and cause the naked AD skin in zebra finch. Our study provides insights into the regulatory divergence in natal down formation between precocial and altricial birds. PMID:27189543

  17. Potato psyllids and their bacterial allies: Two fronts in the war against zebra chip disease.

    Potato psyllid is a major pest of potato in the western United States that transmits the pathogen that causes zebra chip disease. Potato psyllids, like all psyllids, have close associations with bacterial endosymbionts living within them. These endosymbionts may be obligate or facultative, and the...

  18. Study of bioengineered zebra fish olfactory receptor 131-2: receptor purification and secondary structure analysis.

    Kwong-Joo Leck

    Full Text Available How fishes are able to detect trace molecules in large bodies of water is not understood. It is plausible that they use olfactory receptors to detect water-soluble compounds. How the zebra fish Danio Rerio, an organism with only 98 functional olfactory receptors, is able to selectively detect and recognize numerous compounds in water remains a puzzling phenomenon. We are interested in studying the biochemical and molecular mechanisms of olfaction in fish. Here, we report on the study of a bioengineered zebra fish olfactory receptor OR131-2, affinity-purified from a HEK293S tetracycline-inducible system. This receptor was expressed and translocated to the cell plasma membrane as revealed by confocal microscopy. Circular dichroism spectroscopy showed that the purified zebra fish receptor folded into an α-helical structure, as observed for other G-protein coupled receptors (GPCRs. Our study shows that it is possible to produce viable quantities of the zebra fish olfactory receptor. This will not only enable detailed structural and functional analyses, but also aid in the design of biosensor devices in order to detect water-soluble metabolites or its intermediates, which are associated with human health.

  19. Potato tuber chemistry of promising germplasm exhibiting tolerance to zebra chip disease

    Long-term sustainable management of zebra chip (ZC) disease of potato requires development of tolerant or resistant germplasm. To this end, 283 potato varieties and breeding clones were infected with the ZC putative causal agent ‘Candidatus Liberibacter solanacearum’ (Lso) by potato psyllid vector i...

  20. Variations in Zebra Chip disease expression and tuber biochemistry in response to vector density

    This study examined effects of the number of ‘Candidatus Liberibacter solanacearum’ (Lso)-positive psyllids feeding on potatoes to Lso titers, zebra chip disease (ZC) symptom severity, and levels of amino acids, carbohydrates, and phenolics in tubers harvested weeks later. Red La Soda and Russet Nor...

  1. Bindweed Psyllid: Biology, Natural History, and Interactions with the Zebra Chip Pathogen

    Bactericera maculipennis is a native psyllid that commonly occurs on field bindweed in the western United States. We have found that Pacific Northwest populations of B. maculipennis carry Liberibacter solanacearum, the pathogen associated with zebra chip disease of potato. In North America, this p...

  2. Zebra - sõbralik ja lillelõhnaline / Ell-Maaja Randküla

    Randküla, Ell-Maaja, 1939-2016


    Tallinnas Narva mnt. 7 asuva kohviku Zebra sisekujundus. Sisearhitekt Tiiu Truus. Ehitus: AS KMG Ehitus. Materjalidest on kasutatud triibulise mustriga puitu Zebrano ja looduskivi. Laes on dekoratiivsed lipud, mille graafiline kujundus on Tiiu Priskolt ja Mati Veermetsalt. Tualettruumi looduskivist valamu ja põrandavaasi autor on Kaido Kivi. Ill.: põhiplaan, 11 värv. vaadet

  3. Infestation of research zebra finch colony with 2 novel mite species.

    Siddalls, Monica; Currier, Timothy A; Pang, Jassia; Lertpiriyapong, Kvin; Patterson, Mary M


    A zebra finch (Taeniopygia guttata) housed in a neuroscience laboratory was observed to have numerous feather mites. Subsequently, similar mites were found on other birds in the animal facility and research space. The most abundant mite was a novel, undescribed species in the genus Neocheyletiella. Whereas known Neocheyletiella mites have previously been characterized as skin parasites of various birds worldwide, the species on the zebra finches is unique because it lives and builds nests in the feathers. Infrequent specimens of a 'true' feather mite, a new species of Megninialges, were present also. Although multiple treatments using a pyrethrin spray were effective in eradicating the mites, topical ivermectin later was found to be more efficacious, better tolerated by the birds, and less labor intensive. This case highlights the general dearth of information regarding ectoparasites in zebra finches, even though these are the most frequently used songbirds in biomedical research. The mite epizootic also underscores the diverse pathogens possible in zebra finches that arrive from outside sources and why ongoing health monitoring of finch colonies is warranted. PMID:25730757

  4. Effects of oxidative stress and carotenoid intake on sperm/nmorphology and function in zebra finches

    Tomášek, Oldřich; Albrechtová, Jana; Opatová, Pavlína; Němcová, M.; Albrecht, Tomáš

    Badajoz : European Ornithologist's Union, 2015 - (Martin, G.; Marzal, A.). S8.4 [Conference of the European Ornithologist's Union /10./. 24.08.2015-28.08.2015, Badajoz] Institutional support: RVO:68081766 Keywords : zebra finch es * sperm Subject RIV: EG - Zoology

  5. Zebra Crossing: Walking in Two Continents Sharing and Celebrating Difference through Music

    Joseph, Dawn


    I use the metaphor "zebra crossing" in my reflective narrative to describe my plight and struggle as a non-white person growing up and working in Johannesburg, South Africa, during the apartheid era. This article considers and compares the notions of culture, diversity and identity as I now work in a tertiary institution in Melbourne, Australia. I…

  6. The Quantitative Ethology of the Zebra Finch: A Study in Comparative Psychometrics.

    Figueredo, Aurelio Jose; And Others


    A quantitative ethogram was developed for the zebra finch, using one-zero focal animal sampling on an ethologically comprehensive checklist of 52 behavioral items, and it was assessed for interobserver reliability and construct validity. Applying the quantitative methods of psychometrics allows verification of ethological theory and testing of…

  7. The Zebra Fish IBD Model Assessed By Novel Probe Based TagMan Assays

    Kania, Per Walter; Buchmann, Kurt; Haarder, Simon


    models it is known that oxazolone and TNBS can induce conditions mimicking ulcerative colitis (Th2 like response) and Crohn's disease (Th1/Th17 like response), respectively. Zebra fish (body weight 0.5 g) were divided into 4 groups (each with 2 replicates) and instilled rectally with H2O, ethanol, TNBS...

  8. Assessing the potential for fish predation to impact zebra mussels (Dreissena polymorpha): Insight from bioenergetics models

    Eggleton, M.A.; Miranda, L.E.; Kirk, J.P.


    Rates of annual food consumption and biomass were modeled for several fish species across representative rivers and lakes in eastern North America. Results were combined to assess the relative potential of fish predation to impact zebra mussels (Dreissena polymorpha). Predicted annual food consumption by fishes in southern waters was over 100% greater than that in northern systems because of warmer annual water temperatures and presumed increases in metabolic demand. Although generally increasing with latitude, biomasses of several key zebra mussel fish predators did not change significantly across latitudes. Biomasses of some less abundant fish predators did increase significantly with latitude, but increases were not of the magnitude to offset predicted decreases in food consumption. Our results generally support the premise that fishes in rivers and lakes of the southern United States (U.S.) have inherently greater potential to impact zebra mussels by predation. Our simulations may provide a partial explanation of why zebra mussel invasions have not been as rapid and widespread in southern U.S. waters compared to the Great Lakes region. ?? Blackwell Munksgaard, 2004.

  9. Oxygen profile in zebra fish (Danio rerio) elucidated by theory and experiment

    Kranenbarg, S.; Boogaart, van den J.G.M.; Leeuwen, van J.L.


    We present a numerical-experi mental diffusion study in which we elucidate the spatial oxygen profile around and inside a zebra fish embryo in the pre-circulation stage (24-28 hpf). Lowest oxygen partial pressures are found in the head with a gradient of posteriorly increasing pressure along the mid

  10. Automatic detection of zebra crossings from mobile LiDAR data

    Riveiro, B.; González-Jorge, H.; Martínez-Sánchez, J.; Díaz-Vilariño, L.; Arias, P.


    An algorithm for the automatic detection of zebra crossings from mobile LiDAR data is developed and tested to be applied for road management purposes. The algorithm consists of several subsequent processes starting with road segmentation by performing a curvature analysis for each laser cycle. Then, intensity images are created from the point cloud using rasterization techniques, in order to detect zebra crossing using the Standard Hough Transform and logical constrains. To optimize the results, image processing algorithms are applied to the intensity images from the point cloud. These algorithms include binarization to separate the painting area from the rest of the pavement, median filtering to avoid noisy points, and mathematical morphology to fill the gaps between the pixels in the border of white marks. Once the road marking is detected, its position is calculated. This information is valuable for inventorying purposes of road managers that use Geographic Information Systems. The performance of the algorithm has been evaluated over several mobile LiDAR strips accounting for a total of 30 zebra crossings. That test showed a completeness of 83%. Non-detected marks mainly come from painting deterioration of the zebra crossing or by occlusions in the point cloud produced by other vehicles on the road.

  11. Examining the role of tuber biochemistry in the development of zebra chip in stored potato tubers

    Zebra chip disease (ZC), associated with infection by the bacterium ‘Candidatus Liberibacter solanacearum’ (Lso), is an emerging problem for potato growers in the United States, Mexico, and New Zealand. Although potato tubers exhibiting ZC symptoms will be rejected by processors, it remains possible...

  12. Evidence that Cell Death is Associated with Zebra Chip Disease in Potato Tubers

    Zebra chip (ZC) is an established and highly destructive disease of potato (Solanum tuberosum L.) that occurs in several southwestern states of the United States, Mexico, Central America, and New Zealand. The causal agent for this disease has not been identified. However, the bacterium ‘Candidatus ...

  13. Sex-specific effects of yolk testosterone on survival, begging and growth of zebra finches

    von Engelhardt, N; Carere, C; Dijkstra, C; Groothuis, TGG


    Yolk androgens affect offspring hatching, begging, growth and survival in many bird species. If these effects are sex-specific, yolk androgen deposition may constitute a mechanism for differential investment in male and female offspring. We tested this hypothesis in zebra finches. In this species, f

  14. Development of a molecular diagnostic system to discriminate Dreissena polymorpha (zebra mussel) and Dreissena bugensis (quagga mussel)

    Hoy, M.S.; Kelly, K.; Rodriguez, R.J.


    A 3-primer PCR system was developed to discriminate invasive zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussel. The system is based on: 1) universal primers that amplifies a region of the nuclear 28s rDNA gene from both species and 2) a species-specific primer complementary to either zebra or quagga mussel. The species-specific primers bind to sequences between the binding sites for the universal primers resulting in the amplification of two products from the target species and one product from the nontarget species. Therefore, nontarget products are positive amplification controls. The 3-primer system accurately discriminated zebra and quagga mussels from seven geographically distinct populations.

  15. Zebra Finch Song Phonology and Syntactical Structure across Populations and Continents-A Computational Comparison.

    Lachlan, Robert F; van Heijningen, Caroline A A; Ter Haar, Sita M; Ten Cate, Carel


    Learned bird songs are often characterized by a high degree of variation between individuals and sometimes between populations, while at the same time maintaining species specificity. The evolution of such songs depends on the balance between plasticity and constraints. Captive populations provide an opportunity to examine signal variation and differentiation in detail, so we analyzed adult male zebra finch (Taeniopygia guttata) songs recorded from 13 populations across the world, including one sample of songs from wild-caught males in their native Australia. Cluster analysis suggested some, albeit limited, evidence that zebra finch song units belonged to universal, species-wide categories, linked to restrictions in vocal production and non-song parts of the vocal repertoire. Across populations, songs also showed some syntactical structure, although any song unit could be placed anywhere within the song. On the other hand, there was a statistically significant differentiation between populations, but the effect size was very small, and its communicative significance dubious. Our results suggest that variation in zebra finch songs within a population is largely determined by species-wide constraints rather than population-specific features. Although captive zebra finch populations have been sufficiently isolated to allow them to genetically diverge, there does not appear to have been any divergence in the genetically determined constraints that underlie song learning. Perhaps more surprising is the lack of locally diverged cultural traditions. Zebra finches serve as an example of a system where frequent learning errors may rapidly create within-population diversity, within broad phonological and syntactical constraints, and prevent the formation of long-term cultural traditions that allow populations to diverge. PMID:27458396

  16. Factors Affecting Driver Yielding Behavior at a Mid-Block Zebra Crossing

    Wirach Hirun


    Full Text Available Zebra crossing is one of an important pedestrian facility but a number of mid-block zebra crossings for pedestrians in Thailand are not yet utilized. Although the law requires drivers to yield the right-of-way to pedestrians at crossing, within a marked crosswalk in Thailand, a number of drivers still will not yield for a pedestrian. This situation affects the safety of pedestrians and needs urgent attention of the relevant authorities/agencies to improve the situation, before the zebra crossings becomes a safety hazard. The objective of this paper is to investigate the driver behavior at zebra crossings and the factors that are affecting driver yield behavior are also explored. The questionnaire was produced by a Google Form and the drivers were recruited using a snowball sampling technique via a Facebook and Application LINE. Friends and family of the researcher were invited to complete the survey via Facebook and Application LINE and were also asked to pass on the questionnaire to their friends and family. A total of 445 people completed the survey. The descriptive statistics and the logistic regression were employed for analysis. The binary logit model was used with six attributes: age, sex, education, experience, type of vehicle, and knowledge of pedestrian’s right-of-way law was developed. The results indicated that more than 50% of drivers do not have an understanding of the pedestrian’s right-of-way law. The developed model revealed that the yielding behavior of the driver depends on age, education, and knowledge of the pedestrian right-of-way law. The odd number of knowledge of the pedestrian rightof- way law is 1.588. For this reason, educating the drivers to the pedestrian right-of-way law is a beginning point to improve the safety for pedestrians at a zebra crossing in Thailand.

  17. Robotic removal of zebra mussel accumulations in a nuclear power plant screenhouse

    Zebra mussel accumulations in the power plant intake system have increased over the last four years and have become a maintenance issue. Several treatment methods have been used, including mechanical cleaning by divers. This is limited to areas of relatively low flow velocity. Various sections of the screenhouse are not accessible except during an outage or when one of the intake tunnels can be otherwise be blocked and flow reduced. In addition, diver services are relatively costly. For the above reasons, the Indiana Michigan Power Co., Cook Nuclear Plant, contracted with ARD Environmental Inc. to develop and test a robotic system as an alternative to cleaning by divers. The first phase of this project addressed the requirement to clean the screenhouse floor in all areas, including those with high flow velocity. Subsequent phases will address robotic cleaning of other areas of the intake and the screenhouse structures. The objectives of the project were to: (1) Demonstrate the ability to deploy and retrieve a modified XT1000 vehicle in the inlet bay and screen bays; (2) Remove the accumulations of zebra mussels and possibly other pumpable material from the floor; (3) Reduce or eliminate the need for diver services and reduce overall cost of removing accumulations of zebra mussels; and, (4) Critique operations and develop recommendations for further enhancements to the robotic equipment and materials handling system. Implementation of the operating plan commenced on September 8, 1994, and was completed on October 7, 1994. The project demonstrated that robotic techniques are an efficient and cost effective alternative to diver operations for mechanical removal of zebra mussels. In particular, the robotic system was able to operate effectively in the high flow velocity areas including those at the intake tunnels. The ability to operate in the high flow areas means that zebra mussel removal may take place at any time, without affecting normal plant operations

  18. Strategies to control zebra mussel fouling at Kewaunee Nuclear Power Plant

    The zebra mussel, Dreissena polymorpha, is currently infesting the Great Lakes. First discovered in Lake St. Clair, it is now widespread in Lakes Erie and Ontario. The initial efforts relating to zebra mussel control at Wisconsin Public Service Corporation's (WPSC) Kewaunee Nuclear Power Plant (KNPP) precipitated from the Nuclear Regulatory Commission's (NRC) Generic Letter 89-13 regarding fouling of service water (SW) systems at nuclear power plants. In the summer of 1990, Stone and Webster Engineering Corporation (Stone and Webster) was contracted to perform an evaluation of known problems within the SW system. The purposes of the study were to evaluate the actual and potential magnitude of these problems, to evaluate corrective actions to resolve the problems, and to prepare recommendations which would adequately address the issues. Two of the recommendations of this study were to continue a zebra mussel monitoring program which WPSC had already implemented and to evaluate various biocide injection programs should one be required for zebra mussel control. The concern of utilities operating power stations which use waters infested with zebra mussels as their source of cooling and/or makeup water is that mussels (both adults and veligers) will enter plant water systems and foul piping and heat exchangers. This type of fouling can restrict flow through piping, process equipment, and heat exchangers. This type of fouling can restrict flow through piping, process equipment, and heat exchangers, thereby increasing head losses and reducing heat transfer capabilities. The greatest concern in that fouling of this type is within safety-related piping and equipment that are components of service water systems at nuclear power plants

  19. Zebra Fish Dnmt1 and Suv39h1 Regulate Organ-Specific Terminal Differentiation during Development

    Rai, Kunal; Nadauld, Lincoln D; Chidester, Stephanie; Manos, Elizabeth J.; James, Smitha R.; Karpf, Adam R.; Cairns, Bradley R.; Jones, David A.


    DNA methylation and histone methylation are two key epigenetic modifications that help govern heterochromatin dynamics. The roles for these chromatin-modifying activities in directing tissue-specific development remain largely unknown. To address this issue, we examined the roles of DNA methyltransferase 1 (Dnmt1) and the H3K9 histone methyltransferase Suv39h1 in zebra fish development. Knockdown of Dnmt1 in zebra fish embryos caused defects in terminal differentiation of the intestine, exocr...

  20. Early responses to zebra mussels in the Great Lakes: a journey from information vacuum to policy and regulation

    Griffiths, Ronald W.; Schloesser, Don W.; Kovalak, William P.


    Invasive species such as zebra mussels pose a threat to the economies and environments of coastal and fresh-water habitats around the world. Consequently, it is important that government policies and programs be adequate to protect these waters from invaders. This chapter documents key events that took place in the early years (1988-1991) of zebra mussel colonization of the Laurentian Great Lakes and evaluates government responses (policies and programs) to this disruptive, invasive, freshwater species.

  1. On the production and perception of syntactical regularities in zebra finches: experimenting with ABBA, ACDC and others

    Heijningen, Cornelia Adriana Anna van


    Natural zebra finch song contains heterogeneity in the relative distribution of element types across 13 populations worldwide, but compared between individuals it contains relatively little structural constraints or rules in the order of elements. In contrast, from a perception point of view, zebra finches are able to detect differences in song structure and are able to learn rules to generalize these regularities to new element types in some instances, a hallmark of human language. This abil...

  2. Enteroparasitas em alfaces (Lactuca sativa comercializadas na cidade de Guarapuava (PR / Enteroparasites on commercial lettuce (Lactuca sativa in Guarapuava City, Paraná State

    Silvia Cristina Osaki


    Full Text Available O consumo de hortaliças cruas constitui importante meio de transmissão de enteroparasitoses. O objetivo deste trabalho foi avaliar a contaminação parasitária em alfaces (Lactuca sativa comercializadas na cidade de Guarapuava (PR. No período de julho/2005 a junho/2006, 52 supermercados foram visitados, com colheita de um pé de alface. A análise parasitológica foi realizada após duas lavagens, filtragem em gaze e sedimentação. O sedimento, corado pelo lugol, foi analisado microscopicamente por exame direto e após centrífugo-flutuação em sulfato de zinco. Das 52 amostras de alface avaliadas, 18 (34,6% apresentaram uma ou mais estruturas parasitárias como cistos de Giardia spp. (7,7%, de Entamoeba spp. (11,5% e de Balantidium coli (3,8%, oocistos de coccídios (7,7% e ovos de Capillaria spp. (3,8%. Esse alto número de amostras contaminadas aponta deficiências na cadeia produtiva dessas hortaliças, indicando a necessidade de adequada higienização antes de seu consumo. AbstractThe ingestion of raw vegetables is an important mode of enteroparasites transmission. The aim of this study was to evaluate the parasitological contamination of lettuce (Lactuca sativa commercialized in Guarapuava City, Parana State. Fifty-two samples of lettuce were collected from supermarkets during the period of July 2005 and June 2006. Parasitological analysis was realized by the sedimentation technique. Lugol-stained sediments were microscopically analyzed by direct exam and after centrifugation-fluctuation in zinc sulfate. A total of 18 out of 52 lettuce samples analyzed (34.6% were positive for one or more parasitic structures. The parasites found in the analysis were Giardia spp. (7.7%, Entamoeba spp. (11.5%, Balantidium coli (3.8%, coccidian oocysts (7.7% and Capillaria spp. eggs (3.8%. Such high occurrence of contaminated samples revealed deficiencies in the chain of lettuce cultivation, which suggests a need for improvement in the current




    Full Text Available RESUMO O presente trabalho teve como objetivo avaliar a qualidade físico-química das polpas de frutas congeladas comercializadas na cidade de Cuiabá-MT, comparando com os padrões estabelecidos pela legislação vigente. O experimento foi desenvolvido em delineamento inteiramente casualizado, sendo cinco tratamentos (marcas denominadas A, B, C, D e E e três repetições, para as polpas de abacaxi, acerola, caju, goiaba e maracujá. Foram analisados os parâmetros pH, acidez titulável expressa em ácido cítrico, sólidos solúveis, ratio, vitamina C, açúcar redutor e quantificação da perda de vitamina C após 90 dias de armazenamento sob congelamento, em polpas de acerola e caju. Os dados obtidos foram submetidos à análise de variância, e as médias, comparadas pelo teste de Tukey, ao nível de 5% de probabilidade. A marca D apresentou não conformidade com a legislação para todas as polpas em, pelo menos, um dos parâmetros avaliados. Foi observado maior número de amostras em inadequação para o teor de vitamina C e, de forma geral, as polpas avaliadas apresentaram valores abaixo das especificações exigidas pelos Padrões de Identidade e Qualidade (PIQ para as mesmas. Todas as amostras avaliadas tiveram redução do teor de vitamina C durante armazenamento sob congelamento, sendo que nenhuma marca de polpa de acerola e apenas uma de caju apresentou, ao final de 90 dias, teor de vitamina C de acordo com o estabelecido pelo PIQ. Conclui-se que é necessária uma intensificação na fiscalização no processamento de polpas de frutas congeladas para garantia da saúde do consumidor.

  4. Plantas medicinais comercializadas no Mercado Municipal de Campo Grande-MS Commercialized medicinal plants in the Mercado Municipal of Campo Grande-MS

    Mirella Ustulin


    Full Text Available O objetivo do presente trabalho foi realizar um levantamento etnofarmacológico das principais espécies vegetais comercializadas no Mercado Municipal de Campo Grande (MS. O estudo foi realizado entre agosto de 2002 e agosto de 2003, através de entrevistas com os raizeiros. Cerca de 117 espécies foram citadas. Foram selecionadas as plantas dos biomas Cerrado e Pantanal e dessas 34 espécies foram adquiridas. Das plantas adquiridas 22 foram identificadas botanicamente, pois o material das outras foi deficiente para determinação até espécie. Das plantas identifificadas, somente dez são típicas do cerrado, podendo-se citar a Curatella americana, Guazuma ulmifolia, Maclura tinctoria e Stryphnodendron obovatum. A família com o maior número de citação foi Asteraceae, seguida de Moraceae, Sterculiaceae e Leguminosae. A parte das plantas mais utilizada é a folha, preparada principalmente como infusão. A indicação terapêutica mais citada foi como cicatrizante, no tratamento de feridas e dores reumáticas. Grande parte das espécies têm indicação de utilização popular para várias patologias e a maioria das espécies (65,2% não teve qualquer estudo farmacológico que confirmasse a indicação popular. Somente oito espécies (34,8% tiveram alguma atividade confirmada na literatura.The aim of this paper was the survey of the medicinal plants most used from Campo Grande population and commercialized in the Mercado Municipal of Campo Grande, Mato Grosso do Sul, Brazil. The survey was performed in 2002 and 2003 by interviewing and revealed 117 species. Thirty four species were acquired, and of those 22 were identified. Of those ten are only typical of the Cerrado, like as: Curatella americana, Guazuma ulmifolia, Maclura tinctoria, Stryphnodendron obovatum etc. The most mentioned families were Asteraceae, Moraceae, Sterculiaceae and Leguminosae. The most used part of the plant is the leaf, mainly prepared as infusion. These folk

  5. Análise sensorial da água de coco anão verde processada e comercializada no sertão paraibano e cearense

    Suziane Alves Josino Lima


    Full Text Available O Brasil, atualmente, possui uma grande tendência de crescimento do cultivo do coqueiro anão verde, onde o principal objetivo deste se da para a produção da água de coco, sua cultura esta distribuída em todo o território nacional, destacadamente na região Nordeste onde se concentram os maiores plantios do país. A água de coco é um produto natural que vem ganhando espaço no mercado como uma bebida de vasto potencial comercial, pois além de ser um produto natural é praticamente livre de contaminações, possui baixo teor calórico, considerável valor nutricional e apresenta aroma e sabor suaves e agradáveis. Neste contexto se faz necessário a avaliação da qualidade sensorial da água de coco industrializada e comercializada de forma a garantir a qualidade do produto para o consumidor. Com isso este trabalho objetivou avaliar sensorialmente á água de coco anão verde, produzidas comercialmente e envasadas, por indústrias do Sertão Paraibano e do Ceará. As amostras de água de coco proveniente das indústrias, foram analisadas sensorialmente no laboratório de microbiologia do CVT – UFCG - Pombal, utilizando o teste de comparação múltiplas utilizando uma escala hedônica de 9 pontos (9 = gostei extremamente, até 1 desgostei, também foi aplicado o teste de intenção de compra utilizando-se uma escala estruturada de 5 pontos (1 = certamente compraria, até 5 = Certamente compraria, conforme metodologia do Instituto Adolfo Lutz. Os resultados dos testes somente se deram até o 15 dias de armazenamento, onde 70% dos copos de água de coco armazenados, apresentaram-se turvos e com produção de gás, demonstrando apartir deste ponto impróprios para o consumo. Com 30 dias de armazenamento todas as amostras apresentaram insatisfatórios para consumo, demonstrando resultados preocupantes quanto a estabilidade da qualidade do produto durante sua validade comercial. Sugere-se como forma de garantia e manutenção da qualidade

  6. Genomic and neural analysis of the estradiol-synthetic pathway in the zebra finch

    London Sarah E


    Full Text Available Abstract Background Steroids are small molecule hormones derived from cholesterol. Steroids affect many tissues, including the brain. In the zebra finch, estrogenic steroids are particularly interesting because they masculinize the neural circuit that controls singing and their synthesis in the brain is modulated by experience. Here, we analyzed the zebra finch genome assembly to assess the content, conservation, and organization of genes that code for components of the estrogen-synthetic pathway and steroid nuclear receptors. Based on these analyses, we also investigated neural expression of a cholesterol transport protein gene in the context of song neurobiology. Results We present sequence-based analysis of twenty steroid-related genes using the genome assembly and other resources. Generally, zebra finch genes showed high homology to genes in other species. The diversity of steroidogenic enzymes and receptors may be lower in songbirds than in mammals; we were unable to identify all known mammalian isoforms of the 3β-hydroxysteroid dehydrogenase and 17β-hydroxysteroid dehydrogenase families in the zebra finch genome assembly, and not all splice sites described in mammals were identified in the corresponding zebra finch genes. We did identify two factors, Nobox and NR1H2-RXR, that may be important for coordinated transcription of multiple steroid-related genes. We found very little qualitative overlap in predicted transcription factor binding sites in the genes for two cholesterol transport proteins, the 18 kDa cholesterol transport protein (TSPO and steroidogenic acute regulatory protein (StAR. We therefore performed in situ hybridization for TSPO and found that its mRNA was not always detected in brain regions where StAR and steroidogenic enzymes were previously shown to be expressed. Also, transcription of TSPO, but not StAR, may be regulated by the experience of hearing song. Conclusions The genes required for estradiol synthesis and

  7. Pre- and postnatal growth phenomena of Burchell's Zebra Equus Burchelli Antiquorum

    G.L. Smuts


    Full Text Available Between 1969 and 1972 growth data were collected from 175 zebra Equus burchelli antiquorum and 138 zebra embryos and foetuses from the Central District of the Kruger National Park, Republic of South Africa. Statistical analysis of data indicated no significant difference between body mass of adult stallions (range == 267,3 to 373,3 kg; mean = 318,5 kg; n = 57 and adult non-pregnant mares (range = 272,6 to 386,9 kg; mean = 321,6 kg; n = 51 (t = 0,587. The heaviest zebra had a body mass of 429,4 kilogram. This was a pregnant mare carrying a 35,2 kg foetus. Von Bertalanffy growth curves indicated that shoulder heights in young zebra may reach the adult range by one year of age, the adult body mass range is, however, only attained after three years of age. These curves also showed that age classification of free roaming zebra is only reliable up to the age of about two years, after which individual variation is too great. Stallions were significantly taller at the shoulder than mares (mean = 1,8 cm (t = 2,032 and neck thickness was the only body dimension showing visible sexual dimorphism in adults. Here the stallion had a neck girth on average 8,1 cm greater than the mare. Regression equations for estimating body mass from body dimensions were calculated by using a standard logarithmic transformation and fitting a linear regression by the method of least squares and also by undertaking standard straight line linear regression analyses. Exponential curves obtained by the first method indicated that growth was not isometric (not linear and that the ratios of any of the dimensions of length to body mass were con- stantly changing, i.e. growth is allometric. Marked allometric growth differences existed between the two sexes except in the case of the heart girth-body mass relationship. Comparison of growth data from E. b. antiquorum with that of E. b. boehmi from Tanzania (Sachs 1967, indicates that E. b. antiquorum is considerably larger. Body masses

  8. High-Throughput Selection of Retrovirus Producer Cell Lines Leads to Markedly Improved Efficiency of Germ Line-Transmissible Insertions in Zebra Fish

    Chen, Wenbiao; Burgess, Shawn; Golling, Greg; Amsterdam, Adam; Hopkins, Nancy


    Vesicular stomatitis virus glycoprotein G-pseudotyped mouse retroviral vectors have been used as mutagens for a large-scale insertional mutagenesis screen in the zebra fish. To reproducibly generate high-titer virus stocks, we devised a method for rapidly selecting cell lines that can yield high-titer viruses and isolated a producer cell line that yields virus at a high titer on zebra fish embryos. Virus produced from this line, designated GT virus, is nontoxic following injection of zebra fi...

  9. Espécies medicinais comercializadas como "quebra-pedras" em Porto Alegre, Rio Grande do Sul, Brasil Medicinal species sold as "quebra-pedras" in Porto Alegre, Rio Grande do Sul, Brazil

    Adriana Morais Aita


    Full Text Available Este trabalho visa identificar as espécies comercializadas como quebra-pedras em Porto Alegre, verificar indícios de toxicidade e estabelecer padrões morfológicos para diferenciação das mesmas. São espécies utilizadas na medicina popular principalmente para afecções nos rins e bexiga bem como diuréticas. As 16 amostras foram adquiridas de 14 comerciantes atuantes em bancas fixas ou em feiras-livres. Realizou-se uma revisão bibliográfica para levantamento de dados referentes à utilização de plantas medicinais com o nome de quebra-pedras em diferentes cidades do Rio Grande do Sul. Indícios de toxicidade, dados químicos e biológicos destas plantas foram revisados em diferentes bases de dados e em bibliografia específica. Identificaram-se sete espécies comercializadas como quebra-pedras em Porto Alegre: Euphorbia prostrata e E. serpens (Euphorbiaceae, Phyllanthus niruri e P. tenellus (Phyllanthaceae, Desmodium incanum (Fabaceae, Cunila microcephala (Lamiaceae e Heimia salicifolia (Lythraceae. Destas, as espécies de Phyllanthus e Euphorbia são as que apresentam maior semelhança morfológica quando comercializadas secas e fragmentadas.The aims of this work were to identify the species sold as "quebra-pedras" in Porto Alegre, verify signs of toxicity and establish morphological patterns that help to distinguish such species. Those species are believed to be diuretic and are used in popular medicine mainly to treat kidney and bladder affections. The samples (16 were purchased from 14 sellers who work in permanent market stalls or in public marketplaces. A bibliographic revision gathered data on the use of medicinal plants called "quebra-pedras" in several cities of Rio Grande do Sul. Signs of toxicity, chemical and biological data of these plants were reviewed from different databases and specific bibliography. Seven species were identified among those sold as "quebra-pedras" in Porto Alegre: Euphorbia prostrata and E. serpens


    Wahyu Andy Nugraha


    Full Text Available This research aimed to compare the stunning time and recovery time of reef fish Zebra Jakarta. Sianida and clove oil was used as anaesthetic agent in this experiment. Both substances used concentration of 5 ppm. 5 fish was used in each concentration. Fish was exposed to each concentration one by one and once fish undergo in total loss of equilibrium, time was recorded. Fish then tranferred to recovery tank contained fresh aerated sea water. Once fish recovered, time was recorded. Result shows that fish exposed to clove oil 5 ppm have faster stunning time than fish exposed to cyanide 5 ppm. However, fish exposed to cyanide 5 ppm have faster recovery time compared to fish exposed to clove oil 5 ppm.Key words : Stunning time, Zebra Jakarta, Cyanide, Clove oil

  11. Quasi-periodic wiggles of microwave zebra structures in a solar flare

    Yu, Sijie; Selzer, L A; Tan, Baolin; Yan, Yihua


    Quasi-periodic wiggles of microwave zebra pattern structures with period range from about 0.5 s to 1.5 s are found in a X-class solar flare on 2006 December 13 at the 2.6-3.8 GHz with the Chinese Solar Broadband Radio Spectrometer (SBRS/Huairou). Periodogram and correlation analysis show that the wiggles have two-three significant periodicities and almost in phase between stripes at different frequency. The Alfven speed estimated from the zebra pattern structures is about 700 Km/s. We obtain the spatial size of the waveguiding plasma structure to be about 1 Mm with the detected period of about 1 s. It suggests the ZP wiggles can be associated with the fast mag- netoacoustic oscillations in the flaring active region. The lack of a significant phase shift between wiggles of different stripes suggests that the ZP wiggles are caused by a standing sausage oscillation.

  12. A model of so-called "Zebra" emissions in solar flare radio burst continua

    R. A. Treumann


    Full Text Available A simple mechanism for the generation of electromagnetic "Zebra" pattern emissions is proposed. "Zebra" bursts are regularly spaced narrow-band radio emissions on the otherwise broadband radio continuum emitted by the active solar corona. The mechanism is based on the generation of an ion-ring distribution in a magnetic mirror geometry in the presence of a properly directed field-aligned electric potential field. Such ion-rings or ion-conics are well known from magnetospheric observations. Under coronal conditions they may become weakly relativistic. In this case the ion-cyclotron maser generates a number of electromagnetic ion-cyclotron harmonics which modulate the electron maser emission. The mechanism is capable of switching the emission on and off or amplifying it quasi-periodically which is a main feature of the observations.

  13. Antioxidant Activities of Hydrolysates of Arca Subcrenata Prepared with Three Proteases

    Liyan Song


    Full Text Available In order to get products with antioxidant activity from Arca subcrenata Lischke, the optimal hydrolase and hydrolysis conditionswere investigated in the paper. Three proteases (neutrase, alcalase and papain were applied to hydrolyze the homogenate of A. subcrenata. An orthogonaldesign was used to optimize hydrolysis conditions, and the pH-stat methods was used to determine the degree of hydrolysis. Viewed from the angle ofreducing power, such as scavenging activities against α,α-diphenyl-β-picrylhydrazyl (DPPH radical and hydrogen peroxide, the antioxidantactivities of the alcalase hydrolysate (AH were superior to neutrase hydrolysate (NH and papain hydrolysate (PH, and its EC50 values in DPPHradical and hydrogen peroxide scavenging effect were 6.23 mg/ml and 19.09 mg/ml, respectively. Moreover, compared with products hydrolyzed byneutrase and papain, the molecular mass of AH was lower and its content ofamino acid of peptides was higher. Therefore, alcalase was selected as theoptimal enzyme to produce active ingredients since its hydrolysate exhibitedthe best antioxidant activity among them and possessed large amount ofpotential active peptides.

  14. The effects of rearing conditions on sexual traits and preferences in zebra finches

    Holveck, Marie-Jeanne


    Although theory predicts that females should prefer the highest quality male, female mating preferences within populations often show pronounced variation. What causes and maintains this variation remains poorly understood. This thesis addresses the influence of rearing conditions both on female mating preferences and male advertising signals in the zebra finch Taeniopygia guttata. It reconciles earlier apparently contradicting findings on the relative importance of visual versus acoustic sig...

  15. Occurrence of metazoan parasites of zebra fish Danio rerio (Cyprinidae) in Bangladesh

    Ondračková, Markéta; Spence, R.; Smith, C.

    Brno : Ústav biologie obratlovců AV ČR, 2006 - (Bryja, J.; Zukal, J.). s. 135 ISBN 80-903329-4-3. [Zoologické dny. 09.02.2006-10.02.2006, Brno] R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : zebra fish * Bangladesh Subject RIV: EH - Ecology, Behaviour

  16. Preparation and evaluation of biocide-loaded particles to control the biofouling zebra mussel, Dreissena polymorpha

    R. Costa; Aldridge, D. C.; Moggridge, G. D.


    The freshwater zebra mussel Dreissena polymorpha is a powerful biofouling bivalve, which has tremendous impact on industrial facilities whose operation depends on the intensive use of freshwater, such as waterworks and power stations. The control of the pest in industrial environments remains a major challenge due to low selectivity over non-target organisms and the expense of the large quantities of biocides required. A novel delivery technique involving the encapsulation of a toxin within h...

  17. Pharyngeal teeth of the freshwater drum (Aplodinotus grunniens) a predator of the zebra mussel (Dreissena polymorpha)

    French, John R. P., III


    The morphology of pharyngeal teeth of freshwater drum (Aplodinotus grunniens) was studied to determine changes that occur during growth of drum that may relate to consumption of zebra mussel (Dreissena polymorpha) by larger fish. Pharyngeal teeth were of three types. Cardiform teeth were replaced by villiform teeth, which were replaced by molariform teeth as the size class of drum increased. Molariform teeth comprised over 85% of total surface area of dentition in fish 265 mm long.

  18. Myosin heavy-chain isoforms in the flight and leg muscles of hummingbirds and zebra finches

    Velten, Brandy P.; Welch, Kenneth C.


    Myosin heavy chain (MHC) isoform complement is intimately related to a muscle's contractile properties, yet relatively little is known about avian MHC isoforms or how they may vary with fiber type and/or the contractile properties of a muscle. The rapid shortening of muscles necessary to power flight at the high wingbeat frequencies of ruby-throated hummingbirds and zebra finches (25–60 Hz), along with the varied morphology and use of the hummingbird hindlimb, provides a unique opportunity to...

  19. Juvenile zebra finches learn the underlying structural regularities of their fathers’ song

    Otilia eMenyhart; Oren eKolodny; Goldstein, Michael H.; DeVoogd, Timothy J.; Shimon eEdelman


    Natural behaviors, such as foraging, tool use, social interaction, birdsong, and language, exhibit branching sequential structure. Such structure should be learnable if it can be inferred from the statistics of early experience. We report that juvenile zebra finches learn such sequential structure in song. Song learning in finches has been extensively studied, and it is generally believed that young males acquire song by imitating tutors (Zann, 1996). Variability in the order of elements in a...

  20. Sex-specific effects of yolk testosterone on survival, begging and growth of zebra finches

    von Engelhardt, N.; Carere, C; Dijkstra, C; Groothuis, TGG


    Yolk androgens affect offspring hatching, begging, growth and survival in many bird species. If these effects are sex-specific, yolk androgen deposition may constitute a mechanism for differential investment in male and female offspring. We tested this hypothesis in zebra finches. In this species, females increase yolk-testosterone levels and produce male-biased sex ratios when paired to more attractive males. We therefore predicted that especially sons benefit from elevated yolk androgens. E...

  1. The transparent lens and cornea in the mouse and zebra fish eye

    Greiling, Teri M.S.; Clark, John I.


    The lens and cornea combine to form a single optical element in which transparency and refraction are the fundamental biophysical characteristics required for a functional visual system. Although lens and cornea have different cellular and extracellular specializations that contribute to transparency and refraction, their development is closely related. In the embryonic mouse, the developing cornea and lens separate early. In contrast, zebra fish lens and cornea remain connected during early ...

  2. Summary of Ontario Hydro's 1990-91 zebra mussel research program

    Ontario Hydro is the principal supplier of electricity to the Province of Ontario. It serves 3.6 million customers, with an inservice capacity of 28,200 MW. Ontario Hydro has seven fossil, five nuclear, and four hydraulic stations in the Great Lakes Basin and surrounding watershed. In addition, there are another 60 inland hydraulic stations and numerous dams. As the largest single user of raw water from the Great Lakes Basin, Ontario Hydro recognized the need to control zebra mussels early in 1989. At that time, very little was known in North America about the zebra mussel life cycle and potential impact. European utilities were consulted, but as we now know, zebra mussels are not perceived to be a problem in Europe at this time. To satisfy the immediate need for control, chlorination was identified as the most effective interim measure to prevent the fouling of systems which draw water from the aquatic environment. Due to the current regulatory environment, this solution is considered short term and Ontario Hydro was compelled to initiate a comprehensive research effort aimed at providing alternative methods of control. Most of the research effort during 1990, was methods of control. Most of the research effort during 1990, was directed towards this goal. Many alternative control measures, both chemical and nonchemical were considered. Also considered were the potential effects of the control measures and zebra mussels on station operations. A multidisciplinary team involving aquatic biologists, chemists, corrosion specialists, and civil and mechanical engineers from the various departments of Ontario Hydro was asked to address the problem. Some of the research also involved collaborative studies with universities, US utilities, American Water Works Association, and Canadian industries. Following is a summary of the research effort in 1990, and a preview of the research underway in 1991

  3. Effects of suspended sediments on food uptake for zebra mussels in Lake Markermeer, The Netherlands

    Penning, W.E.; L Pozzato; Vijverberg, T.; Noordhuis, R.; bij de Vaate, A.; Van Donk, E.; Dionisio Pires, L.M.


    Until 1992, zebra mussels (Dreissena polymorpha) were an important food source for diving ducks in Lake Markermeer (The Netherlands). After 1993, the mussel biomass sharply declined, and the current population is in poor condition (maximum shell length 0.5 g L-1. The NS concentrations used in this study are high, but analyses of the near-bottom TSM concentrationsshow that these values occur frequently and may be partly responsible for the poor mussel status in Lake Markermeer.

  4. An experimental assessment of the imaging quality of the low energy gamma-ray telescope ZEBRA

    Caroli, E.; Dicocco, G.; Spada, G.; Spizzichino, A.; Stephen, J. B.; Carter, J. N.; Butler, R. C.; Natalucci, L.; Charalambous, P. M.; Dean, A. J.


    One gamma-ray detection plane of the ZEBRA telescope, consisting of nine position sensitive scintillation crystal bars designed to operate over the spectral range 0.2 to 10 MeV, has been constructed in the laboratory. A series of experimental images has been generated using a scaled down flight pattern mask in conjunction with a diverging gamma-ray beam. Point and extended sources have been imaged in order to assess quantitatively the performance of the system.

  5. Same-sex partner preference in zebra finches: pairing flexibility and choice.

    Tomaszycki, Michelle L; Zatirka, Brendon P


    This study examined flexibility and choice in same-sex pair-bonding behavior in adult zebra finches (Taeniopygia guttata). Zebra finches form life-long monogamous relationships and extra pair behavior is very low, making them an ideal species in which to study same-sex pairing. We examined same-sex behaviors using both semi-naturalistic choice paradigms and skewed sex ratios. In the first experiment, we allowed zebra finches to pair in aviaries with equal sex ratios as part of multiple experiments. On average, 6.4% (N = 78) of unmanipulated pairs were same-sex: all but one was female-female. In a second experiment, we identified pairs from same-sex cages and selected 20 total same-sex pairs (10 of each sex). We then gave pairs a chance to court and pair with members of the opposite sex and observed their behavior for three days. Females did not retain their partner, but most paired with males. In contrast, some males did retain their partner. Similarly, females were more likely to engage in pairing behaviors with males than with their partners or other females whereas males were equally likely to engage in same-sex and opposite-sex pairing behaviors. These findings suggest that same-sex partnerships in zebra finches can be facultative, based on the sex ratio of the group in which they live, but can also be a choice, when opportunities to pair with opposite-sex individuals are possible. Furthermore, it is possible that females are more flexible in this choice of same-sex partnerships than are males. PMID:25190500

  6. Lessons from a transplantation of zebra mussels into a small urban river: An integrated ecotoxicological assessment

    Bourgeault, A.; Gourlay-Francé, C.; Vincent-Hubert, F.; Palais, F.; Geffard, A.; Biagianti-Risbourg, S.; Pain-devin, S.; Tusseau Vuillemin, M.H.


    It is often difficult to evaluate the level of contamination in small urban rivers because pollution is mainly diffuse, with low levels of numerous substances. The use of a coupled approach using both chemical and biological measurements may provide an integrated evaluation of the impact of micro-pollution on the river. Zebra mussels were transplanted along a metal and organic pollution gradient in spring 2008. For two months, mussels and water samples were collected from two sites every two ...

  7. The Zebra Battery: a South African contender for electric vehicle application

    J. Coertzer


    Full Text Available The Zebra battery is one of the most promising power sources for electric vehicles which might be on sale before the year 2000. It is a South African development which started at the CSIR and is at present jointly managed by the Anglo American Corpora­tion of S.A. and the German company A.E.G. The chemical reaction converts common salt and nickel to nickel chloride and sodium during the charging phase.

  8. Proper Care, Husbandry, and Breeding Guidelines for the Zebra Finch, Taeniopygia guttata

    Olson, Christopher R.; Wirthlin, Morgan; Lovell, Peter V; MELLO, CLAUDIO V.


    The zebra finch Taeniopygia guttata castanotis is a songbird commonly used in the laboratory, particularly for studies of vocal learning, neurobiology, and physiology. Within the laboratory, it is important to adopt careful husbandry practices that allow for normal development of the birds. For example, their song is a learned trait, passed culturally from adult males to juveniles, and thus its learning can be influenced by the health and social conditions of the birds present in the laborato...

  9. Diet, maternal condition, and offspring sex ratio in the zebra finch, Poephila guttata

    Bradbury, R.B.; Blakey, J K


    Where maternal condition affects condition and reproductive potential of offspring differentially with respect to sex, mothers in relatively good condition should produce more of the sex whose fitness is more dependent on condition. We experimentally manipulated body-condition in unmated zebra finches by feeding them for three months on high- or low-quality diets. Birds were then allowed to breed, while keeping the same diets. Females on the lower quality diet were in better condition and hat...

  10. Freqüência de enteroparasitas em amostras de alface (Lactuca sativa comercializadas em Lavras, Minas Gerais Frequency of intestinal parasites in samples of lettuce (Lactuca sativa commercialized in Lavras, Minas Gerais State

    Antônio Marcos Guimarães


    Full Text Available O objetivo deste trabalho foi realizar uma avaliação parasitológica em amostras de alface (Lactuca sativa comercializadas em Lavras, MG. As amostras de alfaces apresentaram baixos padrões higiênicos, indicados pela presença de formas parasitológicas de origem animal ou humana e alta concentração de coliformes fecais.The aim of this study was to evaluate the parasitological contamination in samples of lettuce (Lactuca sativa commercialized in Lavras city, Minas Gerais. The samples of lettuce showed low hygienic conditions, indicated by the presence of parasites of animal or human origin and high concentration of fecal coliforms.

  11. Avaliação das condições de higiene dos carrinhos ambulantes de água de coco comercializada em Brasília - DF - doi: 10.5102/ucs.v9i1.1235

    Laura Parente Ribeiro; Antônio Felipe Marangon


    O consumo da água de coco verde comercializada em carrinhos ambulantes no país é crescente e significativo, colocando em risco a saúde do consumidor. O presente estudo objetivou avaliar as condições de higiene da comercialização de água de coco feita por carrinhos ambulantes na cidade de Brasília, Distrito Federal. Os principais aspectos analisados foram às condições de higiene dos manipuladores, condições das instalações dos carrinhos ambulantes e de conservação e higienização dos utensílios...




    Full Text Available The aim of this paper is to emphasize the main aspects of the ways in whichdifferent pH levels influence the development of zebra fish (Danio rerio embryos.During the experiments there have been used 6 variants with different pH levels inorder to monitor the development of zebra fish embryos in 40 ml Nunk culturedishes at optimum density (1 embryo/ 3 ml and at an optimal temperature of28.5oC.It could be noticed that most embryos died in a pH=6 medium (70%. This meansthat such a medium is not suitable to embryo’s development. For the controlvariant (pH=7 it has been recorded the lowest mortality rate of only 23% and inthe case of other variants the mortality was of 30-40%.The studies of the pH influence upon the zebra fish embryo development haveunderlined the fact that little digressions from the optimal conditions can led toirreversible modifications within the roe which sometimes are even lethal.

  13. Investigation of Acute Toxicity Diazinon, Deltamethrin, Butachlor and pretilachlor on Zebra Cichlid (Cryptoheros nigrofasciatus

    Ali Sadeghi


    Full Text Available Background: The presence of pesticide due to the huge demand for agricultural purposes is very prevalent in surface waters of Iran. These pesticides could finally accumulate in aquatic ecosystems and have been proved to have toxic effects on aquatic animals. The aim of this study was to assess the acute toxicity of Diazinon, Deltamethrin, Butachlor and Pretilachlor on Zebra Cichlid (Cryptoheros nigrofasciatus. Methods: Fish samples were exposed to different concentrations of Diazinon (60% (0, 2, 4, 8, 16 and 32 ppm, Deltamethrin (2.5% (0, 0.02, 0.04, 0.10, 0.20 and 0.40 ppm, butachlor (60% (0, 2, 4, 8, 16 and 32 ppm and pretilachlor (50% (0, 5, 10, 20, 30 and 40 ppm for 96 h within the 100 L glass aquaria and cumulative mortality of Zebra Cichlid fish was calculated in 24-h interval. Results: The very low LC50 obtained for diazinon (5.06±0.37 ppm, deltamethrin (0.15±0.39 ppm, butachlor (8.93±0.26 ppm and pretilachlor (20.72±0.58 ppm indicated that these are highly toxic chemicals. Conclusion: Our results demonstrate that deltamethrin and pretilachlor had the lowest and highest rate of mortality on the Zebra Cichlid respectively.

  14. Acetylcholinesterase in central vocal control nuclei of the zebra finch (Taeniopygia guttata)

    Monika Sadananda


    The distribution of acetylcholinesterase (AChE) in the central vocal control nuclei of the zebra finch was studied using enzyme histochemistry. AChE fibres and cells are intensely labelled in the forebrain nucleus area X, strongly labelled in high vocal centre (HVC) perikarya, and moderately to lightly labelled in the somata and neuropil of vocal control nuclei robust nucleus of arcopallium (RA), medial magnocellular nucleus of the anterior nidopallium (MMAN) and lateral magnocellular nucleus of the anterior nidopallium (LMAN). The identified sites of cholinergic and/or cholinoceptive neurons are similar to the cholinergic presence in vocal control regions of other songbirds such as the song sparrow, starling and another genus of the zebra finch (Poephila guttata), and to a certain extent in parallel vocal control regions in vocalizing birds such as the budgerigar. AChE presence in the vocal control system suggests innervation by either afferent projecting cholinergic systems and/or local circuit cholinergic neurons. Co-occurrence with choline acetyltransferase (ChAT) indicates efferent cholinergic projections. The cholinergic presence in parts of the zebra finch vocal control system, such as the area X, that is also intricately wired with parts of the basal ganglia, the descending fibre tracts and brain stem nuclei could underlie this circuitry’s involvement in sensory processing and motor control of song.

  15. Zebra mussels (Dreissena polymorpha) as indicators of freshwater contamination with lindane

    Zebra mussels are common freshwater mollusks in many European lakes and rivers. Their abundance, wide distribution, and filtering activity make them good candidates to evaluate the contamination of fresh waters with environmental contaminants. The purpose of this work was to determine the kinetics of lindane in zebra mussels and compare laboratory results with in situ measurements. Exposure was conducted in small tanks, under controlled experimental conditions. Our results indicated that mussels accumulated lindane with a bioconcentration factor around 10. They generally reached equilibrium within 4 days. Elimination was rapid but biphasic and the terminal elimination half-life was long (>168 h). Age of the mussels and temperature also affected the kinetics of lindane in mussels. In the Lake of eneva, zebra mussels were sampled and showed that mussels accumulated it to significant values (up to 900 ng/g fresh weight) depending on the site and period of sampling. The in situ results, together with the laboratory exposures, showed that freshwater mussels could be used to monitor point sources of pollutants such as lindane over short periods of time (<1 week)

  16. Simple Approaches to Improve the Automatic Inventory of ZEBRA Crossing from Mls Data

    Arias, P.; Riveiro, B.; Soilán, M.; Díaz-Vilariño, L.; Martínez-Sánchez, J.


    The city management is increasingly supported by information technologies, leading to paradigms such as smart cities, where decision-makers, companies and citizens are continuously interconnected. 3D modelling turns of great relevance when the city has to be managed making use of geospatial databases or Geographic Information Systems. On the other hand, laser scanning technology has experienced a significant growth in the last years, and particularly, terrestrial mobile laser scanning platforms are being more and more used with inventory purposes in both cities and road environments. Consequently, large datasets are available to produce the geometric basis for the city model; however, this data is not directly exploitable by management systems constraining the implementation of the technology for such applications. This paper presents a new algorithm for the automatic detection of zebra crossing. The algorithm is divided in three main steps: road segmentation (based on a PCA analysis of the points contained in each cycle of collected by a mobile laser system), rasterization (conversion of the point cloud to a raster image coloured as a function of intensity data), and zebra crossing detection (using the Hough Transform and logical constrains for line classification). After evaluating different datasets collected in three cities located in Northwest Spain (comprising 25 strips with 30 visible zebra crossings) a completeness of 83% was achieved.

  17. Acute phase protein and protein electrophoresis values for captive Grant's zebra (Equus burchelli).

    Cray, Carolyn; Hammond, Elizabeth; Haefele, Holly


    Grant's zebra (Equus burchelli) are commonly kept in zoos and are subject to routine health monitoring and research studies. Recently, assays for acute phase proteins (APP) have been described in many wildlife species, and specific assays for serum amyloid A (SAA) have been well validated and studied in horses (Equus ferus caballus), in which it serves as a major APP. In the present study, serum samples from 26 Grant's zebra were subject to analysis by using assays for SAA, haptoglobin (HP), and protein electrophoresis. Reference intervals were calculated by using the robust method: SAA 1.8-31.4 mg/L and HP 0.37-1.58 mg/ml. Significant differences in SAA and HP were observed in clinically abnormal zebra; in some cases, these differences were marked and were noted in the absence of abnormal values for protein electrophoretic fractions. These data indicate that APP may be a valuable and sensitive tool in monitoring inflammation in this species. PMID:24450080

  18. Batteries: An Advanced Na-FeCl2 ZEBRA Battery for Stationary Energy Storage Application

    Li, Guosheng; Lu, Xiaochuan; Kim, Jin Yong; Viswanathan, Vilayanur V.; Meinhardt, Kerry D.; Engelhard, Mark H.; Sprenkle, Vincent L.


    Sodium-metal chloride batteries, ZEBRA, are considered as one of the most important electrochemical devices for stationary energy storage applications because of its advantages of good cycle life, safety, and reliability. However, sodium-nickel chloride (Na-NiCl2) batteries, the most promising redox chemistry in ZEBRA batteries, still face great challenges for the practical application due to its inevitable feature of using Ni cathode (high materials cost). In this work, a novel intermediate-temperature sodium-iron chloride (Na-FeCl2) battery using a molten sodium anode and Fe cathode is proposed and demonstrated. The first use of unique sulfur-based additives in Fe cathode enables Na-FeCl2 batteries can be assembled in the discharged state and operated at intermediate-temperature (<200°C). The results in this work demonstrate that intermediate-temperature Na-FeCl2 battery technology could be a propitious solution for ZEBRA battery technologies by replacing the traditional Na-NiCl2 chemistry.

  19. Castration modulates singing patterns and electrophysiological properties of RA projection neurons in adult male zebra finches

    Songhua Wang


    Full Text Available Castration can change levels of plasma testosterone. Androgens such as testosterone play an important role in stabilizing birdsong. The robust nucleus of the arcopallium (RA is an important premotor nucleus critical for singing. In this study, we investigated the effect of castration on singing patterns and electrophysiological properties of projection neurons (PNs in the RA of adult male zebra finches. Adult male zebra finches were castrated and the changes in bird song assessed. We also recorded the electrophysiological changes from RA PNs using patch clamp recording. We found that the plasma levels of testosterone were significantly decreased, song syllable’s entropy was increased and the similarity of motif was decreased after castration. Spontaneous and evoked firing rates, membrane time constants, and membrane capacitance of RA PNs in the castration group were lower than those of the control and the sham groups. Afterhyperpolarization AHP time to peak of spontaneous action potential (AP was prolonged after castration.These findings suggest that castration decreases song stereotypy and excitability of RA PNs in male zebra finches.

  20. Gene duplication and fragmentation in the zebra finch major histocompatibility complex

    Burt David W


    Full Text Available Abstract Background Due to its high polymorphism and importance for disease resistance, the major histocompatibility complex (MHC has been an important focus of many vertebrate genome projects. Avian MHC organization is of particular interest because the chicken Gallus gallus, the avian species with the best characterized MHC, possesses a highly streamlined minimal essential MHC, which is linked to resistance against specific pathogens. It remains unclear the extent to which this organization describes the situation in other birds and whether it represents a derived or ancestral condition. The sequencing of the zebra finch Taeniopygia guttata genome, in combination with targeted bacterial artificial chromosome (BAC sequencing, has allowed us to characterize an MHC from a highly divergent and diverse avian lineage, the passerines. Results The zebra finch MHC exhibits a complex structure and history involving gene duplication and fragmentation. The zebra finch MHC includes multiple Class I and Class II genes, some of which appear to be pseudogenes, and spans a much more extensive genomic region than the chicken MHC, as evidenced by the presence of MHC genes on each of seven BACs spanning 739 kb. Cytogenetic (FISH evidence and the genome assembly itself place core MHC genes on as many as four chromosomes with TAP and Class I genes mapping to different chromosomes. MHC Class II regions are further characterized by high endogenous retroviral content. Lastly, we find strong evidence of selection acting on sites within passerine MHC Class I and Class II genes. Conclusion The zebra finch MHC differs markedly from that of the chicken, the only other bird species with a complete genome sequence. The apparent lack of synteny between TAP and the expressed MHC Class I locus is in fact reminiscent of a pattern seen in some mammalian lineages and may represent convergent evolution. Our analyses of the zebra finch MHC suggest a complex history involving

  1. De las arcas reales a las arcas de la nación. El presupuesto y la contabilidad pública como valladares frente a la arbitrariedad gubernamental

    Fernando López Castellano


    social. Cuando se presenta el Informe de la Comisión Especial de Hacienda de las Cortes sobre el Nuevo Plan de Contribuciones, a 6 de julio de 1813, el autor del artículo del Tribuno del Pueblo Español indica : “Las arcas hasta aquí llamadas Reales, son arcas de la Nación”. En este artículo, se examina el trabajo prolífico de un reformador, José Canga Argüelles, que estuvo en el centro de este movimiento orientado a la “racionalización” de la administración. Burócrata formado en la administración de la monarquía y político en el nuevo Estado, inicia la institucionalización del presupuesto y promueve una reforma profunda de la Contabilidad Pública.Von Kassen des Königs bis zu Kassen der Nation. Der Haushaltsplan und die Staatsbuchführung wie Schutzwehren vor der Willkür der Regierung (1808-1814 - Während der französischen Besatzung (1808-1814 ist die Steuerreform mit einer tiefen wirtschaftlichen, politischen und sozialen Umwandlung verbunden gewesen. Während der Vorlage des Berichtes der Außerordentlichen Kommission für die Finanzen von Cortes über den Neuen Plan der Steuereinnahmen, am 6. Juli 1813 weist der Autor des Artikels des Tribuns des spanischen Volkes hin : “die königlichen sogenannten Kassen bis hierher, sind die Kassen der Nation”. Dieser Artikel stellt die fruchtbare Arbeit eines Reformers vor, José Canga Argüelles, der im Herzen dieser Bewegung gewesen ist und der sich um die Rationalisierung der Verwaltung gemüht hat. Bürokrat in der Verwaltung der ehemaligen Monarchie, Politiker im neuen Staat, unternahm er die Institutionalisierung des Haushaltsplanes und vertrat eine tiefe Reform der Staatsbuchführung.

  2. Application experience with ADBAC/DGH cationic surfactants for zebra mussel control in a nuclear service water system

    In response to the introduction and rapid growth of the zebra mussel population in the Great Lakes and the issuance of NRC Generic Letter 89-13 (Service Water Problems Affecting Safety-Related Equipment). A midwest nuclear station instituted a zebra mussel monitoring and control program. The nuclear station uses Lake Michigan as a cooling water source for two 1,100 MW Westinghouse 4-loop design, pressurized water reactors (PWR). Two years of monitoring indicated a growth in zebra mussel population from 0.5 organisms/m2 in July 1990 to 100 organisms/m2 by November 1990. This rapid increase indicated an urgent need for viable methods of zebra mussel control to protect the plant's essential service water (ESW) and non-essential service water (NESW) systems. In April 1991, the station formulated a plan that combined increased system inlet temperature with targeted application of a proprietary product containing two cationic surfactants, ADBAC/DGH. Sidestream biomonitoring boxes were seeded with zebra mussels and observed as a measure of the efficacy of the treatment. Where recommended dosages and duration were maintained, 100% control was achieved

  3. Zebra chip-diseased potato tubers are characterized by increased levels of host secondary metabolites, amino acids, and defense-related proteins

    Zebra chip disease, a serious threat to potato production in the United States and elsewhere, is associated with 'Cadidatus Liberibacter solacearum'. Little is known about host chemistry effects on zebra chip disease symptom development in potatoes (Solanum tuberosum). This research compared chemic...

  4. Using Digital Images of the Zebra Finch Song System as a Tool to Teach Organizational Effects of Steroid Hormones: A Free Downloadable Module

    Grisham, William; Schottler, Natalie A.; Beck McCauley, Lisa M.; Pham, Anh P.; Ruiz, Maureen L.; Fong, Michelle C.; Cui, Xinran


    Zebra finch song behavior is sexually dimorphic: males sing and females do not. The neural system underlying this behavior is sexually dimorphic, and this sex difference is easy to quantify. During development, the zebra finch song system can be altered by steroid hormones, specifically estradiol, which actually masculinizes it. Because of the…

  5. A New in Vitro Anti-Tumor Polypeptide Isolated from Arca inflata

    Jian Xu


    Full Text Available A new in vitro anti-tumor polypeptide, coded as J2-C3, was isolated from Arca inflata Reeve and purified by diethyl-aminoethanol (DEAE-sepharose Fast Flow anion exchange and phenyl sepharose CL-4B hydrophobic chromatography. J2-C3 was identified to be a homogeneous compound by native polyacrylamide gel electrophoresis (Native-PAGE. The purity of J2-C3 was over 99% in reversed phase-high performance liquid chromatography (RP-HPLC. The molecular weight was determined as 20,538.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS. J2-C3 was rich in Glx (Gln + Glu, Lys, and Asx (Asp + Asn according to amino acid analysis. Four partial amino acid sequences of this peptide were determined as L/ISMEDVEESR, KNGMHSI/LDVNHDGR, AMKI/LI/LNPKKGI/LVPR and AMGAHKPPKGNEL/IGHR via MALDI-TOF/TOF-MS and de novo sequencing. Secondary structural analysis by CD spectroscopy revealed that J2-C3 had the α-helix (45.2%, β-sheet (2.9%, β-turn (26.0% and random coil (25.9%. The anti-tumor effect of J2-C3 against human tumor cells was measured by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, and the IC50 values of J2-C3 were 65.57, 93.33 and 122.95 µg/mL against A549, HT-29 and HepG2 cell lines, respectively. Therefore, J2-C3 might be developed as a potential anti-tumor agent.

  6. Phosphorylation of Epstein-Barr Virus ZEBRA Protein at Its Casein Kinase 2 Sites Mediates Its Ability To Repress Activation of a Viral Lytic Cycle Late Gene by Rta

    El-Guindy, Ayman S.; Miller, George


    ZEBRA, a member of the bZIP family, serves as a master switch between latent and lytic cycle Epstein-Barr virus (EBV) gene expression. ZEBRA influences the activity of another viral transactivator, Rta, in a gene-specific manner. Some early lytic cycle genes, such as BMRF1, are activated in synergy by ZEBRA and Rta. However, ZEBRA suppresses Rta's ability to activate a late gene, BLRF2. Here we show that this repressive activity is dependent on the phosphorylation state of ZEBRA. We find that...

  7. Ballast water as a vector of coral pathogens in the Gulf of Mexico: the case of the Cayo Arcas coral reef.

    Aguirre-Macedo, M Leopoldina; Vidal-Martinez, Victor M; Herrera-Silveira, Jorge A; Valdés-Lozano, David S; Herrera-Rodríguez, Miguel; Olvera-Novoa, Miguel A


    The discharge of nutrients, phytoplankton and pathogenic bacteria through ballast water may threaten the Cayo Arcas reef system. To assess this threat, the quality of ballast water and presence of coral reef pathogenic bacteria in 30 oil tankers loaded at the PEMEX Cayo Arcas crude oil terminal were determined. The water transported in the ships originated from coastal, oceanic or riverine regions. Statistical associations among quality parameters and bacteria were tested using redundancy analysis (RDA). In contrast with coastal or oceanic water, the riverine water had high concentrations of coliforms, including Vibrio cholerae 01 and, Serratia marcescens and Sphingomona spp., which are frequently associated with "white pox" and "white plague type II" coral diseases. There were also high nutrient concentrations and low water quality index values (WQI and TRIX). The presence of V. cholerae 01 highlights the need for testing ballast water coming from endemic regions into Mexican ports. PMID:18639903

  8. Genome-wide annotation and analysis of zebra finch microRNA repertoire reveal sex-biased expression

    Luo Guan-Zheng


    Full Text Available Abstract Background MicroRNAs (miRNAs are small noncoding RNAs that regulate gene expression post-transcriptionally in a wide range of biological processes. The zebra finch (Taeniopygia guttata, an oscine songbird with characteristic learned vocal behavior, provides biologists a unique model system for studying vocal behavior, sexually dimorphic brain development and functions, and comparative genomics. Results We deep sequenced small RNA libraries made from the brain, heart, liver, and muscle tissues of adult male and female zebra finches. By mapping the sequence reads to the zebra finch genome and to known miRNAs in miRBase, we annotated a total of 193 miRNAs. Among them, 29 (15% are avian specific, including three novel zebra finch specific miRNAs. Many of the miRNAs exhibit sequence heterogeneity including length variations, untemplated terminal nucleotide additions, and internal substitution events occurring at the uridine nucleotide within a GGU motif. We also identified seven Z chromosome-encoded miRNAs. Among them, miR-2954, an avian specific miRNA, is expressed at significantly higher levels in males than in females in all tissues examined. Target prediction analysis reveals that miR-2954, but not other Z-linked miRNAs, preferentially targets Z chromosome-encoded genes, including several genes known to be expressed in a sexually dimorphic manner in the zebra finch brain. Conclusions Our genome-wide systematic analysis of mature sequences, genomic locations, evolutionary sequence conservation, and tissue expression profiles of the zebra finch miRNA repertoire provides a valuable resource to the research community. Our analysis also reveals a miRNA-mediated mechanism that potentially regulates sex-biased gene expression in avian species.

  9. Simple sequence repeats in zebra finch (Taeniopygia guttata expressed sequence tags: a new resource for evolutionary genetic studies of passerines

    Birkhead Timothy R


    Full Text Available Abstract Background Passerines (perching birds are widely studied across many biological disciplines including ecology, population biology, neurobiology, behavioural ecology and evolutionary biology. However, understanding the molecular basis of relevant traits is hampered by the paucity of passerine genomics tools. Efforts to address this problem are underway, and the zebra finch (Taeniopygia guttata will be the first passerine to have its genome sequenced. Here we describe a bioinformatic analysis of zebra finch expressed sequence tag (EST Genbank entries. Results A total of 48,862 ESTs were downloaded from GenBank and assembled into contigs, representing an estimated 17,404 unique sequences. The unique sequence set contained 638 simple sequence repeats (SSRs or microsatellites of length ≥20 bp and purity ≥90% and 144 simple sequence repeats of length ≥30 bp. A chromosomal location for the majority of SSRs was predicted by BLASTing against assembly 2.1 of the chicken genome sequence. The relative exonic location (5' untranslated region, coding region or 3' untranslated region was predicted for 218 of the SSRs, by BLAST search against the ENSEMBL chicken peptide database. Ten loci were examined for polymorphism in two zebra finch populations and two populations of a distantly related passerine, the house sparrow Passer domesticus. Linkage was confirmed for four loci that were predicted to reside on the passerine homologue of chicken chromosome 7. Conclusion We show that SSRs are abundant within zebra finch ESTs, and that their genomic location can be predicted from sequence similarity with the assembled chicken genome sequence. We demonstrate that a useful proportion of zebra finch EST-SSRs are likely to be polymorphic, and that they can be used to build a linkage map. Finally, we show that many zebra finch EST-SSRs are likely to be useful in evolutionary genetic studies of other passerines.

  10. Status of the EC-FP7 Project ARCAS: Comparing the economics of accelerator-driven systems and fast reactors as minor actinide burners

    The ARCAS Project aims to compare, on a technological and economical basis, accelerator-driven systems and fast reactors as minor actinide burners. It is split into five work packages: the reference scenario definition, the fast reactor system definition, the accelerator-driven system definition, the fuel reprocessing and fabrication facilities definition and the economical comparison. This paper summarises the status of the project and its five work packages. (authors)

  11. EC-FP7 ARCAS: technical and economical comparison of Fast Reactors and Accelerator Driven Systems for transmutation of Minor Actinides

    The ARCAS project aims to compare, on a technological and economical basis, Accelerator Driven Systems and Fast Reactors as Minor Actinide burners. It is split in five work packages: the reference scenario definition, the fast reactor system definition, the accelerator driven system definition, the fuel reprocessing and fabrication facilities definition and the economical comparison. This paper summarizes the status of the project and its five work packages. (author)


    Ivan Župan; Tomislav Šarić; Melita Peharda; Daria Ezgeta-Balić


    Noah’s ark shell Arca noae Linnaeus, 1758 is one of the most important commercially exploited bivalve species in the eastern Adriatic Sea. High harvesting pressure, as a consequence of increasing market demands, could in the future result in its overexploitation in some areas. All mentioned above, together with a high market price, make A. noae a new species for introduction into aquaculture. Several studies have recently been conducted concerning biology and ecology of A. noae in the Adriati...

  13. Effects of elevated carbon dioxide concentrations on survivorship in zebra mussels (Dreissena polymorpha) and Asian clams (Corbicula fluminea)

    McMahon, R.F.; Matthews, M.A.; Shaffer, L.R.; Johnson, P.D. [Univ. of Texas, Arlington, TX (United States)


    In order to determine their tolerance to elevated concentrations of carbon dioxide, Asian clams and zebra mussels were collected. Subsamples of both species were acclimated to 25{degrees}C>14 days and then exposed in water at 25{degrees}C to various concentrations of CO{sub 2} and survivorship recorded. Zebra mussels were allowed to byssally attach prior to testing. Media CO{sub 2} concentrations were maintained by continuous bubbling with appropriate gas mixtures. Gas treatment included: (1) anoxia; (2) hypercapnic anoxia; and (3) hypercapnic normoxia. Deaths were recorded in subsamples of both species every 12-24 h until 100% mortality was achieved. No significant mortality occurred among specimens of either species in air bubbled control media in any experiment. Mortality time of zebra mussels exposed to anoxia under 100% N{sub 2} was 103.7 h and of Asian clams, 349.7 h. Mortality was more rapid among samples of both species exposed to anoxia under 100% CO{sub 2}, mean time to death being 43.6 h for zebra mussels and 46.3 h for Asian clams. There was no difference in the survivorship of samples of either species under atmospheres of either 5% CO{sub 2} and 95% N{sub 2} or 100% N{sub 2}, however, Asian clams survived anoxia under either atmosphere 4 to 5 times longer than did zebra mussels. There was no significant mortality among Asian clam or zebra mussel samples after a 39 day exposure to hypercapnic normoxia. While exposure to hypercapnic normoxia under an atmosphere of 5% CO{sub 2}:19% O{sub 2}:76% N{sub 2} did not induce mortality in zebra mussel samples, it completely suppressed all byssal thread production after 7 days of exposure and induced all sampled individuals to release from their byssal attachments within 10 days of exposure. These results indicate that CO{sub 2} injection may be an easily applied, cost-effective, environmentally acceptable molluscicide for mitigation and control of raw water system macrofouling by Asian clams and zebra mussels.

  14. Mate call as reward: Acoustic communication signals can acquire positive reinforcing values during adulthood in female zebra finches (Taeniopygia guttata).

    Hernandez, Alexandra M; Perez, Emilie C; Mulard, Hervé; Mathevon, Nicolas; Vignal, Clémentine


    Social stimuli can have rewarding properties and promote learning. In birds, conspecific vocalizations like song can act as a reinforcer, and specific song variants can acquire particular rewarding values during early life exposure. Here we ask if, during adulthood, an acoustic signal simpler and shorter than song can become a reward for a female songbird because of its particular social value. Using an operant choice apparatus, we showed that female zebra finches display a preferential response toward their mate's calls. This reinforcing value of mate's calls could be involved in the maintenance of the monogamous pair-bond of the zebra finch. (PsycINFO Database Record PMID:26881942

  15. Examination of the potential of chlorine dioxide for use in zebra mussel veliger control

    Rusznak, L.; Smolik, N.; Hale, L.; Freymark, S. [Ashland Chemical Company, Drew Division, Boonton, NJ (United States)


    Dreissena polymorpha (zebra mussel) veligers were treated with various concentrations of chlorine dioxide and exposed at several time intervals to determine the effectiveness of this oxidant as a veliger control agent. The direction of this testing was based on previous studies which determined the effectiveness of chlorine dioxide as a molluscicide for adult zebra mussel control. Zebra mussel veligers were collected from the Niagara River shoreline at an untreated site and tested using filtered river water from the same source. All testing was conducted on site at an industrial plant in order to insure the integrity of veligers collected for this study. The plankton wheel method was used to examine the effects of chlorine dioxide. This methodology involves intense microscopic examination of the test organism prior to and after chemical exposure todeterminen molluscicidal efficacy. Veliger mortality was determined based on observations of veliger movement. Typical criteria for the determination of mortality was expanded to include four categories; veliger actively swimming, internal musculature movement, no internal musculature movement observed, however not necessarily indicating a mortality and obviously a mortality. The treatment levels ranged from 0.75 ppm - 2.0 ppm which are considered to simulate treatment levels in actual applications. Mortality levels ranged on average from 16%-42% based on 30 minute or 60 minute exposure times. The determination exposure time was based on water flow time intervals in actural applications. Sodium hypochlorite was also evaluated in order to compare the effectiveness of chlorine dioxide against this known veliger control agent. Testing resulted in chlorine dioxide providing significantly better veliger control than sodium hypochlorite under similar conditions.

  16. Combined effects of depleted uranium and ionising radiation on zebra fish embryos

    In the environment, living organisms are exposed to a mixture of stressors, and the combined effects are deemed as multiple stressor effects. In the present work, the authors studied the multiple stressor effect in embryos of the zebra fish (Danio rerio) from simultaneous exposure to alpha particles and depleted uranium (DU) through quantification of apoptotic signals at 24 h post-fertilisation (hpf) revealed by vital dye acridine orange staining. In each set of experiments, dechorionated zebra fish embryos were divided into 4 groups, each having 10 embryos: Group (C) in which the embryos did not receive any further treatment; Group (IU) in which the embryos received an alpha-particle dose of 0.44 mGy at 5 hpf and were then exposed to 100 μg l-1 of DU from 5 to 6 hpf; Group (I) in which the embryos received an alpha-particle dose of 0.44 mGy at 5 hpf and Group (U) in which the dechorionated embryos were exposed to 100 μg l-1 of DU from 5 to 6 hpf. The authors confirmed that an alpha-particle dose of 0.44 mGy and a DU exposure for 1 h separately led to hormetic and toxic effects assessed by counting apoptotic signals, respectively, in the zebra fish. Interestingly, the combined exposure led to an effect more toxic than that caused by the DU exposure alone, so effectively DU changed the beneficial effect (hormesis) brought about by alpha-particle irradiation into an apparently toxic effect. This could be explained in terms of the promotion of early death of cells predisposed to spontaneous transformation by the small alpha-particle dose (i.e. hormetic effect) and the postponement of cell death upon DU exposure. (authors)

  17. Todralazine protects zebra fish from lethal doses of ionizing radiation: role of hematopoietic stem cell expansion

    Radiation induced cell killing and hematopoietic stem cell depletion leads to compromised immune functions and opportunistic infections which significantly affect the recovery and survival upon irradiation. Any agent which can expand residual hematopoietic stem cells in irradiated organism can render protection from the effects of lethal doses of ionizing radiation. Johns Hopkins Clinical compound library (JHCCL) was screened for protection against lethal doses of ionizing radiation using developing zebra fish as a model organism. Modulation of radiation induced reactive oxygen species by the small molecules were done by DCFDA staining and for visual identification and quantification of apoptosis acridine orange assay, flow cytometry were employed respectively. Hematopoietic stem cell expansion potential was assessed by quantifying runx1 expression, a marker for definitive stem cells, were done by RT-PCR and by the kinetics of recovery from chemically induced anaemia. Todralazine hydrochloride from JHCCL exhibited promising results with potential anti radiation effects. A dose of 5μM was found to be the most effective and has rendered significant organ and whole body protection (100% survival advantage over a period of 6 days) against 20 Gy. However todralazine did not modulated radiation induced free radicals (monitored within 2 h of irradiation) and apoptosis in zebra fish embryos analysed at 8 and 24h post irradiation. Flow cytometric quantification of pre G1 population suggested the same. Chemoinformatics approaches were further carried out to elucidate possible targets which are contributing to its radioprotection potential. Structural similarity search suggested several targets and possible hematopoietic stem cell expanding potential. Treatment of zebra fish embryos with todralazine has lead to significant proliferation of hematopoietic stem cell as indicated by increase in expression of runx1. HSC expanding potential of todralazine was further supported by

  18. Current Status of Health and Safety Issues of Sodium/Metal Chloride (Zebra) Batteries

    This report addresses environmental, health, and safety (EH ampersand S) issues associated with sodium/ metal chloride batteries, in general, although most references to specific cell or battery types refer to units developed or being developed under the Zebra trademark. The report focuses on issues pertinent to sodium/metal chloride batteries and their constituent components; however, the fact that some ''issues'' arise from interaction between electric vehicle (EV) and battery design com- pels occasional discussion amid the context of EV vehicle design and operation. This approach has been chosen to provide a reasonably comprehensive account of the topic from a cell technology perspective and an applications perspective

  19. Avaliação da toxidade de misturas de desinfetantes em peixe zebra

    Silva, Carla Ofélia Ferreira da


    Grandes quantidades de produtos químicos (por exemplo, detergentes e desinfetantes) são usados em hospitais para limpeza e desinfeção. Os seus efluentes consistem em misturas que podem causar sérios problemas ambientais. Neste trabalho foram estudados os efeitos de três misturas entre desinfetantes hospitalares: glutaraldeído (GA), formaldeído (FA) ou ortoftaldeído (OPA), com o surfatante cloreto de benzalcónio (BKC), nos primeiros estádios de vida do peixe zebra. Os ensa...

  20. Oscillating magnetic field disrupts magnetic orientation in Zebra finches, Taeniopygia guttata

    Wiltschko Wolfgang


    Full Text Available Abstract Background Zebra finches can be trained to use the geomagnetic field as a directional cue for short distance orientation. The physical mechanisms underlying the primary processes of magnetoreception are, however, largely unknown. Two hypotheses of how birds perceive magnetic information are mainly discussed, one dealing with modulation of radical pair processes in retinal structures, the other assuming that iron deposits in the upper beak of the birds are involved. Oscillating magnetic fields in the MHz range disturb radical pair mechanisms but do not affect magnetic particles. Thus, application of such oscillating fields in behavioral experiments can be used as a diagnostic tool to decide between the two alternatives. Methods In a setup that eliminates all directional cues except the geomagnetic field zebra finches were trained to search for food in the magnetic north/south axis. The birds were then tested for orientation performance in two magnetic conditions. In condition 1 the horizontal component of the geomagnetic field was shifted by 90 degrees using a helmholtz coil. In condition 2 a high frequently oscillating field (1.156 MHz was applied in addition to the shifted field. Another group of birds was trained to solve the orientation task, but with visual landmarks as directional cue. The birds were then tested for their orientation performance in the same magnetic conditions as applied for the first experiment. Results The zebra finches could be trained successfully to orient in the geomagnetic field for food search in the north/south axis. They were also well oriented in test condition 1, with the magnetic field shifted horizontally by 90 degrees. In contrast, when the oscillating field was added, the directional choices during food search were randomly distributed. Birds that were trained to visually guided orientation showed no difference of orientation performance in the two magnetic conditions. Conclusion The results

  1. Efeitos de erros de tradução no peixe zebra

    Neves, Ana Catarina Reis Vela


    O stress proteotóxico é responsável pela degeneração celular frequentemente associada a doenças neurodegenerativas e ao envelhecimento. No entanto não é ainda claro como é que o stress proteotóxico contribui para esta degeneração. Para clarificar esta questão, foram utilizados peixes zebra transgénicos que expressam tRNA mutantes em todas as células e tecidos. Estes tRNAs introduzem erradamente serina devido a mutações no seu anticodão, contribuindo para a síntese de prot...

  2. Current Status of Health and Safety Issues of Sodium/Metal Chloride (Zebra) Batteries

    Trickett, D.


    This report addresses environmental, health, and safety (EH&S) issues associated with sodium/ metal chloride batteries, in general, although most references to specific cell or battery types refer to units developed or being developed under the Zebra trademark. The report focuses on issues pertinent to sodium/metal chloride batteries and their constituent components; however, the fact that some ''issues'' arise from interaction between electric vehicle (EV) and battery design compels occasional discussion amid the context of EV vehicle design and operation. This approach has been chosen to provide a reasonably comprehensive account of the topic from a cell technology perspective and an applications perspective.


    Ivanilda M. AUGUSTA


    Full Text Available A manteiga é um produto gorduroso onde a fase aquosa está dispersa na fase oleosa formando emulsão do tipo água/óleo. As análises físicas e químicas revelam se a fase oleosa apresenta alterações decorrentes de hidrólise, rancificação ou adulteração. A adição de outras gorduras na manteiga provoca alterações em seus índices físicos e químicos. Para avaliar a qualidade de manteigas tipo extra com sal comercializadas no Estado do Rio de Janeiro, cinco marcas nacionais e duas importadas, totalizando 66 amostras, foram submetidas às análises de acidez, índice de peróxidos, índice de iodo, teor de umidade, teor de cloreto de sódio e composição em ácidos graxos por cromatografia gasosa de alta resolução. A acidez das amostras variou de 0,76 a 2,03 ml SN%; o índice de peróxidos de 0,15 a 3,82 meq peróxidos/kg gordura; o índice de iodo de 20,76 a 53,46 g I2/100g gordura; o teor de umidade de 11,3 a 20,3%; o teor de cloreto de sódio de 0,14 a 2,21%; a composição em % dos principais ácidos graxos foi C14:0 (9,7-12,1%; C16:0 (22,0-26,1%; C18:0 (9,6-11,7% e C18:1 (21,9-24,2%. Os resultados das amostras foram comparados com o RIISPOA (1952 e com a Portaria n0. 146/96 do MAARA. Todas as amostras analisadas estavam com a acidez dentro dos padrões; 85,5% estavam com índice de peróxidos acima do permitido; 15,2% estavam fora dos limites de índice de iodo; 34,8% estavam com excesso de umidade e 7,5% estavam com o teor de cloreto de sódio acima do permitido. A composição em ácidos graxos estava dentro dos padrões.Butter is a fatty product where the aqueous phase is dispersed in oil phase forming a water/oil emulsion. The physical and chemical analysis determine the occurrence of hidrolysis, rancification or adulteration in the oil phase. The improper addition of other fats in butter formulation, in order to reduce costs, causes a modification of the oil phase physical and chemical characterisitics. Five brazilian


    Župan, Ivan; Peharda, Melita; Ezgeta-Balić, Daria; Šarić, Tomislav


    Kunjka Arca noae Linnaeus, 1758 jedna je od najvažnijih komercijalno iskorištavanih vrsta školjkaša na istočnoj obali Jadrana. Visoki intenzitet ribolova, kao posljedica rastuće potražnje na tržištu, u budućnosti bi mogao dovesti do pretjerane eksploatacije prirodnih populacija u pojedinim područjima. Kada se navedenim činjenicama pridoda i visoka cijena na tržištu, kunjka A. noae se nameće kao moguća nova vrsta u akvakulturu. Nedavno je provedeno nekoliko istraživanja o biologiji i ekologij...


    Župan, Ivan; Rogošić, Jozo; Šarić, Tomislav; Kanski, Danijel


    Kunjka Arca noae Linnaeus, 1758 je jedna od komercijalno važnih vrsta školjkaša u Hrvatskoj koja se izlovljava iz prirodnih staništa. Istražili smo odnos dužina prema spolu, udio spolova i preživljavanje nakon prebačaja iz prirodnog staništa u eksperimentalne uzgojne uvjete. Statistički značajno manje dužine uočene su kod mužjaka (x=52,6±8,7 mm) u odnosu na ženke (x=60,2±9,5 mm). Ukupni udio spolova bio je 1,8 : 1,0 u korist mužjaka. Preživljavanje nakon 17 mjeseci iznosilo je 20,5%. Istraživ...

  6. Are Predators Limiting Zebra Mussel Colonization of Unionid Mussels in Great Lake Coastal Wetlands?

    de Szalay, F. A.; Bowers, R.


    Although many native mollusc populations have been eliminated in the Laurentian Great Lakes by the exotic zebra mussel, recent surveys have found abundant unionid (Bivalvia: Unionidae) populations in some coastal wetlands. Unionid burrowing in soft sediments and predation by fish have been shown to reduce numbers of attached zebra mussels, and we tested these factors in a Lake Erie coastal wetland. In 2002, we held live unionids (Leptodea fragilis, Quadrula quadrula) and Pyganodon grandis shells in exclosures with wire mesh bottoms that were buried to sediment depths of either 5, 10, or 20 cm. After 2 months, numbers of attached dreissenids on unionids were significantly higher inside all exclosure treatments than outside exclosures. This indicated that either unionid burrowing was prevented in all sediment depth treatments or molluscivores were excluded by exclosures. In 2004, we measured dreissenid colonization on Q. quadrula and PVC plates in bottomless exclosures with different mesh sizes. After 6 months, dreissenid numbers on PVC plates and on Q. quadrula in 2.5 cm X 2.5 cm and 5 cm X 10 cm mesh exclosures were significantly higher than in open exclosures. These data suggest that molluscivores are important in limiting dreissenids in Great Lake coastal wetlands.

  7. Computational Graph Model for 3D Cells Tracking in Zebra Fish Datasets

    Zhang, Lelin; Xiong, Hongkai; Zhao, Yang; Zhang, Kai; Zhou, Xiaobo


    This paper leads to a novel technique for tracking and identification of zebra-fish cells in 3D image sequences, extending graph-based multi-objects tracking algorithm to 3D applications. As raised in previous work of 2D graph-based method, separated cells are modeled as vertices that connected by edges. Then the tracking work is simplified to that of vertices matching between graphs generated from consecutive frames. Graph-based tracking is composed of three steps: graph generation, initial source vertices selection and graph saturation. To satisfy demands in this work separated cell records are segmented from original datasets using 3D level-set algorithms. Besides, advancements are achieved in each of the step including graph regulations, multi restrictions on source vertices and enhanced flow quantifications. Those strategies make a good compensation for graph-based multi-objects tracking method in 2D space. Experiments are carried out in 3D datasets sampled from zebra fish, results of which shows that this enhanced method could be potentially applied to tracking of objects with diverse features.

  8. The zebra finch, Taeniopygia guttata: an avian model for investigating the neurobiological basis of vocal learning.

    Mello, Claudio V


    Songbirds are capable of learning their vocalizations by copying a singing adult. This vocal learning ability requires juveniles to hear and memorize the sound of the adult song, and later to imitate it through a process involving sensorimotor integration. Vocal learning is a trait that songbirds share with humans, where it forms the basis of spoken language acquisition, with other avian groups (parrots and hummingbirds), and with a few other mammals (cetaceans, bats). It is however absent in traditional model organisms such as rodents and nonhuman primates. Zebra finches, a songbird species from Australia, are popular pets and are easy to breed. They also sing a relatively simple and stereotyped song that is amenable to quantitative analysis. Zebra finches have thus emerged as a choice model organism for investigating the neurobiological basis of vocal learning. A number of tools and methodologies have been developed to characterize the bioacoustics properties of their song, analyze the degree of accurate copying during vocal learning, map the brain circuits that control singing and song learning, and investigate the physiology of these circuits. Such studies have led to a large base of knowledge on song production and learning, and their underlying neural substrate. Several molecular resources have recently become available, including brain cDNA/EST databases, microarrays, BAC libraries, a molecular brain atlas, a complete genome assembly, and the ability to perform transgenesis. The recent availability of many other avian genomes provides unique opportunities for comparative analysis in the search for features unique to vocal learning organisms. PMID:25342070

  9. Juvenile zebra finches learn the underlying structural regularities of their fathers’ song

    Otilia eMenyhart


    Full Text Available Natural behaviors, such as foraging, tool use, social interaction, birdsong, and language, exhibit branching sequential structure. Such structure should be learnable if it can be inferred from the statistics of early experience. We report that juvenile zebra finches learn such sequential structure in song. Song learning in finches has been extensively studied, and it is generally believed that young males acquire song by imitating tutors (Zann, 1996. Variability in the order of elements in an individual’s mature song occurs, but the degree to which variation in a zebra finch’s song follows statistical regularities has not been quantified, as it has typically been dismissed as production error (Sturdy et al., 1999. Allowing for the possibility that such variation in song is non-random and learnable, we applied a novel analytical approach, based on graph-structured finite-state grammars, to each individual’s full corpus of renditions of songs. This method does not assume syllable-level correspondence between individuals. We find that song variation can be described by probabilistic finite-state graph grammars that are individually distinct, and that the graphs of juveniles are more similar to those of their fathers than to those of other adult males. This grammatical learning is a new parallel between birdsong and language. Our method can be applied across species and contexts to analyze complex variable learned behaviors, as distinct as foraging, tool use, and language.

  10. Budgerigars and zebra finches differ in how they generalize in an artificial grammar learning experiment.

    Spierings, Michelle J; Ten Cate, Carel


    The ability to abstract a regularity that underlies strings of sounds is a core mechanism of the language faculty but might not be specific to language learning or even to humans. It is unclear whether and to what extent nonhuman animals possess the ability to abstract regularities defining the relation among arbitrary auditory items in a string and to generalize this abstraction to strings of acoustically novel items. In this study we tested these abilities in a songbird (zebra finch) and a parrot species (budgerigar). Subjects were trained in a go/no-go design to discriminate between two sets of sound strings arranged in an XYX or an XXY structure. After this discrimination was acquired, each subject was tested with test strings that were structurally identical to the training strings but consisted of either new combinations of known elements or of novel elements belonging to other element categories. Both species learned to discriminate between the two stimulus sets. However, their responses to the test strings were strikingly different. Zebra finches categorized test stimuli with previously heard elements by the ordinal position that these elements occupied in the training strings, independent of string structure. In contrast, the budgerigars categorized both novel combinations of familiar elements as well as strings consisting of novel element types by their underlying structure. They thus abstracted the relation among items in the XYX and XXY structures, an ability similar to that shown by human infants and indicating a level of abstraction comparable to analogical reasoning. PMID:27325756