Energy Technology Data Exchange (ETDEWEB)
Borja, Marco Antonio; Parkman Cuellar, Pablo A [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1987-12-31
Wind is an inexhaustible energy source. To study its behavior in order to develop research projects and apply new technologies connected to its maximum development is one of the activities carried on at the Instituto de Investigaciones Electricas (IIE). As a part of such activities, the equipment Anemodata-1-IIE was designed and built for the wind velocity and direction data acquisition. The Anemodata-1-IIE is the result of the work that the Departamento de Fuentes no Convencionales (Non-Conventional Energy Sources of the Energy Sources Department) carries on regarding the development of electric equipment for the anemometry. [Espanol] Una fuente inagotable de energia es el viento. Estudiar su comportamiento para desarrollar proyectos de investigacion y aplicar nuevas tecnologias vinculadas con su maximo aprovechamiento es una de las actividades que se realizan en el Instituto de Investigaciones Electricas (IIE). Como parte de dichas actividades, se diseno y construyo el equipo Anemodata-1-IIE para la adquisicion de datos de velocidad y direccion del viento. El anemodata-1-IIE es un resultado de los trabajos que el Departamento de Fuentes no Convencionales, de la division de Fuentes de Energia, lleva a cabo en torno al desarrollo de equipo electrico para anemometria.
Energy Technology Data Exchange (ETDEWEB)
Borja, Marco Antonio; Parkman Cuellar, Pablo A. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1986-12-31
Wind is an inexhaustible energy source. To study its behavior in order to develop research projects and apply new technologies connected to its maximum development is one of the activities carried on at the Instituto de Investigaciones Electricas (IIE). As a part of such activities, the equipment Anemodata-1-IIE was designed and built for the wind velocity and direction data acquisition. The Anemodata-1-IIE is the result of the work that the Departamento de Fuentes no Convencionales (Non-Conventional Energy Sources of the Energy Sources Department) carries on regarding the development of electric equipment for the anemometry. [Espanol] Una fuente inagotable de energia es el viento. Estudiar su comportamiento para desarrollar proyectos de investigacion y aplicar nuevas tecnologias vinculadas con su maximo aprovechamiento es una de las actividades que se realizan en el Instituto de Investigaciones Electricas (IIE). Como parte de dichas actividades, se diseno y construyo el equipo Anemodata-1-IIE para la adquisicion de datos de velocidad y direccion del viento. El anemodata-1-IIE es un resultado de los trabajos que el Departamento de Fuentes no Convencionales, de la division de Fuentes de Energia, lleva a cabo en torno al desarrollo de equipo electrico para anemometria.
Pyridine induction of cytochrome P450IIE1: Evidence for enhanced protein synthesis
International Nuclear Information System (INIS)
Kim, S.G.; Novak, R.F.
1990-01-01
The dose-, and time-dependent induction of P450IIE1 in the rat by pyridine (PY) has been characterized. A single injection of PY (100 mg/kg, i.p.) increased as the levels of IIE1 2-, 3- and 4-fold at 6, 10 and 24 hr, respectively, relative to controls based on p-nitrophenol hydroxylase activity and Western blot analysis. Induction of IIE1 was dose-dependent over the range 10 to 200 mg/kg. Cycloheximide administration completely prevented the induction of IIE1 by PY, while actinomycin D failed to affect PY induction of IIE1. The rate of IIE1 synthesis was examined by labelling of proteins with [ 14 C] leucine in vivo, followed by SDS-PAGE and autoradiographic analysis of isolated microsomes. Enhanced intensity of the IIE1 band was observed in microsomes isolated from rats treated with either PY or acetone relative to untreated rats. Slot and Northern blot analyses were employed to assess IIE1 mRNA levels in total RNA and poly(A + ) mRNA isolated from livers of rats at 1, 5 and 12 hr following a single dose of PY. No increase in IIE1 mRNA in total RNA was monitored. A time-dependent decrease in IIE1 poly(A + ) mRNA however, was observed with the maximal decrease occurring at ∼12 hr. These results suggest that induction of IIE1 by PY does not involve transcriptional activation but occurs by protein synthesis possibly through increased translational efficiency
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas in Mexico, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the ETDE Energy database. [Espanol] El Boletin IIE es producido en Mexico por el Instituto de Investigaciones Electricas. Este se publica 6 veces al ano. Se han preparado citas y resumenes para articulos individuales dentro del alcance de la base de datos Energy del ETDE.
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas in Mexico, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the ETDE Energy database. [Espanol] El Boletin IIE es producido en Mexico por el Instituto de Investigaciones Electricas. Este se publica 6 veces al ano. Se han preparado citas y resumenes para articulos individuales dentro del alcance de la base de datos Energy del ETDE.
IIE`s wind tunnel calibration; Calibracion del tunel de viento del IIE
Energy Technology Data Exchange (ETDEWEB)
Pena Garcia, Raymundo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1986-12-31
The calibration of a wind tunnel is performed in such a way as to warrant a very low turbulence grade. When there is recently built tunnel, as is the case of the IIE`s tunnel, the turbulence in its testing chambers is large; for this reason it is necessary to integrate in it aerodynamic devices and elements capable of reducing it. At the end of the calibration studies can be performed in models with controlled scale. From these and from the results obtained it will be decided if the designed prototypes are built or modified. [Espanol] La calibracion de un tunel de viento se realiza de tal forma que garantiza un grado de turbulencia muy bajo. Cuando se tiene un tunel recien construido, como es el caso del tunel de viento del IIE, la turbulencia en sus camaras de prueba es grande; por lo que es necesario integrarle dispositivos y elementos aerodinamicos que sean capaces de reducirla. Al terminar la calibracion pueden realizarse estudios en modelos con escala controlada. De estos y de los resultados que se obtengan se decidira si se construyen o se modifican los prototipos disenados.
IIE`s wind tunnel calibration; Calibracion del tunel de viento del IIE
Energy Technology Data Exchange (ETDEWEB)
Pena Garcia, Raymundo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1985-12-31
The calibration of a wind tunnel is performed in such a way as to warrant a very low turbulence grade. When there is recently built tunnel, as is the case of the IIE`s tunnel, the turbulence in its testing chambers is large; for this reason it is necessary to integrate in it aerodynamic devices and elements capable of reducing it. At the end of the calibration studies can be performed in models with controlled scale. From these and from the results obtained it will be decided if the designed prototypes are built or modified. [Espanol] La calibracion de un tunel de viento se realiza de tal forma que garantiza un grado de turbulencia muy bajo. Cuando se tiene un tunel recien construido, como es el caso del tunel de viento del IIE, la turbulencia en sus camaras de prueba es grande; por lo que es necesario integrarle dispositivos y elementos aerodinamicos que sean capaces de reducirla. Al terminar la calibracion pueden realizarse estudios en modelos con escala controlada. De estos y de los resultados que se obtengan se decidira si se construyen o se modifican los prototipos disenados.
Qiu, Y H; Xu, Y L; Zhang, W H
2016-06-03
We investigate the role of the GSTM1, GSTT1, and GSTP1 IIe105Val genetic polymorphisms in the susceptibility to gestational diabetes mellitus. A total of 223 pregnant women with gestational diabetes mellitus and 265 healthy pregnant women were examined at The Second Affiliated Hospital of Shaanxi University of Chinese Medicine from May 2013 to November 2013. Genotyping for detection of GSTM1, GSTT1, and GSTP1 IIe105Val polymorphisms was conducted using the restriction fragment length polymorphism-polymerase chain reaction. There were statistically significant differences between patients with gestational diabetes mellitus and control subjects in terms of age (χ(2) = 6.68, P = 0.01) and BMI (t = 7.56, P gestational diabetes mellitus compared to the present genotype [adjusted OR (95%CI) = 1.85 (1.26-2.72)]. However, the unconditional logistic analysis revealed that GSTT1 and GSTP1 IIe105Val polymorphisms could not influence the risk of gestational diabetes mellitus in a Chinese population. In summary, we suggest that the GSTM1 gene polymorphism could influence the susceptibility to gestational diabetes mellitus in a Chinese population.
IIE Bulletin: selected articles from 1993 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1989 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1990-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1990 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1991-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1993 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1992 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1995 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1989 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1989-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1985 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1986-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1986 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1987-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1987 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1988-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1997 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1996 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1991 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1991-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1997 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1996 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1990 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1990-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1987 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1987-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1992 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1992-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1986 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1986-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1995 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1991 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1992-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1988 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1988-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1985 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1985-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
IIE Bulletin: selected articles from 1994 issues of ``boletin iie``
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
Boletin IIE, produced by the Instituto de Investigaciones Electricas, is issued six times a year. Separate citations and abstracts have been prepared for individual articles in scope for the database.
Directory of Open Access Journals (Sweden)
Binhai Ren
2016-04-01
Full Text Available Due to the limitations of current treatment regimes, gene therapy is a promising strategy being explored to correct blood glucose concentrations in diabetic patients. In the current study, we used a retroviral vector to deliver either the human insulin gene alone, the rat NeuroD1 gene alone, or the human insulin gene and rat NeuroD1 genes together, to the rat liver cell line, H4IIE, to determine if storage of insulin and pancreatic transdifferentiation occurred. Stable clones were selected and expanded into cell lines: H4IIEins (insulin gene alone, H4IIE/ND (NeuroD1 gene alone, and H4IIEins/ND (insulin and NeuroD1 genes. The H4IIEins cells did not store insulin; however, H4IIE/ND and H4IIEins/ND cells stored 65.5 ± 5.6 and 1475.4 ± 171.8 pmol/insulin/5 × 106 cells, respectively. Additionally, several β cell transcription factors and pancreatic hormones were expressed in both H4IIE/ND and H4IIEins/ND cells. Electron microscopy revealed insulin storage vesicles in the H4IIE/ND and H4IIEins/ND cell lines. Regulated secretion of insulin to glucose (0–20 mmol/L was seen in the H4IIEins/ND cell line. The H4IIEins/ND cells were transplanted into diabetic immunoincompetent mice, resulting in normalization of blood glucose. This data shows that the expression of NeuroD1 and insulin in liver cells may be a useful strategy for inducing islet neogenesis and reversing diabetes.
Morphogenic Protein RodZ Interacts with Sporulation Specific SpoIIE in Bacillus subtilis.
Muchová, Katarína; Chromiková, Zuzana; Bradshaw, Niels; Wilkinson, Anthony J; Barák, Imrich
2016-01-01
The first landmark in sporulation of Bacillus subtilis is the formation of an asymmetric septum followed by selective activation of the transcription factor σF in the resulting smaller cell. How the morphological transformations that occur during sporulation are coupled to cell-specific activation of transcription is largely unknown. The membrane protein SpoIIE is a constituent of the asymmetric sporulation septum and is a crucial determinant of σF activation. Here we report that the morphogenic protein, RodZ, which is essential for cell shape determination, is additionally required for asymmetric septum formation and sporulation. In cells depleted of RodZ, formation of asymmetric septa is disturbed and σF activation is perturbed. During sporulation, we found that SpoIIE recruits RodZ to the asymmetric septum. Moreover, we detected a direct interaction between SpoIIE and RodZ in vitro and in vivo, indicating that SpoIIE-RodZ may form a complex to coordinate asymmetric septum formation and σF activation. We propose that RodZ could provide a link between the cell shape machinery and the coordinated morphological and developmental transitions required to form a resistant spore.
I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites
International Nuclear Information System (INIS)
Niemeyer, S.
1980-01-01
Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40 Ar- 39 Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40 Ar at low temperature, and the well defined 40 Ar- 39 Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's ( 129 Xe/ 132 Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40 Ar- 39 Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)
Directory of Open Access Journals (Sweden)
Burgoon Lyle D
2011-04-01
Full Text Available Abstract Background 2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD is an environmental contaminant that elicits a broad spectrum of toxic effects in a species-specific manner. Current risk assessment practices routinely extrapolate results from in vivo and in vitro rodent models to assess human risk. In order to further investigate the species-specific responses elicited by TCDD, temporal gene expression responses in human HepG2, mouse Hepa1c1c7 and rat H4IIE cells were compared. Results Microarray analysis identified a core set of conserved gene expression responses across species consistent with the role of AhR in mediating adaptive metabolic responses. However, significant species-specific as well as species-divergent responses were identified. Computational analysis of the regulatory regions of species-specific and -divergent responses suggests that dioxin response elements (DREs are involved. These results are consistent with in vivo rat vs. mouse species-specific differential gene expression, and more comprehensive comparative DRE searches. Conclusions Comparative analysis of human HepG2, mouse Hepa1c1c7 and rat H4IIE TCDD-elicited gene expression responses is consistent with in vivo rat-mouse comparative gene expression studies, and more comprehensive comparative DRE searches, suggesting that AhR-mediated gene expression is species-specific.
Watson: A new link in the IIE iron chain
Olsen, Edward; Davis, Andrew; Clarke, Roy S., Jr.; Schultz, Ludolf; Weber, Hartwig W.; Clayton, Robert; Mayeda, Toshiko; Jarosewich, Eugene; Sylvester, Paul; Grossman, Lawrence
1994-01-01
Watson, which was found in 1972 in South Australia, contains the largest single silicate rock mass seen in any known iron meteorite. A comprehensive study has been completed on this unusual meteorite: petrography, metallography, analyses of the silicate inclusion (whole rock chemical analysis, INAA, RNAA, noble gases, and oxygen isotope analysis) and mineral compositions (by electron microprobe and ion microprobe). The whole rock has a composition of an H-chondrite minus the normal H-group metal and troilite content. The oxygen isotope composition is that of the silicates in the IIE iron meteorites and lies along an oxygen isotope fractionation line with the H-group chondrites. Trace elements in the metal confirm Watson is a new IIE iron. Whole rock Watson silicate shows an enrichment in K and P (each approximately 2X H-chondrites). The silicate inclusion has a highly equilibrated igneous (peridotite-like) texture with olivine largely poikilitic within low-Ca pyroxene: olivine (Fa20), opx (Fs17Wo3), capx (Fs9Wo14)(with very fine exsolution lamellae), antiperthite feldspar (An1-3Or5) with less than 1 micron exsolution lamellae (An1-3Or greater than 40), shocked feldspar with altered stoichiometry, minor whitlockite (also a poorly characterized interstitial phosphate-rich phase) and chromite, and only traces of metal and troilite. The individual silicate minerals have normal chondritic REE patterns, but whitlockite has a remarkable REE pattern. It is very enriched in light REE (La is 720X C1, and Lu is 90X C1, as opposed to usual chonditic values of approximately 300X and 100-150X, respectively) with a negative Eu anomaly. The enrichment of whole rock K is expressed both in an unusually high mean modal Or content of the feldspar, Or13, and in the presence of antiperthite.
M.Sc José A Betancourt Betancourt.
2005-01-01
ResumenA partir de los registros de 1404 bovinos lecheros de la raza Siboney de 6 empresas ganaderas de la provincia de Camaguey se realizó un análisis estadístico para determinar que variable de las estudiadas influyeron sobre el intervalo interestral (IIE). Se determinó que todos los factores que influyeron sobre el IIE pueden ser corregidos con acciones de manejo y organización del trabajo, y corrobora que el IIE es un valioso elemento diagnóstico de la fertilidad del rebaño bovino que ref...
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
The document contains two papers within INIS subject scope which were presented at the 8th Seminar of the IMP-IIE-ININ on technological specialties. Topic 10: Earth Sciences. A separate abstract was prepared for each paper.
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The document includes 10 papers presented at the 7. Seminar of the IIE-IMP-ININ (Mexico) on technological specialities in the field of information services (Topic 10). Three items were in INIS subject scope and a separate abstract was prepared for each of them.
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
With the purpose to give continuity to the exchange of experiences and to impel the development of common specialties among IIE-ININ-IMP, the VII Seminary was held in Mexico City on September 7, 1994. In the event were present 163 researchers of the three participant Institutions as well as representative persons of invited institutions. The objective of this Seminary was to relate the researchers of a common branch, with the idea that the specialists made an exchange of experiences, in order to establish cooperation routes. The event was arranged in 11 working tables, with a total of 111 papers: 43 of these papers were from IIE, 42 from IMP, 22 from ININ and 4 from invited entities. During the Seminary, the 11 working tables has sessions simultaneously, and each one of the papers were discussed at the time that possible future cooperating inter institutional actions were examined. The conclusions of the Seminary were exposed in a plenary session, in the presence of the directing boards of the three participant Institutions.
6. Seminar of the IIE-ININ-IMP on technological specialties. Topic 4: dynamics
International Nuclear Information System (INIS)
1992-01-01
The document includes 7 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of dynamics. (Topic 4). One item was in INIS subject scope and a separate abstract was prepared for it
6. Seminar of the IIE-ININ-IMP on technological specialties. Topic 8: computation
International Nuclear Information System (INIS)
1992-01-01
The document includes 10 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of computation. (Topic 8). Three items were in INIS subject scope and a separate abstract was prepared for each of them
8. Seminar of the IMP-IIE-ININ on technological specialties. Topic 10: Earth Sciences
International Nuclear Information System (INIS)
1996-01-01
The document contains two papers within INIS subject scope which were presented at the 8th Seminar of the IMP-IIE-ININ on technological specialties. Topic 10: Earth Sciences. A separate abstract was prepared for each paper
Joint international conference ICIEOM-CIO-IIE 2015
Ferreira, Carlos; Junior, Milton; Prado, Carlos
2017-01-01
This book gathers a selection of the best papers presented at the joint international conference ICIEOM-CIO-IIE 2015, offering recent research on industrial engineering, management and operations from an international and interdisciplinary perspective. It includes contributions from different fields, such as operations research, modeling and simulation, production and service management and logistics, information systems and quality, and as such is of interest to both researchers and practitioners. Reflecting the interconnected nature of today’s production systems, characterized by intense flows of goods, information and individuals between companies and nations, it is a valuable resource for anyone wanting an in-depth understanding of the field to guide managerial practice in order to take full advantage of existing opportunities.
6. Seminar of the IIE-ININ-IMP on technological specialties. Topic 7: energy savings
International Nuclear Information System (INIS)
1992-01-01
The document includes 6 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of energy savings. (Topic 7). One item was in INIS subject scope and a separate abstract was prepared for it
International Nuclear Information System (INIS)
Serkiz, A.W.
1988-04-01
This report contains the technical findings and regulatory analysis for Generic Safety Issue II.E.4.3, ''Containment Integrity Check.'' An evaluation of the containment isolation history from 1965 to 1983 reveals that (except for a small number of events) containment integrity has been maintained and that the majority of reported events have been events related to exceeding Technical Specification limits (or 0.6 of the allowable leakage level). In addition, more recent risk analyses have shown that allowable leakage rates even if increased by a factor of 10 would not significantly increase risk. Potential methods of continuous monitoring are identified and evaluated. Therefore, these technical findings and risk evaluations support closure of Generic Safety Issue II.E.4.3
7. Seminar of the IIE-ININ-IMP on technological specialties. Topic 10: Information Services
International Nuclear Information System (INIS)
1994-01-01
The document includes 10 papers presented at the 7. Seminar of the IIE-IMP-ININ (Mexico) on technological specialities in the field of information services (Topic 10). Three items were in INIS subject scope and a separate abstract was prepared for each of them
6. Seminar of the IIE-ININ-IMP on technological specialties. Topic 13: earth sciences
International Nuclear Information System (INIS)
1992-01-01
The document includes 12 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of earth sciences. (Topic 13). Four items were in INIS subject scope and a separate abstract was prepared for each of them
6. Seminar of the IIE-ININ-IMP on technological specialties. Topic 3: thermal fluids
International Nuclear Information System (INIS)
1992-01-01
The document includes 10 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of thermal fluids. (Topic 3). From these, 4 papers were in INIS subject scope and a separate abstract was prepared for each of them
6. Seminar of the IIE-ININ-IMP on technological specialties. Topic 6: environmental contamination
International Nuclear Information System (INIS)
1992-01-01
The document includes 10 papers presented at the 6. Seminar of the IIE-ININ-IMP on technological specialities in the field of environmental contamination (Topic 6). From these, 6 papers were in INIS subject scope and a separate abstract was prepared for each of these papers
8. Seminar of the IMP-IIE-ININ on technological specialties. Topic 9: Analytical Chemistry
International Nuclear Information System (INIS)
1996-01-01
The document includes four papers considered within the INIS subject scope, which were presented at the 8th Seminar of the IMP-IIE-ININ on technological specialities (Section Analytical Chemistry), held on 26 June 1996 in Cuernavaca (Mexico). A separate abstract and indexing were provided for each paper
Directory of Open Access Journals (Sweden)
Lei Wang
2014-08-01
Full Text Available Mogroside IIE is a bitter triterpenoid saponin which is the main component of unripe Luo Han Guo fruit and a precursor of the commercially available sweetener mogroside V. In this study, we developed an enzymatic glycosyl transfer method, by which bitter mogroside IIE could be converted into a sweet triterpenoid saponin mixture. The reactant concentration, temperature, pH and buffer system were studied. New saponins with the α-glucose group were isolated from the resulting mixtures, and the structures of three components of the extract were determined. The structure-taste relationships of these derivatives were also studied together with those of the natural mogrosides. The number and stereoconfiguration of glucose groups present in the mogroside molecules were found to be the main factor to determine the sweet or bitter taste of a compound. The antioxidant and food safety properties were initially evaluated by their radical scavenging ability and via 7 day mice survival tests, respectively. The results showed that the sweet triterpenoid saponin mixture has the same favorable physiological and safety characteristics as the natural mogrosides.
7. Seminar of the IIE-IMP-ININ on technological specialities. Topic 8: Analytical Chemistry
International Nuclear Information System (INIS)
1994-01-01
With the purpose to give continuity to the exchange of experiences and to impel the development of common specialties among IIE-ININ-IMP, the VII Seminary was held in Mexico City on September 7, 1994. In the event were present 163 researchers of the three participant Institutions as well as representative persons of invited institutions. The objective of this Seminary was to relate the researchers of a common branch, with the idea that the specialists made an exchange of experiences, in order to establish cooperation routes. The event was arranged in 11 working tables, with a total of 111 papers: 43 of these papers were from IIE, 42 from IMP, 22 from ININ and 4 from invited entities. During the Seminary, the 11 working tables has sessions simultaneously, and each one of the papers were discussed at the time that possible future cooperating inter institutional actions were examined. The conclusions of the Seminary were exposed in a plenary session, in the presence of the directing boards of the three participant Institutions
Energy Technology Data Exchange (ETDEWEB)
Ramos Berumen, Carlos; Ramirez Benitez, Juan Rafael; Beltran Adan, Jose [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: cramos@iie.org.mx; rramirez@iie.org.mx; jose.beltran@iie.org.mx
2010-11-15
The transformation industry normally uses thermal energy within its process, it obtains this energy burning fossils fuel, a new option is to use new technologies like the thermal solar technology like the parabolic trough, this is a long parabolic mirror used to reflect the sunlight and focused on an absorber tube with a heat-conducting fluid inside. The Instituto de Investigaciones Electricas (IIE) developed a prototype of parabolic trough that is operating in different industries, in this article are showing some improvements to the design, giving like result the second generation of the prototype of parabolic trough of the IIE. [Spanish] La industria de la transformacion normalmente utiliza energia termica dentro de su proceso, los medios convencionales para obtener esta energia es el quemar combustibles fosiles, una opcion que aplica nuevas tecnologias es el uso de la tecnologia termosolar a concentracion que le permitira a la industria utilizar el sol como fuente de energia primaria. El uso de esta tecnologia permitira a las empresas generar calor de proceso sin contaminar el ambiente, lo que dara como resultado empresas competitivas y autosuficientes. Para alcanzar temperaturas utiles a estas aplicaciones se requiere concentrar la energia solar en un area mas pequena, siendo la tecnologia mas extendida la de canal parabolico, el principio de operacion de esta tecnologia es la de concentrar la radiacion solar en el eje receptor preparado con una pintura especial para una mejor absorcion del calor y una cubierta de vidrio para evitar perdidas termicas, dentro del tubo circula un fluido caloportador el cual lleva el calor util hacia el proceso. El Instituto de Investigaciones Electricas (IIE) desarrollo un prototipo de canal parabolico, actualmente estan operando en diferentes industrias, resultado de estas aplicaciones se llevo a cabo una evaluacion del prototipo, se detectaron algunos puntos de mejoras al diseno, los cuales se exponen en este articulo, dando
International Nuclear Information System (INIS)
1992-01-01
The document includes 9 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of commercialization and technology transfer. (Topic 15). One item was in INIS s ubject scope and a separate abstract was prepared for it
Fletcher, Richard K., Jr.
This description of procedures for dumping high and low resolution graphics using the Apple IIe microcomputer system focuses on two special hardware configurations that are commonly used in schools--the Apple Dot Matrix Printer with the Apple Parallel Interface Card, and the Imagewriter Printer with the Apple Super Serial Interface Card. Special…
International Nuclear Information System (INIS)
1992-01-01
The document includes 10 papers presented at the 6. Seminar of the IIE-ININ-IMP on technological specialities in the field of electronics, instrumentation and control. (Topic 9). From these, 4 papers were in INIS subject scope and a separate abstract was prepared for each of them
International Nuclear Information System (INIS)
1992-01-01
The document includes 9 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of information systems and services. (Topic 14). Two items were in INIS subject scope and a separate abstract was prepared for each of them
International Nuclear Information System (INIS)
1992-01-01
The document includes 8 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of standards and quality assurance. (Topic 11). From these, 2 papers were in INIS subject scope and a separate abstract was prepared for each of them
International Nuclear Information System (INIS)
1992-01-01
The document includes 7 papers presented at the 6. Seminar of the IIE-ININ-IMP (Mexico) on technological specialties in the field of industrial applications of radiation and control. (Topic 10). A separate abstract was prepared for each paper
Upgradation of an Apple IIe based DC arc atomic emission spectrometer to a PC based system
International Nuclear Information System (INIS)
Sampathkumar, R.; Ravindranath, S.V.G.; Patil, P.B.; Deshpande, S.S.; Saha, T.K.; Handu, V.K.
2004-01-01
The analysis of Uranium metal and its compounds used as reactor fuel for the presence of impurities especially Cd and B which have a high neutron capture cross section is routinely performed in Spectroscopy Division. The DC Arc Atomic Emission Spectrometer in the Division was employing an Apple IIe computer for performing the control and data acquisition jobs. The system was upgraded to a PC based data acquisition system and the necessary software to perform the spectro chemical analysis has been developed. This becomes necessary in a scenario where the commercially available Atomic Emission Spectrometers are no longer equipped with DC arc source. Also the Apple IIe computer which was performing the control and data acquisition has gone obsolete and its spares are no longer available. Therefore, to derive the benefits of using DC arc as excitation source the system was upgraded to a PC based system. This paper describes the upgraded system and the various software features relating to the mode of data acquisition, method of analysis, data processing etc. implemented as required by the analysts. (author)
Schlenker, Richard M.
This manual is a "how to" training device for developing inventory records in the AppleWorks program using an Apple IIe or Apple IIGS Computer with Duodisk or two disk drives and an 80-column card. The manual provides step-by-step directions, and includes 17 figures depicting the computer screen at the various stages of the inventory…
Operational performance of the Avispa-IIE wind generator in microhybrid systems
Energy Technology Data Exchange (ETDEWEB)
Gonzalez Galarza, Raul; Mejia Neri, Fortino [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1997-12-31
The purpose of this paper is to make a general analysis over the operational performance of the Avispa-IIE wind generator in an Solar-Eolic hybrid installation, at an eco-tourist resort. This work was performed through the monitor of the wind generator and the system itself throughout a year, for the acquisition taking the variables of interest and operational parameters that might allow to characterize and to evaluate the general behavior of the system. Herein are the principals characteristics of the wind generator; its performance curve, the basic configuration of the installation and the control philosophy; Likewise, some technical and human problems which arise during the operation of the system are included, the implementation of improvements in the wind generator and the general results acquired during the time of operation of the wind generator in the cited installations. [Espanol] El proposito de este articulo es el hacer un analisis general del comportamiento operacional del aerogenerador Avispa-IIE en una instalacion hibrida Solar-Eolica en un lugar de veraneo eco-turistico. Este trabajo ha sido llevado a cabo mediante el monitor del aerogenerador y el sistema mismo por espacio de un ano, para la adquisicion de las variables de interes y de los parametros operacionales que pudieran servir para caracterizar y evaluar el comportamiento general del sistema. Aqui se incluyen las caracteristicas principales del aerogenerador; su curva de comportamiento, la configuracion basica de la instalacion y la filosofia del control. De la misma manera se incluyen algunos problemas tecnicos y humanos que se originan durante la operacion del sistema y la puesta en practica de las mejoras del aerogenerador y los resultados generales adquiridos durante el tiempo de operacion del aerogenerador en las instalaciones citadas.
Operational performance of the Avispa-IIE wind generator in microhybrid systems
Energy Technology Data Exchange (ETDEWEB)
Gonzalez Galarza, Raul; Mejia Neri, Fortino [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1998-12-31
The purpose of this paper is to make a general analysis over the operational performance of the Avispa-IIE wind generator in an Solar-Eolic hybrid installation, at an eco-tourist resort. This work was performed through the monitor of the wind generator and the system itself throughout a year, for the acquisition taking the variables of interest and operational parameters that might allow to characterize and to evaluate the general behavior of the system. Herein are the principals characteristics of the wind generator; its performance curve, the basic configuration of the installation and the control philosophy; Likewise, some technical and human problems which arise during the operation of the system are included, the implementation of improvements in the wind generator and the general results acquired during the time of operation of the wind generator in the cited installations. [Espanol] El proposito de este articulo es el hacer un analisis general del comportamiento operacional del aerogenerador Avispa-IIE en una instalacion hibrida Solar-Eolica en un lugar de veraneo eco-turistico. Este trabajo ha sido llevado a cabo mediante el monitor del aerogenerador y el sistema mismo por espacio de un ano, para la adquisicion de las variables de interes y de los parametros operacionales que pudieran servir para caracterizar y evaluar el comportamiento general del sistema. Aqui se incluyen las caracteristicas principales del aerogenerador; su curva de comportamiento, la configuracion basica de la instalacion y la filosofia del control. De la misma manera se incluyen algunos problemas tecnicos y humanos que se originan durante la operacion del sistema y la puesta en practica de las mejoras del aerogenerador y los resultados generales adquiridos durante el tiempo de operacion del aerogenerador en las instalaciones citadas.
Schlenker, Richard M.
This manual is a "how to" training device for building database files using the AppleWorks program with an Apple IIe or Apple IIGS Computer with Duodisk or two disk drives and an 80-column card. The manual provides step-by-step directions, and includes 25 figures depicting the computer screen at the various stages of the database file…
46 CFR 63.25-1 - Small automatic auxiliary boilers.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Small automatic auxiliary boilers. 63.25-1 Section 63.25... AUXILIARY BOILERS Requirements for Specific Types of Automatic Auxiliary Boilers § 63.25-1 Small automatic auxiliary boilers. Small automatic auxiliary boilers defined as having heat-input ratings of 400,000 Btu/hr...
Energy Technology Data Exchange (ETDEWEB)
Arvizu Fernandez, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1996-12-31
The waste water treatment plant of the Instituto de Investigaciones Electricas (IIE) is analyzed. This plant originally was a plant of the activated sludge type (aerobic development), process that consumes large amounts of energy and that produces residual sludge 5 or 6 times greater than the anaerobic processes. The methodology and the techniques utilized were base in the analysis of the existing plant introducing an anaerobic treatment and performing laboratory experimentation. The plant design parameters considered are described. The results show the benefits of treating by anaerobic means the waste waters since depuration are obtained on the order of 75%, as well as the reduction of resulting residual sludge and in energy consumption. A reduction of 60% to 70% can be attained if a combination of anaerobic and aerobic processes is utilized [Espanol] Se analiza la planta de tratamiento de aguas residuales del Instituto de Investigaciones Electricas (IIE). Esta planta era originalmente una planta de lodos activados (desarrollo aerobio), proceso que consume mucha energia y genera lodos residuales de 5 a 6 veces mas que los procesos anaerobios. La metodologia y las tecnicas utilizadas se basaron en el analisis de la planta de tratamiento existente en el IIE; en la caracterizacion residual del IIE; en la modificacion de la planta de tratamiento introduciendo un tratamiento anaerobio y efectuando experimentacion en laboratorio. Se describen los parametros de diseno de la planta considerados. Los resultados muestran los beneficios de tratar por medios anaerobios las aguas residuales ya que se obtienen depuraciones del orden del 75%, asi como la reduccion de lodos residuales resultantes y el consumo de energia, pueden reducirse de un 60% a un 70% si se utiliza la combinacion de los procesos anaerobios y aerobios
Energy Technology Data Exchange (ETDEWEB)
Arvizu Fernandez, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1997-12-31
The waste water treatment plant of the Instituto de Investigaciones Electricas (IIE) is analyzed. This plant originally was a plant of the activated sludge type (aerobic development), process that consumes large amounts of energy and that produces residual sludge 5 or 6 times greater than the anaerobic processes. The methodology and the techniques utilized were base in the analysis of the existing plant introducing an anaerobic treatment and performing laboratory experimentation. The plant design parameters considered are described. The results show the benefits of treating by anaerobic means the waste waters since depuration are obtained on the order of 75%, as well as the reduction of resulting residual sludge and in energy consumption. A reduction of 60% to 70% can be attained if a combination of anaerobic and aerobic processes is utilized [Espanol] Se analiza la planta de tratamiento de aguas residuales del Instituto de Investigaciones Electricas (IIE). Esta planta era originalmente una planta de lodos activados (desarrollo aerobio), proceso que consume mucha energia y genera lodos residuales de 5 a 6 veces mas que los procesos anaerobios. La metodologia y las tecnicas utilizadas se basaron en el analisis de la planta de tratamiento existente en el IIE; en la caracterizacion residual del IIE; en la modificacion de la planta de tratamiento introduciendo un tratamiento anaerobio y efectuando experimentacion en laboratorio. Se describen los parametros de diseno de la planta considerados. Los resultados muestran los beneficios de tratar por medios anaerobios las aguas residuales ya que se obtienen depuraciones del orden del 75%, asi como la reduccion de lodos residuales resultantes y el consumo de energia, pueden reducirse de un 60% a un 70% si se utiliza la combinacion de los procesos anaerobios y aerobios
Energy Technology Data Exchange (ETDEWEB)
Chan, Janet Kit Yan [Croucher Institute for Environmental Sciences, and Department of Biology, Hong Kong Baptist University, Hong Kong SAR (China); School of Biological Sciences, The University of Hong Kong, Kadoorie Biological Sciences Building, Pokfulam, Hong Kong (China); Man, Yu Bon [Croucher Institute for Environmental Sciences, and Department of Biology, Hong Kong Baptist University, Hong Kong SAR (China); Xing, Guan Hua [Croucher Institute for Environmental Sciences, and Department of Biology, Hong Kong Baptist University, Hong Kong SAR (China); China National Environmental Monitoring Center, 100012, Beijing (China); Wu, Sheng Chun [Croucher Institute for Environmental Sciences, and Department of Biology, Hong Kong Baptist University, Hong Kong SAR (China); State Key Laboratory in Marine Pollution, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Murphy, Margaret B. [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China); Xu, Ying [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, 430072, Wuhan, Hubei Province (China); Wong, Ming H., E-mail: mhwong@hkbu.edu.hk [Croucher Institute for Environmental Sciences, and Department of Biology, Hong Kong Baptist University, Hong Kong SAR (China)
2013-10-01
Dietary exposure to polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) via fish consumption in two major electronic (e) waste sites: Guiyu (GY), Guangdong Province and Taizhou (TZ), Zhejiang Province, and dioxin-like activity in fish determined by H4IIE-luc bioassay. In the present study, all fish were below EU's maximum allowable concentration in muscle of fish (4 pg WHO-TEQ/g wet wt), except crucian (4.28 pg WHO-TEQ/g wet wt) and silver carps (7.49 pg WHO-TEQ/g wet wt) collected from GY rivers. Moreover, the residual concentration in bighead carp collected from GY (2.15 pg WHO-TEQ/g wet wt) was close to the EU's action level (3 pg WHO-TEQ/g wet wt) which gives “early warning” to the competent authorities and operators to take measures to eliminate contamination. In addition, results indicated that the maximum human intake of PCDD/Fs via freshwater fish consumption in GY was 4.31 pg WHO-TEQ/kg bw/day, which exceeds the higher end of the tolerable daily intake recommended by the WHO, EC-SCF and JECFA (1–4, 2 and 2.3 pg WHO-TEQ/kg bw/day respectively). Furthermore, H4IIE-luc cell bioassay provides a very sensitive and cost-efficient screening tool for assessing the overall dioxin-like toxicity in the study, and is therefore valuable for high-throughput environmental monitoring studies. - Highlights: ► Freshwater fish are contaminated by PCDD/F at 2 e-waste sites in China. ► Guiyu residents are exposed to unsafe levels of PCDD/Fs through dietary exposure. ► H4IIE-luc cell bioassay provides a very sensitive screening tool for PCDD/Fs.
International Nuclear Information System (INIS)
Chan, Janet Kit Yan; Man, Yu Bon; Xing, Guan Hua; Wu, Sheng Chun; Murphy, Margaret B.; Xu, Ying; Wong, Ming H.
2013-01-01
Dietary exposure to polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) via fish consumption in two major electronic (e) waste sites: Guiyu (GY), Guangdong Province and Taizhou (TZ), Zhejiang Province, and dioxin-like activity in fish determined by H4IIE-luc bioassay. In the present study, all fish were below EU's maximum allowable concentration in muscle of fish (4 pg WHO-TEQ/g wet wt), except crucian (4.28 pg WHO-TEQ/g wet wt) and silver carps (7.49 pg WHO-TEQ/g wet wt) collected from GY rivers. Moreover, the residual concentration in bighead carp collected from GY (2.15 pg WHO-TEQ/g wet wt) was close to the EU's action level (3 pg WHO-TEQ/g wet wt) which gives “early warning” to the competent authorities and operators to take measures to eliminate contamination. In addition, results indicated that the maximum human intake of PCDD/Fs via freshwater fish consumption in GY was 4.31 pg WHO-TEQ/kg bw/day, which exceeds the higher end of the tolerable daily intake recommended by the WHO, EC-SCF and JECFA (1–4, 2 and 2.3 pg WHO-TEQ/kg bw/day respectively). Furthermore, H4IIE-luc cell bioassay provides a very sensitive and cost-efficient screening tool for assessing the overall dioxin-like toxicity in the study, and is therefore valuable for high-throughput environmental monitoring studies. - Highlights: ► Freshwater fish are contaminated by PCDD/F at 2 e-waste sites in China. ► Guiyu residents are exposed to unsafe levels of PCDD/Fs through dietary exposure. ► H4IIE-luc cell bioassay provides a very sensitive screening tool for PCDD/Fs
Ke, Q-H; Zhou, S-Q; Du, W; Liang, G; Lei, Y; Luo, F
2014-12-12
On the basis of the benefits of frontline radiation in early-stage, extranodal natural killer (NK)/T-cell lymphoma (ENKTL), we conducted the trial of concurrent chemoradiotherapy (CCRT) followed by three cycles of gemcitabine, dexamethasone and cisplatin (GDP). Thirty-two patients with newly diagnosed, stage IE to IIE, nasal ENKTL received CCRT (that is, all patients received intensity-modulated radiotherapy 56 Gy and cisplatin 30 mg/m(2) weekly, 3-5 weeks). Three cycles of GDP (gemcitabine 1000 mg/m(2) intravenously (i.v.) on days 1 and 8, dexamethasone 40 mg orally on days 1-4 and cisplatin 75 mg/m(2) i.v. on day 1 (GDP), every 21 days as an outpatient were scheduled after CCRT. All patients completed CCRT, which resulted in 100% response that included 24 complete responses (CRs) and eight partial responses. The CR rate after CCRT was 75.0% (that is, 24 of 32 responses). Twenty-eight of the 32 patients completed the planned three cycles of GDP, whereas four patients did not because they withdrew (n = 1) or because they had an infection (n = 3). The overall response rate and the CR rate were 90.6% (that is, 29 of 32 responses) and 84.4% (that is, 27 of 32 responses), respectively. Only two patient experienced grade 3 toxicity during CCRT (nausea), whereas 13 of the 30 patients experienced grade 4 neutropenia. The estimated 3-year overall survival and progression-free rates were 87.50% and 84.38%, respectively. In conclusion, CCRT followed by GDP chemotherapy can be a feasible and effective treatment strategy for stage IE to IIE nasal ENKTL.
Energy Technology Data Exchange (ETDEWEB)
Cano C, Ulises; Arriaga H, Gerardo; Romero C, T; Medrano V, M. Consolacion; Gonzalez, A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)
2005-07-01
In April, 2001, a fuel cells project was initiated at the Instituto de Investigaciones Electricas (IIE) as a part of the interest of this institution for such a technology. Towards end of that same year, a group dedicated to research and development (R and D) activities was implemented and efforts were initiated for the assembly of a laboratory with specialized infrastructure that would support these activities. Thus, in the last two years, the hydrogen and fuel cells group has taken under its responsibility the task of renewing and conditioning a space to receive specialized instrumentation and to initiate its operation, as well as to develop its own knowledge on the technology of fuel cells. The R and D work related to fuel cells was initiated from basic electrochemical studies of platinum electrodes on vitreous coal in acid solutions, to determine kinetic parameters and structural properties. Since the main components of PEM cells to a great extent define the cost of the technology, other additional efforts related to basic studies for the development of components as bipolar plates, are described by the same author in 2001. Other work on basic research is bound to the response of fuel monocells under different operation conditions, and that also will be reviewed in this article. [Spanish] En abril del 2001, se inicio un proyecto de celdas de combustible en el IIE como parte del interes de esta institucion por tal tecnologia. Hacia finales de ese mismo ano, se conformo un grupo dedicado a actividades de investigacion y desarrollo (I y D) y se iniciaron esfuerzos para el montaje de un laboratorio con infraestructura especializada que apoyara estas actividades. Asi, en los ultimos dos anos, el grupo de hidrogeno y celdas de combustible se ha dado a la tarea de renovar y acondicionar un espacio para recibir instrumentacion especializada e iniciar su operacion, asi como a desarrollar su propio conocimiento de tecnologia de celdas de combustible. Los trabajos de I y
International Nuclear Information System (INIS)
Neuber, Jens Christian; Tippl, Wolfgang; Hemptinne, Gwendoline de; Maes, Philippe; Ranta-aho, Anssu; Peneliau, Yannick; Jutier, Ludyvine; Tardy, Marcel; Reiche, Ingo; Kroeger, Helge; Nakata, Tetsuo; Armishaw, Malcom; Miller, Thomas M.
2015-01-01
The report describes the final results of the Phase II-E Burn-up Credit Criticality Benchmark conducted by the Expert Group on Burn-up Credit Criticality Safety. The objective of Phase II of the Burn-up Credit Criticality Safety programme is to study the impact of axial burn-up profiles of PWR UO 2 spent fuel assemblies on the reactivity of PWR UO 2 spent fuel assembly configurations. The objective of the Phase II-E benchmark was to study the impact of changes on the spent nuclear fuel isotopic composition due to control rod insertion during depletion on the reactivity and the end effect of spent fuel assemblies with realistic axial burn-up profiles for different control rod insertion depths ranging from 0 cm (no insertion) to full insertion (i.e. to the case that the fuel assemblies were exposed to control rod insertion over their full active length). For this purpose two axial burn-up profiles have been extracted from an AREVA-NP-GmbH-owned 17x17-(24+1) PWR UO 2 spent fuel assembly burn-up profile database. One profile has an average burn-up of 30 MWd/kg U, the other profile is related to an average burn-up of 50 MWd/kg U. Two profiles with different average burn-up values were selected because the shape of the burn-up profile is affected by the average burn-up and the end effect depends on the average burn-up of the fuel. The Phase II-E benchmark exercise complements the Phase II-C and Phase II-D benchmark exercises. In Phase II-D different irradiation histories were analysed using different control rod insertion histories during depletion as well as irradiation histories without control rod insertion. But in all the histories analysed a uniform distribution of the burn-up and hence a uniform distribution of the isotopic composition were assumed; and in all the histories including any usage of control rods full insertion of the control rods was assumed. In Phase II-C the impact of the asymmetry of axial burn-up profiles on the reactivity and the end effect of
JT Schoffer; C Bustos-López; P Sotomayor; CA Mattar; A González; C Robles; F Samsing; O Acevedo; CE Valdovinos
2011-01-01
En el presente estudio se aplicó el bioensayo EROD con línea celular H4IIE para determinar la equivalencia de resultados para carnes de pollo, entre el bioensayo EROD-H4IIE en pg TCDD-EQ/g de tejido y los resultados de la cromatografía de gases de alta resolución acoplada a espectrometría de alta resolución (HRGC/HRMS) en pg WHO-TEQ/g de grasa. Para lo anterior se utilizaron 41 muestras compuestas de trutros de pollo. Éstas fueron obtenidas en la planta faenadora de 4 planteles diferentes de ...
DEFF Research Database (Denmark)
Long, M.; Laier, Peter; Vinggaard, Anne
2003-01-01
TV101L hepatoma cell lines. In comparison the results indicated that the rat H4IIE cell line is more sensitive than the human TV101L for detection of TCDD inducing AhR-CALUX activity. The pesticides iprodione, chlorpyrifos and prochloraz showed dose-dependent AhR agonistic effects in both cell lines...
DEFF Research Database (Denmark)
Thomsen, M; Dahl, Morten; Tybjærg-Hansen, Anne
2012-01-01
Abstract. Thomsen M, Dahl M, Tybjaerg-Hansen A, Nordestgaard BG (Copenhagen University Hospital, Copenhagen; University of Copenhagen, Copenhagen, Denmark). ß(2) -adrenergic receptor Thr164IIe polymorphism, blood pressure and ischaemic heart disease in 66 750 individuals. J Intern Med 2011; doi: 10.......1111/j.1365-2796.2011.02447.x Objectives. The ß(2) -adrenergic receptor (ADRB2) is located on smooth muscle cells and is an important regulator of smooth muscle tone. The Thr164Ile polymorphism (rs1800888) in the ADRB2 gene is rare but has profound functional consequences on receptor function and could...
30 CFR 75.1103-1 - Automatic fire sensors.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic fire sensors. 75.1103-1 Section 75.1103-1 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY... fire sensors. A fire sensor system shall be installed on each underground belt conveyor. Sensors so...
International Nuclear Information System (INIS)
Niering, Petra; Michels, Gudrun; Waetjen, Wim; Ohler, Sandra; Steffan, Baerbel; Chovolou, Yvonni; Kampkoetter, Andreas; Proksch, Peter; Kahl, Regine
2005-01-01
Flavonoids are ubiquitous substances in fruits and vegetables. Among them, the flavonol kaempferol contributes up to 30% of total dietary flavonoid intake. Flavonoids are assumed to exert beneficial effects on human health, e.g., anticancer properties. For this reason, they are used in food supplements at high doses. The aim of this project was to determine the effects of kaempferol on oxidative stress and apoptosis in H4IIE rat hepatoma cells over a broad concentration range. Kaempferol is rapidly taken up and glucuronidated by H4IIE cells. The results demonstrate that kaempferol protects against H 2 O 2 -induced cellular damage at concentrations which lead to cell death and DNA strand breaks in the absence of H 2 O 2 -mediated oxidative stress. Preincubation with 50 μM kaempferol exerts protection against the loss of cell viability induced by 500 μM H 2 O 2 (2 h) while the same concentration of kaempferol reduces cell viability by 50% in the absence of H 2 O 2 (24 h). Preincubation with 50 μM kaempferol ameliorates the strong DNA damage induced by 500 μM H 2 O 2 while 50 μM kaempferol leads to a significant increase of DNA breakage in the absence of H 2 O 2 . Preincubation with 50 μM kaempferol reduces H 2 O 2 -mediated caspase-3 activity by 40% (4 h) while the same concentration of kaempferol leads to the formation of a DNA ladder in the absence of H 2 O 2 (24 h). It is concluded that the intake of high dose kaempferol in food supplements may not be advisable because in our cellular model protective kaempferol concentrations can also induce DNA damage and apoptosis by themselves
Energy Technology Data Exchange (ETDEWEB)
McCarroll, R [UT MD Anderson Cancer Center, Houston, TX (United States); UT Health Science Center, Graduate School of Biomedical Sciences, Houston, TX (United States); Beadle, B; Yang, J; Zhang, L; Kisling, K; Balter, P; Stingo, F; Nelson, C; Followill, D; Court, L [UT MD Anderson Cancer Center, Houston, TX (United States); Mejia, M [University of Santo Tomas Hospital, Manila, Metro Manila (Philippines)
2016-06-15
Purpose: To investigate and validate the use of an independent deformable-based contouring algorithm for automatic verification of auto-contoured structures in the head and neck towards fully automated treatment planning. Methods: Two independent automatic contouring algorithms [(1) Eclipse’s Smart Segmentation followed by pixel-wise majority voting, (2) an in-house multi-atlas based method] were used to create contours of 6 normal structures of 10 head-and-neck patients. After rating by a radiation oncologist, the higher performing algorithm was selected as the primary contouring method, the other used for automatic verification of the primary. To determine the ability of the verification algorithm to detect incorrect contours, contours from the primary method were shifted from 0.5 to 2cm. Using a logit model the structure-specific minimum detectable shift was identified. The models were then applied to a set of twenty different patients and the sensitivity and specificity of the models verified. Results: Per physician rating, the multi-atlas method (4.8/5 point scale, with 3 rated as generally acceptable for planning purposes) was selected as primary and the Eclipse-based method (3.5/5) for verification. Mean distance to agreement and true positive rate were selected as covariates in an optimized logit model. These models, when applied to a group of twenty different patients, indicated that shifts could be detected at 0.5cm (brain), 0.75cm (mandible, cord), 1cm (brainstem, cochlea), or 1.25cm (parotid), with sensitivity and specificity greater than 0.95. If sensitivity and specificity constraints are reduced to 0.9, detectable shifts of mandible and brainstem were reduced by 0.25cm. These shifts represent additional safety margins which might be considered if auto-contours are used for automatic treatment planning without physician review. Conclusion: Automatically contoured structures can be automatically verified. This fully automated process could be used to
26 CFR 1.414(w)-1 - Permissible withdrawals from eligible automatic contribution arrangements.
2010-04-01
... contribution arrangements. 1.414(w)-1 Section 1.414(w)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Plans, Etc. § 1.414(w)-1 Permissible withdrawals from eligible automatic contribution arrangements. (a) Overview. Section 414(w) provides rules under which certain employees are permitted to elect to make a...
International Nuclear Information System (INIS)
Nakazawa, Toshio; Yabuuti, Noriaki; Takahashi, Hiroki; Shimazaki, Junya
1999-02-01
Development of operation support system such as automatic operating system and anomaly diagnosis systems of nuclear reactor is very important in practical nuclear ship because of a limited number of operators and severe conditions in which receiving support from others in a case of accident is very difficult. The goal of development of the operation support systems is to realize the perfect automatic control system in a series of normal operation from the reactor start-up to the shutdown. The automatic control system for the normal operation has been developed based on operating experiences of the first Japanese nuclear ship 'Mutsu'. Automation technique was verified by 'Mutsu' plant data at manual operation. Fully automatic control of start-up and shutdown operations was achieved by setting the desired value of operation and the limiting value of parameter fluctuation, and by making the operation program of the principal equipment such as the main coolant pump and the heaters. This report presents the automatic operation system developed for the start-up and the shutdown of reactor and the verification of the system using the Nuclear Ship Engineering Simulator System. (author)
Schoffer, JT; Bustos-López, C; Sotomayor, P; Mattar, CA; González, A; Robles, C; Samsing, F; Acevedo, O; Valdovinos, CE
2011-01-01
En el presente estudio se aplicó el bioensayo EROD con línea celular H4IIE para determinar la equivalencia de resultados para carnes de pollo, entre el bioensayo EROD-H4IIE en pg TCDD-EQ/g de tejido y los resultados de la cromatografía de gases de alta resolución acoplada a espectrometría de alta resolución (HRGC/HRMS) en pg WHO-TEQ/g de grasa. Para lo anterior se utilizaron 41 muestras compuestas de trutros de pollo. Éstas fueron obtenidas en la planta faenadora de 4 planteles diferentes de ...
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Uniform Test Method for Measuring the Energy Consumption... Energy Consumption of Automatic and Semi-Automatic Clothes Washers The provisions of this appendix J1... means for determining the energy consumption of a clothes washer with an adaptive control system...
The Doubting System 1: Evidence for automatic substitution sensitivity.
Johnson, Eric D; Tubau, Elisabet; De Neys, Wim
2016-02-01
A long prevailing view of human reasoning suggests severe limits on our ability to adhere to simple logical or mathematical prescriptions. A key position assumes these failures arise from insufficient monitoring of rapidly produced intuitions. These faulty intuitions are thought to arise from a proposed substitution process, by which reasoners unknowingly interpret more difficult questions as easier ones. Recent work, however, suggests that reasoners are not blind to this substitution process, but in fact detect that their erroneous responses are not warranted. Using the popular bat-and-ball problem, we investigated whether this substitution sensitivity arises out of an automatic System 1 process or whether it depends on the operation of an executive resource demanding System 2 process. Results showed that accuracy on the bat-and-ball problem clearly declined under cognitive load. However, both reduced response confidence and increased response latencies indicated that biased reasoners remained sensitive to their faulty responses under load. Results suggest that a crucial substitution monitoring process is not only successfully engaged, but that it automatically operates as an autonomous System 1 process. By signaling its doubt along with a biased intuition, it appears System 1 is "smarter" than traditionally assumed.
Pro-apoptotic effects of the flavonoid luteolin in rat H4IIE cells
International Nuclear Information System (INIS)
Michels, G.; Waetjen, W.; Niering, P.; Steffan, B.; Thi, Q.-H. Tran; Chovolou, Y.; Kampkoetter, A.; Bast, A.; Proksch, P.; Kahl, R.
2005-01-01
Polyphenols are ubiquitous substances in the diet. Their anti-oxidative, anti-inflammatory and anti-viral effects are of interest for human health, and polyphenols such as luteolin are used at high concentrations in food supplements. The aim of this project was to determine the intrinsic effects of luteolin in H4IIE rat hepatoma cells. Luteolin is relatively toxic, cell death was caused via induction of apoptosis as detected by DNA-ladder formation, by nuclear fragmentation and activation of apoptotic enzymes (caspase-2, -3/7, -9 and -8/10). Luteolin (250 μM, 24 h) increased the caspase-3/7 activity four-fold and the caspase-9 activity six-fold. In a time course experiment caspase-9 is activated after 6 h, while caspase-2 and -3/7 are activated after 12 h. After 24 h, caspase-8/10 also displays activation. We found a concentration-dependent increase in malondialdehyde release suggesting a prooxidative effect of luteolin. Furthermore, we analysed DNA strand break formation by luteolin and found a distinct increase of DNA strand breaks after incubation for 3 h with 100 μM luteolin, a concentration which induces oligonucleosomal DNA cleavage at 24 h. In conclusion, the sequence of events is compatible with the assumption that luteolin triggers the mitochondrial pathway of apoptosis, probably by inducing DNA damage
Mennillo, Elvira; Krøkje, Åse; Pretti, Carlo; Meucci, Valentina; Arukwe, Augustine
2018-03-30
Pharmaceuticals such as racemate ketoprofen (RS-KP) and its enantiomer, dexketoprofen (S(+)-KP) are highly detectable non-steroidal anti-inflammatory drugs (NSAIDs) in the aquatic environment and therefore are designated as one of the most emerging groups of pollutants that can affect environmental and human health. The potential impact of these pharmaceuticals was assessed for the first time in vitro using a rat hepatocellular carcinoma cell line (H4IIE). Cells were exposed to low and high concentrations of these drugs. Cytotoxicity was determined by MTT reduction assay; CYP1A1 transcriptional and enzymatic levels together with canonical oxidative stress responsive markers (GPx, GR, GST and CAT) were also investigated. Cells exposed to RS-KP and S(+)-KP did not show cytotoxicity effect at the concentrations tested. However, this study highlighted differences between RS-KP and S(+)-KP in most of the evaluated markers, showing compound-, concentration- and time-specific effect patterns which suggest a potential stereo-selective toxicity of these drugs. Copyright © 2018 Elsevier B.V. All rights reserved.
14 CFR 23.1329 - Automatic pilot system.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Automatic pilot system. 23.1329 Section 23...: Installation § 23.1329 Automatic pilot system. If an automatic pilot system is installed, it must meet the following: (a) Each system must be designed so that the automatic pilot can— (1) Be quickly and positively...
Massot-Tarrús, Andreu; Steven, David A; McLachlan, Richard S; Mirsattari, Seyed M; Diosy, David; Parrent, Andrew G; Blume, Warren T; Girvin, John P; Burneo, Jorge G
2016-11-01
Temporal lobe epilepsy (TLE) with unclear lateralization may require intracranial implantation of electrodes (IIE). We retrospectively assessed the association between the use of IIE and long-term outcomes in patients undergoing anterior temporal lobectomy (ATL). We retrospectively reviewed the records of 1,032 patients undergoing epilepsy surgery at our center from 1977 to 2006. Patients who underwent ATL were included. Seizure outcome was assessed through final follow-up. Those who underwent scalp and IIE (mostly evaluated with temporal subdural strip electrodes) were compared. From 497 patients who underwent ATL, 139 did so after IIE placement in the temporal lobes. Mean age at surgery was 32.3±12.3years and median duration of follow-up 24 months (range: 6-36). Fifty-three percent of those evaluated with IIE were seizure-free at their last available visit (vs. 68% evaluated with only scalp EEG, p=0.002). Patients with lesional TLE generally had a better outcome (65.5% seizure free) than those without lesions (56.3%, p=0.093), especially for unilateral TLE diagnosed with IIE. In a multivariate Cox regression analyses adjusted for gender, neuropsychological concordance, pathological findings, and post-operative seizures, bilateral TLE predicted seizure recurrence in IIE patients (HR=2.08, 95% CI: 1.08-4.0, p=0.029). More than a half of those who undergo IIE in suspected TLE are seizure free after ATL. IIE allows for the identification of surgical candidates. Copyright © 2016 Elsevier B.V. All rights reserved.
Wang, Liang; Xia, Zhong-jun; Huang, Hui-qiang; Lu, Yue; Zhang, Yu-jing
2012-11-01
We conducted a retrospective study of 135 patients of stage IE/IIE extranodal natural killer/T cell lymphoma, nasal type (ENKTL) treated with CHOP as induction chemotherapy to find some valuable prognostic factors and analyze the usefulness of International Prognostic Index (IPI) and Korean Prognostic Index (KPI) in predicting prognosis. Most of the patients were in the low-risk group (IPI score 0-1). Complete remission (CR) after induction chemotherapy was achieved in 31.8 % of the patients, which increased to 69.6 % after radiotherapy. The 2-, 5-, and 10-year overall survival (OS) rates were 60, 48, and 43 %, respectively. Patients with better performance status (ECOG 0-1), normal serum LDH level, without local invasiveness, low KPI scores, and IPI score of 0 had significantly better overall survival (P KPI score systems should be improved further to classify patients into different groups, and should be validated in larger prospective trials. Due to the multi-drug resistance mechanism of ENKTL, CHOP is no longer the state of art and novel drugs should be incorporated into future treatments.
Automatic classification of journalistic documents on the Internet1
Directory of Open Access Journals (Sweden)
Elias OLIVEIRA
Full Text Available Abstract Online journalism is increasing every day. There are many news agencies, newspapers, and magazines using digital publication in the global network. Documents published online are available to users, who use search engines to find them. In order to deliver documents that are relevant to the search, they must be indexed and classified. Due to the vast number of documents published online every day, a lot of research has been carried out to find ways to facilitate automatic document classification. The objective of the present study is to describe an experimental approach for the automatic classification of journalistic documents published on the Internet using the Vector Space Model for document representation. The model was tested based on a real journalism database, using algorithms that have been widely reported in the literature. This article also describes the metrics used to assess the performance of these algorithms and their required configurations. The results obtained show the efficiency of the method used and justify further research to find ways to facilitate the automatic classification of documents.
A Cloud-Based System for Automatic Hazard Monitoring from Sentinel-1 SAR Data
Meyer, F. J.; Arko, S. A.; Hogenson, K.; McAlpin, D. B.; Whitley, M. A.
2017-12-01
Despite the all-weather capabilities of Synthetic Aperture Radar (SAR), and its high performance in change detection, the application of SAR for operational hazard monitoring was limited in the past. This has largely been due to high data costs, slow product delivery, and limited temporal sampling associated with legacy SAR systems. Only since the launch of ESA's Sentinel-1 sensors have routinely acquired and free-of-charge SAR data become available, allowing—for the first time—for a meaningful contribution of SAR to disaster monitoring. In this paper, we present recent technical advances of the Sentinel-1-based SAR processing system SARVIEWS, which was originally built to generate hazard products for volcano monitoring centers. We outline the main functionalities of SARVIEWS including its automatic database interface to Sentinel-1 holdings of the Alaska Satellite Facility (ASF), and its set of automatic processing techniques. Subsequently, we present recent system improvements that were added to SARVIEWS and allowed for a vast expansion of its hazard services; specifically: (1) In early 2017, the SARVIEWS system was migrated into the Amazon Cloud, providing access to cloud capabilities such as elastic scaling of compute resources and cloud-based storage; (2) we co-located SARVIEWS with ASF's cloud-based Sentinel-1 archive, enabling the efficient and cost effective processing of large data volumes; (3) we integrated SARVIEWS with ASF's HyP3 system (http://hyp3.asf.alaska.edu/), providing functionality such as subscription creation via API or map interface as well as automatic email notification; (4) we automated the production chains for seismic and volcanic hazards by integrating SARVIEWS with the USGS earthquake notification service (ENS) and the USGS eruption alert system. Email notifications from both services are parsed and subscriptions are automatically created when certain event criteria are met; (5) finally, SARVIEWS-generated hazard products are now
Directory of Open Access Journals (Sweden)
Philippe Moyen
2006-03-01
Full Text Available De la prospérité des cités-États phéniciennes à la disparition de l’empire carthaginois, la Méditerranée, entre le IXe et le IIe siècle, constitue un champ d’analyse privilégié pour étudier, dans la longue durée, l’évolution des «États point-champ» et mettre en évidence la diversité des modalités de territorialisation dans la production des aires géopolitiques supports de la trame évènementielle de l’Histoire.
The ''controbloc'', a programmable automatic device for the 1,300 MW generation of power stations
International Nuclear Information System (INIS)
Pralus, B.; Winzelle, J.C.
1983-01-01
Technological progress in the field of microelectronics has led to the development of an automatic control device, the ''controbloc'', for operating and controlling nuclear power plants. The ''controbloc'' will be used in automatic systems with a high degree of safety and versatility and is now being installed in the first of the new generation 1,300 MW power stations. The main characteristics of the device and the evaluation tests which have been carried out are described [fr
The automatic component of habit in health behavior: habit as cue-contingent automaticity.
Orbell, Sheina; Verplanken, Bas
2010-07-01
Habit might be usefully characterized as a form of automaticity that involves the association of a cue and a response. Three studies examined habitual automaticity in regard to different aspects of the cue-response relationship characteristic of unhealthy and healthy habits. In each study, habitual automaticity was assessed by the Self-Report Habit Index (SRHI). In Study 1 SRHI scores correlated with attentional bias to smoking cues in a Stroop task. Study 2 examined the ability of a habit cue to elicit an unwanted habit response. In a prospective field study, habitual automaticity in relation to smoking when drinking alcohol in a licensed public house (pub) predicted the likelihood of cigarette-related action slips 2 months later after smoking in pubs had become illegal. In Study 3 experimental group participants formed an implementation intention to floss in response to a specified situational cue. Habitual automaticity of dental flossing was rapidly enhanced compared to controls. The studies provided three different demonstrations of the importance of cues in the automatic operation of habits. Habitual automaticity assessed by the SRHI captured aspects of a habit that go beyond mere frequency or consistency of the behavior. PsycINFO Database Record (c) 2010 APA, all rights reserved.
14 CFR 29.1329 - Automatic pilot system.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Automatic pilot system. 29.1329 Section 29... pilot system. (a) Each automatic pilot system must be designed so that the automatic pilot can— (1) Be sufficiently overpowered by one pilot to allow control of the rotorcraft; and (2) Be readily and positively...
14 CFR 27.1329 - Automatic pilot system.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Automatic pilot system. 27.1329 Section 27... pilot system. (a) Each automatic pilot system must be designed so that the automatic pilot can— (1) Be sufficiently overpowered by one pilot to allow control of the rotorcraft; and (2) Be readily and positively...
Energy Technology Data Exchange (ETDEWEB)
Martinez M, Miguel A; Flores L, Zenon; Delgadillo V, Miguel A; Gutierrez A, Ruben [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)
2001-07-01
This article deals on the Automatic System of Tests, denominated PROBADOR, used by the Gerencia de Control e Instrumentation (GCI) of the Instituto de Investigaciones Electricas (IIE)for the accomplishment of dynamic tests in laboratory, to the systems of acquisition and control developed with the electronic line SAC-IIE that are installed in the Thermoelectric Power station of Combined Cycle (CTCC) of Dos Bocas, Veracruz and Gomez Palacio, Durango, Mexico. Also the architecture, the functions that are carried out in the equipment of the System of Acquisition and control (SAC) and in the personal computer (PC) that conforms it are described, as well as the methodology used for the development of the tests. The PC constitutes Interface Man-Machine (IMM) and in the SAC equipment the simulation of the processes is made (by means of the execution of algebraic-differential equations) in the compressor, combustion chamber, gas turbine, heat recuperators, steam turbines and condenser equipment that integrate a CTCC. The equations that are used are based in the thermodynamics, flow dynamics and heat transfer; they become attached to the real process with a margin of error that is estimated in 10%. Finally, the tendencies of the PROBADOR and the technical and economic advantages are described that it has provided for the improvement in the performance of the control systems, before different situations, with no need to have the real process. [Spanish] Este articulo versa sobre el Sistema Automatico de Pruebas, denominado PROBADOR, utilizado por la Gerencia de Control e Instrumentacion (GCI) del Instituto de Investigaciones Electricas para la realizacion de pruebas dinamicas en laboratorio, a los sistemas de adquisicion y control desarrollado con la linea electronica SAC-IIE que estan instalados en las Centrales Termoelectricas de Ciclo Combinado (CTCC) de Dos Bocas, Veracruz y Gomez Palacio, Durango, Mexico. Tambien se describen la arquitectura, las funciones que se llevan
46 CFR 52.01-10 - Automatic controls.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Automatic controls. 52.01-10 Section 52.01-10 Shipping... Requirements § 52.01-10 Automatic controls. (a) Each main boiler must meet the special requirements for automatic safety controls in § 62.35-20(a)(1) of this chapter. (b) Each automatically controlled auxiliary...
Energy Technology Data Exchange (ETDEWEB)
Picasso B, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Astorga Q, Clemente [Luz y Fuerza del Centro (Mexico)
2003-07-01
In order to increase the services quality in the electrical energy, to improve the process of identification of energy losses, to increase the equipment efficiency, to count on more complete statistics of profiles of load consumptions, among other applications, the Compania de Luz y Fuerza del Centro (LyFC) carries out the modernization in automatization of substations and regional operation centers of distribution networks. The technological base to make these programs requires automating the operative schemes of the substation and distribution centers that supervise the events of the electrical process. In this article the main results of the development and integration of master stations based on PC, that were made in the Instituto de Investigaciones Electricas (IIE) and that have been integrated in the electrical company LyFC are presented. [Spanish] Con el proposito de incrementar la calidad de los servicios en la energia electrica, mejorar el proceso de identificacion de perdidas de energia, aumentar la eficiencia de los equipos, contar con estadisticas mas completas de perfiles de consumos de carga, entre otras aplicaciones, la Compania de Luz y Fuerza del Centro (LyFC) lleva a cabo la modernizacion en automatizacion de subestaciones y centros de operacion regional de redes electricas de distribucion. La base tecnologica para realizar estos programas, requiere de automatizar los esquemas operativos de la subestacion y centros de distribucion que supervisan los eventos del proceso electrico. En este articulo se presentan los principales resultados del desarrollo e integracion de estaciones maestras basadas en PC, que se realizaron en el Instituto de Investigaciones Electricas (IIE) y que se han integrado en la compania electrica LyFC.
One kilometer (1 km) electric solar wind sail tether produced automatically.
Seppänen, Henri; Rauhala, Timo; Kiprich, Sergiy; Ukkonen, Jukka; Simonsson, Martin; Kurppa, Risto; Janhunen, Pekka; Hæggström, Edward
2013-09-01
We produced a 1 km continuous piece of multifilament electric solar wind sail tether of μm-diameter aluminum wires using a custom made automatic tether factory. The tether comprising 90,704 bonds between 25 and 50 μm diameter wires is reeled onto a metal reel. The total mass of 1 km tether is 10 g. We reached a production rate of 70 m/24 h and a quality level of 1‰ loose bonds and 2‰ rebonded ones. We thus demonstrated that production of long electric solar wind sail tethers is possible and practical.
30 CFR 77.314 - Automatic temperature control instruments.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic temperature control instruments. 77... UNDERGROUND COAL MINES Thermal Dryers § 77.314 Automatic temperature control instruments. (a) Automatic temperature control instruments for thermal dryer system shall be of the recording type. (b) Automatic...
Role of hypoxia-inducible factor-α in hepatitis-B-virus X protein-mediated MDR1 activation
International Nuclear Information System (INIS)
Han, Hyo-Kyung; Han, Chang Yeob; Cheon, Eun-Pa; Lee, Jaewon; Kang, Keon Wook
2007-01-01
The transition from chemotherapy-responsive cancer cells to chemotherapy-resistant cancer cells is mainly accompanied by the increased expression of multi-drug resistance 1 (MDR1). We found that hepatitis-B-virus X protein (HBx) increases the transcriptional activity and protein level of MDR1 in a hepatoma cell line, H4IIE. In addition, HBx overexpression made H4IIE cells more resistant to verapamil-uptake. HBx stabilized hypoxia-inducible factor-1α (HIF-1α) and induced the nuclear translocation of C/EBPβ. Reporter gene analyses showed that HBx increased the reporter activity in the cells transfected with the reporter containing MDR1 gene promoter. Moreover, the luciferase reporter gene activity was significantly inhibited by HIF-1α siRNA but not by overexpression of C/EBP dominant negative mutant. These results imply that HBx increases the MDR1 transporter activity through the transcriptional activation of the MDR1 gene with HIF-1α activation, and suggest HIF-1α for the therapeutic target of HBV-mediated chemoresistance
Heyes, Cecilia
2011-01-01
"Automatic imitation" is a type of stimulus-response compatibility effect in which the topographical features of task-irrelevant action stimuli facilitate similar, and interfere with dissimilar, responses. This article reviews behavioral, neurophysiological, and neuroimaging research on automatic imitation, asking in what sense it is "automatic"…
Automatic imitation: A meta-analysis.
Cracco, Emiel; Bardi, Lara; Desmet, Charlotte; Genschow, Oliver; Rigoni, Davide; De Coster, Lize; Radkova, Ina; Deschrijver, Eliane; Brass, Marcel
2018-05-01
Automatic imitation is the finding that movement execution is facilitated by compatible and impeded by incompatible observed movements. In the past 15 years, automatic imitation has been studied to understand the relation between perception and action in social interaction. Although research on this topic started in cognitive science, interest quickly spread to related disciplines such as social psychology, clinical psychology, and neuroscience. However, important theoretical questions have remained unanswered. Therefore, in the present meta-analysis, we evaluated seven key questions on automatic imitation. The results, based on 161 studies containing 226 experiments, revealed an overall effect size of g z = 0.95, 95% CI [0.88, 1.02]. Moderator analyses identified automatic imitation as a flexible, largely automatic process that is driven by movement and effector compatibility, but is also influenced by spatial compatibility. Automatic imitation was found to be stronger for forced choice tasks than for simple response tasks, for human agents than for nonhuman agents, and for goalless actions than for goal-directed actions. However, it was not modulated by more subtle factors such as animacy beliefs, motion profiles, or visual perspective. Finally, there was no evidence for a relation between automatic imitation and either empathy or autism. Among other things, these findings point toward actor-imitator similarity as a crucial modulator of automatic imitation and challenge the view that imitative tendencies are an indicator of social functioning. The current meta-analysis has important theoretical implications and sheds light on longstanding controversies in the literature on automatic imitation and related domains. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
DEFF Research Database (Denmark)
Automatic Program Development is a tribute to Robert Paige (1947-1999), our accomplished and respected colleague, and moreover our good friend, whose untimely passing was a loss to our academic and research community. We have collected the revised, updated versions of the papers published in his...... honor in the Higher-Order and Symbolic Computation Journal in the years 2003 and 2005. Among them there are two papers by Bob: (i) a retrospective view of his research lines, and (ii) a proposal for future studies in the area of the automatic program derivation. The book also includes some papers...... by members of the IFIP Working Group 2.1 of which Bob was an active member. All papers are related to some of the research interests of Bob and, in particular, to the transformational development of programs and their algorithmic derivation from formal specifications. Automatic Program Development offers...
30 CFR 77.1401 - Automatic controls and brakes.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic controls and brakes. 77.1401 Section... MINES Personnel Hoisting § 77.1401 Automatic controls and brakes. Hoists and elevators shall be equipped with overspeed, overwind, and automatic stop controls and with brakes capable of stopping the elevator...
30 CFR 57.19006 - Automatic hoist braking devices.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic hoist braking devices. 57.19006 Section 57.19006 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND... Hoisting Hoists § 57.19006 Automatic hoist braking devices. Automatic hoists shall be provided with devices...
30 CFR 56.19006 - Automatic hoist braking devices.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic hoist braking devices. 56.19006 Section 56.19006 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND... Hoisting Hoists § 56.19006 Automatic hoist braking devices. Automatic hoists shall be provided with devices...
Towards an Automatic Parking System using Bio-Inspired 1-D Optical Flow Sensors
Mafrica , Stefano; Servel , Alain; Ruffier , Franck
2015-01-01
International audience; Although several (semi-) automatic parking systems have been presented throughout the years [1]–[12], car manufacturers are still looking for low-cost sensors providing redundant information about the obstacles around the vehicle, as well as efficient methods of processing this information, in the hope of achieving a very high level of robustness. We therefore investigated how Local Motion Sensors (LMSs) [13], [14], comprising only of a few pixels giving 1-D optical fl...
Automatic control system at the ''Loviisa'' NPP
International Nuclear Information System (INIS)
Kukhtevich, I.V.; Mal'tsev, B.K.; Sergievskaya, E.N.
1980-01-01
Automatic control system of the Loviisa-1 NPP (Finland) is described. According to operation conditions of Finland power system the Loviisa-1 NPP must operate in the mode of week and day control of loading schedule and participate in current control of power system frequency and capacity. With provision for these requirements NPP is equipped with the all-regime system for automatic control functioning during reactor start-up, shut-down, in normal and transient regimes and in emergency situations. The automatic control system includes: a data subsystem, an automatic control subsystem, a discrete control subsystem including remote, a subsystem for reactor control and protection and overall station system of protections: control and dosimetry inside the reactor. Structures of a data-computer complex, discrete control subsystems, reactor control and protection systems, neutron flux control system, inside-reactor control system, station protection system and system for control of fuel element tightness are presented in short. Two-year experience of the NPP operation confirmed advisability of the chosen volume of automatization. The Loviisa-1 NPP operates successfully in the mode of the week and day control of supervisor schedule and current control of frequency (short-term control)
Fully automatic detection of deep white matter T1 hypointense lesions in multiple sclerosis
Spies, Lothar; Tewes, Anja; Suppa, Per; Opfer, Roland; Buchert, Ralph; Winkler, Gerhard; Raji, Alaleh
2013-12-01
A novel method is presented for fully automatic detection of candidate white matter (WM) T1 hypointense lesions in three-dimensional high-resolution T1-weighted magnetic resonance (MR) images. By definition, T1 hypointense lesions have similar intensity as gray matter (GM) and thus appear darker than surrounding normal WM in T1-weighted images. The novel method uses a standard classification algorithm to partition T1-weighted images into GM, WM and cerebrospinal fluid (CSF). As a consequence, T1 hypointense lesions are assigned an increased GM probability by the standard classification algorithm. The GM component image of a patient is then tested voxel-by-voxel against GM component images of a normative database of healthy individuals. Clusters (≥0.1 ml) of significantly increased GM density within a predefined mask of deep WM are defined as lesions. The performance of the algorithm was assessed on voxel level by a simulation study. A maximum dice similarity coefficient of 60% was found for a typical T1 lesion pattern with contrasts ranging from WM to cortical GM, indicating substantial agreement between ground truth and automatic detection. Retrospective application to 10 patients with multiple sclerosis demonstrated that 93 out of 96 T1 hypointense lesions were detected. On average 3.6 false positive T1 hypointense lesions per patient were found. The novel method is promising to support the detection of hypointense lesions in T1-weighted images which warrants further evaluation in larger patient samples.
Automatic differentiation bibliography
Energy Technology Data Exchange (ETDEWEB)
Corliss, G.F. [comp.
1992-07-01
This is a bibliography of work related to automatic differentiation. Automatic differentiation is a technique for the fast, accurate propagation of derivative values using the chain rule. It is neither symbolic nor numeric. Automatic differentiation is a fundamental tool for scientific computation, with applications in optimization, nonlinear equations, nonlinear least squares approximation, stiff ordinary differential equation, partial differential equations, continuation methods, and sensitivity analysis. This report is an updated version of the bibliography which originally appeared in Automatic Differentiation of Algorithms: Theory, Implementation, and Application.
Reliability analysis of the automatic control of the A-1 power plant coolant temperature
International Nuclear Information System (INIS)
Kuklik, B.; Semerad, V.; Chylek, Z.
Reliability analysis of the automatic control of the A-1 reactor coolant temperature is performed taking into account the effect of both the dependent failures and the routine maintenance of control system components. In a separate supplement, reliability analysis is reported of coincidence systems of the A-1 power plant reactor. Both safe and unsafe failures are taken into consideration as well as the effect of maintenance of the respective branch elements
Optical Automatic Car Identification (OACI) : Volume 1. Advanced System Specification.
1978-12-01
A performance specification is provided in this report for an Optical Automatic Car Identification (OACI) scanner system which features 6% improved readability over existing industry scanner systems. It also includes the analysis and rationale which ...
Robot-assisted automatic ultrasound calibration.
Aalamifar, Fereshteh; Cheng, Alexis; Kim, Younsu; Hu, Xiao; Zhang, Haichong K; Guo, Xiaoyu; Boctor, Emad M
2016-10-01
Ultrasound (US) calibration is the process of determining the unknown transformation from a coordinate frame such as the robot's tooltip to the US image frame and is a necessary task for any robotic or tracked US system. US calibration requires submillimeter-range accuracy for most applications, but it is a time-consuming and repetitive task. We provide a new framework for automatic US calibration with robot assistance and without the need for temporal calibration. US calibration based on active echo (AE) phantom was previously proposed, and its superiority over conventional cross-wire phantom-based calibration was shown. In this work, we use AE to guide the robotic arm motion through the process of data collection; we combine the capability of the AE point to localize itself in the frame of the US image with the automatic motion of the robotic arm to provide a framework for calibrating the arm to the US image automatically. We demonstrated the efficacy of the automated method compared to the manual method through experiments. To highlight the necessity of frequent ultrasound calibration, it is demonstrated that the calibration precision changed from 1.67 to 3.20 mm if the data collection is not repeated after a dismounting/mounting of the probe holder. In a large data set experiment, similar reconstruction precision of automatic and manual data collection was observed, while the time was reduced by 58 %. In addition, we compared ten automatic calibrations with ten manual ones, each performed in 15 min, and showed that all the automatic ones could converge in the case of setting the initial matrix as identity, while this was not achieved by manual data sets. Given the same initial matrix, the repeatability of the automatic was [0.46, 0.34, 0.80, 0.47] versus [0.42, 0.51, 0.98, 1.15] mm in the manual case for the US image four corners. The submillimeter accuracy requirement of US calibration makes frequent data collections unavoidable. We proposed an automated
A neurocomputational model of automatic sequence production.
Helie, Sebastien; Roeder, Jessica L; Vucovich, Lauren; Rünger, Dennis; Ashby, F Gregory
2015-07-01
Most behaviors unfold in time and include a sequence of submovements or cognitive activities. In addition, most behaviors are automatic and repeated daily throughout life. Yet, relatively little is known about the neurobiology of automatic sequence production. Past research suggests a gradual transfer from the associative striatum to the sensorimotor striatum, but a number of more recent studies challenge this role of the BG in automatic sequence production. In this article, we propose a new neurocomputational model of automatic sequence production in which the main role of the BG is to train cortical-cortical connections within the premotor areas that are responsible for automatic sequence production. The new model is used to simulate four different data sets from human and nonhuman animals, including (1) behavioral data (e.g., RTs), (2) electrophysiology data (e.g., single-neuron recordings), (3) macrostructure data (e.g., TMS), and (4) neurological circuit data (e.g., inactivation studies). We conclude with a comparison of the new model with existing models of automatic sequence production and discuss a possible new role for the BG in automaticity and its implication for Parkinson's disease.
Automatic quality control in clinical (1)H MRSI of brain cancer.
Pedrosa de Barros, Nuno; McKinley, Richard; Knecht, Urspeter; Wiest, Roland; Slotboom, Johannes
2016-05-01
MRSI grids frequently show spectra with poor quality, mainly because of the high sensitivity of MRS to field inhomogeneities. These poor quality spectra are prone to quantification and/or interpretation errors that can have a significant impact on the clinical use of spectroscopic data. Therefore, quality control of the spectra should always precede their clinical use. When performed manually, quality assessment of MRSI spectra is not only a tedious and time-consuming task, but is also affected by human subjectivity. Consequently, automatic, fast and reliable methods for spectral quality assessment are of utmost interest. In this article, we present a new random forest-based method for automatic quality assessment of (1)H MRSI brain spectra, which uses a new set of MRS signal features. The random forest classifier was trained on spectra from 40 MRSI grids that were classified as acceptable or non-acceptable by two expert spectroscopists. To account for the effects of intra-rater reliability, each spectrum was rated for quality three times by each rater. The automatic method classified these spectra with an area under the curve (AUC) of 0.976. Furthermore, in the subset of spectra containing only the cases that were classified every time in the same way by the spectroscopists, an AUC of 0.998 was obtained. Feature importance for the classification was also evaluated. Frequency domain skewness and kurtosis, as well as time domain signal-to-noise ratios (SNRs) in the ranges 50-75 ms and 75-100 ms, were the most important features. Given that the method is able to assess a whole MRSI grid faster than a spectroscopist (approximately 3 s versus approximately 3 min), and without loss of accuracy (agreement between classifier trained with just one session and any of the other labelling sessions, 89.88%; agreement between any two labelling sessions, 89.03%), the authors suggest its implementation in the clinical routine. The method presented in this article was implemented
30 CFR 75.1404 - Automatic brakes; speed reduction gear.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic brakes; speed reduction gear. 75.1404... Automatic brakes; speed reduction gear. [Statutory Provisions] Each locomotive and haulage car used in an... permit automatic brakes, locomotives and haulage cars shall be subject to speed reduction gear, or other...
Energy Technology Data Exchange (ETDEWEB)
Yang, Fangxing, E-mail: fxyang@zju.edu.cn [MOE Key Laboratory of Environmental Remediation and Ecosystem Health, College of Environmental and Resource Sciences, Zhejiang University, Hangzhou, 310058 (China); Zhuang, Shulin [MOE Key Laboratory of Environmental Remediation and Ecosystem Health, College of Environmental and Resource Sciences, Zhejiang University, Hangzhou, 310058 (China); Zhang, Chao; Dai, Heping [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan, 430072 (China); Liu, Weiping, E-mail: wliu@zju.edu.cn [MOE Key Laboratory of Environmental Remediation and Ecosystem Health, College of Environmental and Resource Sciences, Zhejiang University, Hangzhou, 310058 (China)
2013-06-15
Increasing environmental pollution by carcinogens such as some of persistent organic pollutants (POPs) has prompted growing interest in searching for chemopreventive compounds which are readily obtainable. Sulforaphane (SFN) is isolated from cruciferous vegetables and has the potentials to reduce carcinogenesis through various pathways. In this study, we studied the effects of SFN on CYP1A1 activity and genotoxicity induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD). The results showed that SFN inhibited TCDD-induced CYP1A1 activity in H4IIE cells by directly inhibiting CYP1A1 activity, probably through binding to aryl hydrocarbon receptor and/or CYP1A1 revealed by molecular docking. However, SFN promoted TCDD-induced DNA damage in yeast cells and reduced the viability of initiated yeast cells. Besides, it is surprising that SFN also failed to reduce genotoxicity induced by other genotoxic reagents which possess different mechanisms to lead to DNA damage. Currently, it is difficult to predict whether SFN has the potentials to reduce the risk of TCDD based on the conflicting observations in the study. Therefore, further studies should be urgent to reveal the function and mechanism of SFN in the stress of such POPs on human health. - Highlights: • Sulforaphane inhibited TCDD-induced CYP1A1 activity in H4IIE cells. • Sulforaphane may bind to aryl hydrocarbon receptor and/or CYP1A1. • Sulforaphane promoted TCDD-induced DNA damage in yeast cells. • Sulforaphane may promote DNA damage by DNA strand breaks or DNA alkylation.
Automatic TLI recognition system. Part 1: System description
Energy Technology Data Exchange (ETDEWEB)
Partin, J.K.; Lassahn, G.D.; Davidson, J.R.
1994-05-01
This report describes an automatic target recognition system for fast screening of large amounts of multi-sensor image data, based on low-cost parallel processors. This system uses image data fusion and gives uncertainty estimates. It is relatively low cost, compact, and transportable. The software is easily enhanced to expand the system`s capabilities, and the hardware is easily expandable to increase the system`s speed. This volume gives a general description of the ATR system.
A usefulness and evaluation of setting region of interest automatically, using NEURO FLEXER ver. 1.0
International Nuclear Information System (INIS)
Mizuno, Takashi; Takahashi, Masaaki
2010-01-01
Software NEURO FLEXER Ver. 1.0 (FLEX), Brain ROI (BROI) and 3D Stereotactic ROI Template ver. 3.1 (3DSRT) were compared with authors' manual method (MM) for ROI setting to estimate cerebral blood flow (CBF) in single photon emission computed tomography (SPECT) to search the most efficient automatic setting. Subjects analyzed were 123 IMP SPECT autoradiography (ARG) images of 52 patients (M/F 24/28, average age of 69 y) with I: cerebral infarction and ischemia (INF, 26 cases), Alzheimer disease and other dementia (AD, 14), postoperation subarachnoid hemorrhage (10) and 2 other cases, and II: their each 10 cases of AD with and INF without atrophy in MRI. The machine was Toshiba SPECT GCA9300A equipped with the high resolution fan beam collimator for low energy and the processor GMS5500/PI. ARG acquisition was conducted by 8 rotations/20 min with 3.44 mm thick slices. ROI was set by MM with GMS5500/PI or automatically with FLEX (Fuji Mediphysics), BROI and 3DSRT (both, Fuji Film RI Pharma). Anatomical standardization was done with iSSP5 (NEUROSTAT STEREO) and eZIZ (SPM2 spatial normalize). Five experts split up MM and one finally checked all. In group I (all lesions) and II (according to disease type), MM vs each automatic ROI setting was compared for rCBF (mL/min/100 g) by regression. The automatic ROI setting with FLEX software was suggested to be closest to that by authors' MM for estimating CBF in SPECT as the software in standardization and volume of interest (VOI) template application was found flexible even at reduced blood flow and atrophic lesion. For the automation, however, the user should understand the features of the standardization and know how to meet with the situation. (T.T.)
1981-03-01
Final Report: February 1978 ZAUTOMATIC OSCILLATING TURRET SYSTEM September 1980 * 6. PERFORMING 01G. REPORT NUMBER .J7. AUTHOR(S) S. CONTRACT OR GRANT...o....e.... *24 APPENDIX P-4 OSCILLATING BUMPER TURRET ...................... 25 A. DESCRIPTION 1. Turret Controls ...Other criteria requirements were: 1. Turret controls inside cab. 2. Automatic oscillation with fixed elevation to range from 20* below the horizontal to
An Automatic Detection Method of Nanocomposite Film Element Based on GLCM and Adaboost M1
Directory of Open Access Journals (Sweden)
Hai Guo
2015-01-01
Full Text Available An automatic detection model adopting pattern recognition technology is proposed in this paper; it can realize the measurement to the element of nanocomposite film. The features of gray level cooccurrence matrix (GLCM can be extracted from different types of surface morphology images of film; after that, the dimension reduction of film can be handled by principal component analysis (PCA. So it is possible to identify the element of film according to the Adaboost M1 algorithm of a strong classifier with ten decision tree classifiers. The experimental result shows that this model is superior to the ones of SVM (support vector machine, NN and BayesNet. The method proposed can be widely applied to the automatic detection of not only nanocomposite film element but also other nanocomposite material elements.
Automatic Detection of Wild-type Mouse Cranial Sutures
DEFF Research Database (Denmark)
Ólafsdóttir, Hildur; Darvann, Tron Andre; Hermann, Nuno V.
, automatic detection of the cranial sutures becomes important. We have previously built a craniofacial, wild-type mouse atlas from a set of 10 Micro CT scans using a B-spline-based nonrigid registration method by Rueckert et al. Subsequently, all volumes were registered nonrigidly to the atlas. Using......, the observer traced the sutures on each of the mouse volumes as well. The observer outperforms the automatic approach by approximately 0.1 mm. All mice have similar errors while the suture error plots reveal that suture 1 and 2 are cumbersome, both for the observer and the automatic approach. These sutures can...
Automatic isotope gas analysis of tritium labelled organic materials Pt. 1
International Nuclear Information System (INIS)
Gacs, I.; Mlinko, S.
1978-01-01
A new automatic procedure developed to convert tritium in HTO hydrogen for subsequent on-line gas counting is described. The water containing tritium is introduced into a column prepared from molecular sieve-5A and heated to 550 deg C. The tritium is transferred by isotopic exchange into hydrogen flowing through the column. The radioactive gas is led into an internal detector for radioactivity measurement. The procedure is free of memory effects, provides quantitative recovery with analytical reproducibility better than 0.5% rel. at a preset number of counts. The experimental and analytical results indicate that isotopic exchange between HTO and hydrogen over a column prepared from alumina or molecular sieve-5A can be successfully applied for the quantitative transfer of tritium from HTO into hydrogen for on-line gas countinq. This provides an analytical procedure for the automatic determination of tritium in water with an analytical reproducibility better than 0.5% rel. The exchange process will also be suitable for rapid tritium transfer from water formed during the decomposition of tritium-labelled organic compounds or biological materials. The application of the procedure in automatic isotope gas analysis of organic materials labelled with tritium will be described in subsequent papers (Parts II and III). (T.G.)
Automatic shadowing device for electron microscopy
Energy Technology Data Exchange (ETDEWEB)
Bishop, F W; Bogitch, S
1960-01-01
For the past ten years in the laboratory of the Department of Nuclear Medicine and Radiation Biology at the University of California, and before that at Rochester, New York, every evaporation was done with the aid of an automatic shadowing device. For several months the automatic shadowing device has been available at the Atomic Bomb Casualty Commission (ABCC) Hiroshima, Japan with the modifications described. 1 reference.
Directory of Open Access Journals (Sweden)
Narcis Eduard Mitu
2013-11-01
Full Text Available Policies or institutions (built into an economic system that automatically tend to dampen economic cycle fluctuations in income, employment, etc., without direct government intervention. For example, in boom times, progressive income tax automatically reduces money supply as incomes and spendings rise. Similarly, in recessionary times, payment of unemployment benefits injects more money in the system and stimulates demand. Also called automatic stabilizers or built-in stabilizers.
Shaping electromagnetic waves using software-automatically-designed metasurfaces.
Zhang, Qian; Wan, Xiang; Liu, Shuo; Yuan Yin, Jia; Zhang, Lei; Jun Cui, Tie
2017-06-15
We present a fully digital procedure of designing reflective coding metasurfaces to shape reflected electromagnetic waves. The design procedure is completely automatic, controlled by a personal computer. In details, the macro coding units of metasurface are automatically divided into several types (e.g. two types for 1-bit coding, four types for 2-bit coding, etc.), and each type of the macro coding units is formed by discretely random arrangement of micro coding units. By combining an optimization algorithm and commercial electromagnetic software, the digital patterns of the macro coding units are optimized to possess constant phase difference for the reflected waves. The apertures of the designed reflective metasurfaces are formed by arranging the macro coding units with certain coding sequence. To experimentally verify the performance, a coding metasurface is fabricated by automatically designing two digital 1-bit unit cells, which are arranged in array to constitute a periodic coding metasurface to generate the required four-beam radiations with specific directions. Two complicated functional metasurfaces with circularly- and elliptically-shaped radiation beams are realized by automatically designing 4-bit macro coding units, showing excellent performance of the automatic designs by software. The proposed method provides a smart tool to realize various functional devices and systems automatically.
Automatic cortical surface reconstruction of high-resolution T1 echo planar imaging data.
Renvall, Ville; Witzel, Thomas; Wald, Lawrence L; Polimeni, Jonathan R
2016-07-01
Echo planar imaging (EPI) is the method of choice for the majority of functional magnetic resonance imaging (fMRI), yet EPI is prone to geometric distortions and thus misaligns with conventional anatomical reference data. The poor geometric correspondence between functional and anatomical data can lead to severe misplacements and corruption of detected activation patterns. However, recent advances in imaging technology have provided EPI data with increasing quality and resolution. Here we present a framework for deriving cortical surface reconstructions directly from high-resolution EPI-based reference images that provide anatomical models exactly geometric distortion-matched to the functional data. Anatomical EPI data with 1mm isotropic voxel size were acquired using a fast multiple inversion recovery time EPI sequence (MI-EPI) at 7T, from which quantitative T1 maps were calculated. Using these T1 maps, volumetric data mimicking the tissue contrast of standard anatomical data were synthesized using the Bloch equations, and these T1-weighted data were automatically processed using FreeSurfer. The spatial alignment between T2(⁎)-weighted EPI data and the synthetic T1-weighted anatomical MI-EPI-based images was improved compared to the conventional anatomical reference. In particular, the alignment near the regions vulnerable to distortion due to magnetic susceptibility differences was improved, and sampling of the adjacent tissue classes outside of the cortex was reduced when using cortical surface reconstructions derived directly from the MI-EPI reference. The MI-EPI method therefore produces high-quality anatomical data that can be automatically segmented with standard software, providing cortical surface reconstructions that are geometrically matched to the BOLD fMRI data. Copyright © 2016 Elsevier Inc. All rights reserved.
1981-06-01
span required or allowed for each task in a single scan is outlined in Table 3-1. The executive program controls the initiation and termination of each...by-step manner throughout the ATARS process. At the same time, the executive program controls and determines when each task is ready to accept the next...AD-AI04 147 MITRE CORP MCLEAN VA METREK UI V ’ 1AUTOMATIC TRAFFIC AUVISORY AND RESOLUTION SERVICE (ATARS) ALGOR--ETC(U) JUN a R H LENTZ. W D LOVE, T L
14 CFR 25.904 - Automatic takeoff thrust control system (ATTCS).
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Automatic takeoff thrust control system... Automatic takeoff thrust control system (ATTCS). Each applicant seeking approval for installation of an engine power control system that automatically resets the power or thrust on the operating engine(s) when...
Automatic Tuning of PID Controller for a 1-D Levitation System Using a Genetic Algorithm
DEFF Research Database (Denmark)
Yang, Zhenyu; Pedersen, Gerulf K.m.
2006-01-01
The automatic PID control design for a onedimensional magnetic levitation system is investigated. The PID controller is automatically tuned using the non-dominated sorting genetic algorithm (NSGA-II) based on a nonlinear system model. The developed controller is digitally implemented and tested...
Automatic Control of Silicon Melt Level
Duncan, C. S.; Stickel, W. B.
1982-01-01
A new circuit, when combined with melt-replenishment system and melt level sensor, offers continuous closed-loop automatic control of melt-level during web growth. Installed on silicon-web furnace, circuit controls melt-level to within 0.1 mm for as long as 8 hours. Circuit affords greater area growth rate and higher web quality, automatic melt-level control also allows semiautomatic growth of web over long periods which can greatly reduce costs.
Accuracy of Automatic Cephalometric Software on Landmark Identification
Anuwongnukroh, N.; Dechkunakorn, S.; Damrongsri, S.; Nilwarat, C.; Pudpong, N.; Radomsutthisarn, W.; Kangern, S.
2017-11-01
This study was to assess the accuracy of an automatic cephalometric analysis software in the identification of cephalometric landmarks. Thirty randomly selected digital lateral cephalograms of patients undergoing orthodontic treatment were used in this study. Thirteen landmarks (S, N, Or, A-point, U1T, U1A, B-point, Gn, Pog, Me, Go, L1T, and L1A) were identified on the digital image by an automatic cephalometric software and on cephalometric tracing by manual method. Superimposition of printed image and manual tracing was done by registration at the soft tissue profiles. The accuracy of landmarks located by the automatic method was compared with that of the manually identified landmarks by measuring the mean differences of distances of each landmark on the Cartesian plane where X and Y coordination axes passed through the center of ear rod. One-Sample T test was used to evaluate the mean differences. Statistically significant mean differences (pmean differences in both horizontal and vertical directions. Small mean differences (mean differences were found for A-point (3.0 4mm) in vertical direction. Only 5 of 13 landmarks (38.46%; S, N, Gn, Pog, and Go) showed no significant mean difference between the automatic and manual landmarking methods. It is concluded that if this automatic cephalometric analysis software is used for orthodontic diagnosis, the orthodontist must correct or modify the position of landmarks in order to increase the accuracy of cephalometric analysis.
Automatic evidence retrieval for systematic reviews.
Choong, Miew Keen; Galgani, Filippo; Dunn, Adam G; Tsafnat, Guy
2014-10-01
Snowballing involves recursively pursuing relevant references cited in the retrieved literature and adding them to the search results. Snowballing is an alternative approach to discover additional evidence that was not retrieved through conventional search. Snowballing's effectiveness makes it best practice in systematic reviews despite being time-consuming and tedious. Our goal was to evaluate an automatic method for citation snowballing's capacity to identify and retrieve the full text and/or abstracts of cited articles. Using 20 review articles that contained 949 citations to journal or conference articles, we manually searched Microsoft Academic Search (MAS) and identified 78.0% (740/949) of the cited articles that were present in the database. We compared the performance of the automatic citation snowballing method against the results of this manual search, measuring precision, recall, and F1 score. The automatic method was able to correctly identify 633 (as proportion of included citations: recall=66.7%, F1 score=79.3%; as proportion of citations in MAS: recall=85.5%, F1 score=91.2%) of citations with high precision (97.7%), and retrieved the full text or abstract for 490 (recall=82.9%, precision=92.1%, F1 score=87.3%) of the 633 correctly retrieved citations. The proposed method for automatic citation snowballing is accurate and is capable of obtaining the full texts or abstracts for a substantial proportion of the scholarly citations in review articles. By automating the process of citation snowballing, it may be possible to reduce the time and effort of common evidence surveillance tasks such as keeping trial registries up to date and conducting systematic reviews.
Automatic Generation of Building Models with Levels of Detail 1-3
Nguatem, W.; Drauschke, M.; Mayer, H.
2016-06-01
We present a workflow for the automatic generation of building models with levels of detail (LOD) 1 to 3 according to the CityGML standard (Gröger et al., 2012). We start with orienting unsorted image sets employing (Mayer et al., 2012), we compute depth maps using semi-global matching (SGM) (Hirschmüller, 2008), and fuse these depth maps to reconstruct dense 3D point clouds (Kuhn et al., 2014). Based on planes segmented from these point clouds, we have developed a stochastic method for roof model selection (Nguatem et al., 2013) and window model selection (Nguatem et al., 2014). We demonstrate our workflow up to the export into CityGML.
Finding weak points automatically
International Nuclear Information System (INIS)
Archinger, P.; Wassenberg, M.
1999-01-01
Operators of nuclear power stations have to carry out material tests at selected components by regular intervalls. Therefore a full automaticated test, which achieves a clearly higher reproducibility, compared to part automaticated variations, would provide a solution. In addition the full automaticated test reduces the dose of radiation for the test person. (orig.) [de
Association of GSTs polymorphisms with risk of gestational diabetes mellitus.
Li, Yan; Li, Shaoru; Zhai, Qianqian; Hai, Jie; Wang, Di; Cao, Meng; Zhang, Qinggui
2015-01-01
We conducted a case-control study to investigate the association between GSTM1, GSTT1 and GSTP1 IIe105Val polymorphisms and development of gestational diabetes mellitus in a Chinese population. A total of 320 patients with gestational diabetes mellitus and 358 pregnancy subjects were consecutively collected between January 2013 and December 2014. Genotyping for detection of GSTM1, GSTT1 and GSTP1 IIe105Val was conducted by using PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphisms) method. By Fisher's exact test, we found that the genotype distributions of GSTP1 IIe105Val were in line with the Hardy-Weinberg equilibrium in control subjects (P=0.57). By Chi-square test, we found significant differences in the genotype distributions of GSTM1 (χ(2)=11.49, P=0.001) and GSTT1 (χ(2)=18.50, Pgestational diabetes mellitus when compared with the present genotype, and the adjusted Ors (95% CI) were 1.71 (1.24-2.36) and 2.00 (1.44-2.79), respectively. However, the GSTP1 IIe105Val polymorphism was not associated with an elevated risk of gestational diabetes mellitus. In conclusion, we suggest that the GSTM1 null genotype and GSTT1 null genotype are correlated with an increased risk of gestational diabetes mellitus in a Chinese population.
Automatic Registration Method for Fusion of ZY-1-02C Satellite Images
Directory of Open Access Journals (Sweden)
Qi Chen
2013-12-01
Full Text Available Automatic image registration (AIR has been widely studied in the fields of medical imaging, computer vision, and remote sensing. In various cases, such as image fusion, high registration accuracy should be achieved to meet application requirements. For satellite images, the large image size and unstable positioning accuracy resulting from the limited manufacturing technology of charge-coupled device, focal plane distortion, and unrecorded spacecraft jitter lead to difficulty in obtaining agreeable corresponding points for registration using only area-based matching or feature-based matching. In this situation, a coarse-to-fine matching strategy integrating two types of algorithms is proven feasible and effective. In this paper, an AIR method for application to the fusion of ZY-1-02C satellite imagery is proposed. First, the images are geometrically corrected. Coarse matching, based on scale invariant feature transform, is performed for the subsampled corrected images, and a rough global estimation is made with the matching results. Harris feature points are then extracted, and the coordinates of the corresponding points are calculated according to the global estimation results. Precise matching is conducted, based on normalized cross correlation and least squares matching. As complex image distortion cannot be precisely estimated, a local estimation using the structure of triangulated irregular network is applied to eliminate the false matches. Finally, image resampling is conducted, based on local affine transformation, to achieve high-precision registration. Experiments with ZY-1-02C datasets demonstrate that the accuracy of the proposed method meets the requirements of fusion application, and its efficiency is also suitable for the commercial operation of the automatic satellite data process system.
Reciprocal regulation of LXRα activity by ASXL1 and ASXL2 in lipogenesis
Energy Technology Data Exchange (ETDEWEB)
Park, Ui-Hyun; Seong, Mi-ran [Department of Bioscience and Biotechnology, Institute of Bioscience, BK21 Graduate Program, Sejong University, Seoul 143-747 (Korea, Republic of); Kim, Eun-Joo; Hur, Wonhee; Kim, Sung Woo [Department of Molecular Biology, BK21 Graduate Program, Dankook University, Gyeonggi-do 448-701 (Korea, Republic of); Yoon, Seung Kew [The Catholic University Liver Research Center and WHO Collaborating Center of Viral Hepatitis, The Catholic University, College of Medicine, Seoul 137-701 (Korea, Republic of); Um, Soo-Jong, E-mail: umsj@sejong.ac.kr [Department of Bioscience and Biotechnology, Institute of Bioscience, BK21 Graduate Program, Sejong University, Seoul 143-747 (Korea, Republic of)
2014-01-10
Highlights: •ASXL1 and ASXL2 directly interact with ligand-bound LXRα. •Ligand-induced LXRα activity is repressed by ASXL1 and activated by ASXL2. •ASXL1 and ASXL2 bind to the LXRE of the LXRα target promoter. •ASXL1 and ASXL2 reciprocally regulate lipogenesis in liver cells. -- Abstract: Liver X receptor alpha (LXRα), a member of the nuclear receptor superfamily, plays a pivotal role in hepatic cholesterol and lipid metabolism, regulating the expression of genes associated with hepatic lipogenesis. The additional sex comb-like (ASXL) family was postulated to regulate chromatin function. Here, we investigate the roles of ASXL1 and ASXL2 in regulating LXRα activity. We found that ASXL1 suppressed ligand-induced LXRα transcriptional activity, whereas ASXL2 increased LXRα activity through direct interaction in the presence of the ligand. Chromatin immunoprecipitation (ChIP) assays showed ligand-dependent recruitment of ASXLs to ABCA1 promoters, like LXRα. Knockdown studies indicated that ASXL1 inhibits, while ASXL2 increases, lipid accumulation in H4IIE cells, similar to their roles in transcriptional regulation. We also found that ASXL1 expression increases under fasting conditions, and decreases in insulin-treated H4IIE cells and the livers of high-fat diet-fed mice. Overall, these results support the reciprocal role of the ASXL family in lipid homeostasis through the opposite regulation of LXRα.
Microprocessor controlled system for automatic and semi-automatic syntheses of radiopharmaceuticals
International Nuclear Information System (INIS)
Ruth, T.J.; Adam, M.J.; Morris, D.; Jivan, S.
1986-01-01
A computer based system has been constructed to control the automatic synthesis of 2-deoxy-2-( 18 F)fluoro-D-glucose and is also being used in the development of an automatic synthesis of L-6-( 18 F)fluorodopa. (author)
Automatic Encoding and Language Detection in the GSDL
Directory of Open Access Journals (Sweden)
Otakar Pinkas
2014-10-01
Full Text Available Automatic detection of encoding and language of the text is part of the Greenstone Digital Library Software (GSDL for building and distributing digital collections. It is developed by the University of Waikato (New Zealand in cooperation with UNESCO. The automatic encoding and language detection in Slavic languages is difficult and it sometimes fails. The aim is to detect cases of failure. The automatic detection in the GSDL is based on n-grams method. The most frequent n-grams for Czech are presented. The whole process of automatic detection in the GSDL is described. The input documents to test collections are plain texts encoded in ISO-8859-1, ISO-8859-2 and Windows-1250. We manually evaluated the quality of automatic detection. To the causes of errors belong the improper language model predominance and the incorrect switch to Windows-1250. We carried out further tests on documents that were more complex.
DEFF Research Database (Denmark)
Burelli, Paolo; Preuss, Mike
2014-01-01
Automatically generating computer animations is a challenging and complex problem with applications in games and film production. In this paper, we investigate howto translate a shot list for a virtual scene into a series of virtual camera configurations — i.e automatically controlling the virtual...
Energy Technology Data Exchange (ETDEWEB)
Martinez Flores, Marco Antonio; Tamayo Flores, G. A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: mamf@iie.org.mx; gatamayo@iie.org.mx
2010-11-15
To expand the scope of studies and technological developments in the Laboratory of Combustion of the Thermal Process Management a new experimental furnace with a capacity of 1.5 MWt was designed and built. Spray design studies with real operational evaluation (comparison of emission of Combustion products and thermal behavior) as well as information on the behavior of the NO{sub x} emissions will be produced. An automatic control system using a water cooling jacket provides the cooling of the furnace. The furnace design is modular, consisting of six sections. Currently three trials to its maximum load of operation have been performed. The results show that the global energy balance of the furnace matches the design. The flue gas residence time and temperature also match those at the exit of steam generators of big capacity. [Spanish] Para ampliar las posibilidades de estudios y desarrollos tecnologicos del laboratorio de combustion de la Gerencia de Procesos Termicos, se diseno y construyo un nuevo horno experimental con capacidad maxima de 1.5 MegaWatts termicos (MWt). Este horno permitira realizar estudios de diseno de atomizadores con evaluacion de operacion real (comparacion de emision de productos de combustion y comportamiento termico), asi como ampliar la informacion que se tiene en el comportamiento de la emision de los oxidos de nitrogeno (NO{sub x}) que se producen en el horno. El diseno del horno es modular, compuesto por seis secciones, las cuales se enfrian de forma independiente a traves de un sistema de control automatico, empleando una chaqueta de enfriamiento por la cual circula agua. Actualmente se han realizado tres encendidos hasta alcanzar su carga maxima de operacion, los resultados obtenidos muestran que el balance de energia global del horno experimental es practicamente el de diseno y cumple con las caracteristicas de tiempo de residencia y temperatura de gases a la salida del horno de Generadores de Vapor de gran capacidad.
Multi-order, automatic dispersion compensation for 1.28 Terabaud signals
Paquot, Yvan; Schröder, Jochen; Van Erps, Jürgen; Vo, Trung D.; Pelusi, Mark D.; Madden, Steve; Luther-Davies, Barry; Eggleton, Benjamin J.
2012-06-01
Transmitting ultra-high symbol rate optical signals remains a challenge due to their high sensitivity to fluctuations of GVD and higher orders of dispersion in the transmission link. Being able to cancel the impairments due to those fluctuations is a key requirement to make transmission of ultrashort optical pulses practical. We demonstrate an automatic compensation scheme able to keep an Optical Time Division Multiplexed (OTDM) signal stable at a bandwidth of up to 1.28 Tbaud in spite of external perturbations. Our approach is based on monitoring the signal with a photonic-chip-based all-optical RF-spectrum analyzer. The measurement of a single parameter extracted from the RF-spectrum is used to drive a multidimensional optimization algorithm. We apply the method to the real time simultaneous compensation for 2nd, 3rd and 4th order dispersion using an LCOS spectral pulse shaper (SPS) as a tunable dispersion compensator.
Motor automaticity in Parkinson’s disease
Wu, Tao; Hallett, Mark; Chan, Piu
2017-01-01
Bradykinesia is the most important feature contributing to motor difficulties in Parkinson’s disease (PD). However, the pathophysiology underlying bradykinesia is not fully understood. One important aspect is that PD patients have difficulty in performing learned motor skills automatically, but this problem has been generally overlooked. Here we review motor automaticity associated motor deficits in PD, such as reduced arm swing, decreased stride length, freezing of gait, micrographia and reduced facial expression. Recent neuroimaging studies have revealed some neural mechanisms underlying impaired motor automaticity in PD, including less efficient neural coding of movement, failure to shift automated motor skills to the sensorimotor striatum, instability of the automatic mode within the striatum, and use of attentional control and/or compensatory efforts to execute movements usually performed automatically in healthy people. PD patients lose previously acquired automatic skills due to their impaired sensorimotor striatum, and have difficulty in acquiring new automatic skills or restoring lost motor skills. More investigations on the pathophysiology of motor automaticity, the effect of L-dopa or surgical treatments on automaticity, and the potential role of using measures of automaticity in early diagnosis of PD would be valuable. PMID:26102020
46 CFR 161.002-10 - Automatic fire detecting system control unit.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Automatic fire detecting system control unit. 161.002-10...-10 Automatic fire detecting system control unit. (a) General. The fire detecting system control unit... and the battery to be charged. (h) Automatic fire detecting system, battery charging and control—(1...
[Automatic adjustment control system for DC glow discharge plasma source].
Wan, Zhen-zhen; Wang, Yong-qing; Li, Xiao-jia; Wang, Hai-zhou; Shi, Ning
2011-03-01
There are three important parameters in the DC glow discharge process, the discharge current, discharge voltage and argon pressure in discharge source. These parameters influence each other during glow discharge process. This paper presents an automatic control system for DC glow discharge plasma source. This system collects and controls discharge voltage automatically by adjusting discharge source pressure while the discharge current is constant in the glow discharge process. The design concept, circuit principle and control program of this automatic control system are described. The accuracy is improved by this automatic control system with the method of reducing the complex operations and manual control errors. This system enhances the control accuracy of glow discharge voltage, and reduces the time to reach discharge voltage stability. The glow discharge voltage stability test results with automatic control system are provided as well, the accuracy with automatic control system is better than 1% FS which is improved from 4% FS by manual control. Time to reach discharge voltage stability has been shortened to within 30 s by automatic control from more than 90 s by manual control. Standard samples like middle-low alloy steel and tin bronze have been tested by this automatic control system. The concentration analysis precision has been significantly improved. The RSDs of all the test result are better than 3.5%. In middle-low alloy steel standard sample, the RSD range of concentration test result of Ti, Co and Mn elements is reduced from 3.0%-4.3% by manual control to 1.7%-2.4% by automatic control, and that for S and Mo is also reduced from 5.2%-5.9% to 3.3%-3.5%. In tin bronze standard sample, the RSD range of Sn, Zn and Al elements is reduced from 2.6%-4.4% to 1.0%-2.4%, and that for Si, Ni and Fe is reduced from 6.6%-13.9% to 2.6%-3.5%. The test data is also shown in this paper.
Automatic Photoelectric Telescope Service
International Nuclear Information System (INIS)
Genet, R.M.; Boyd, L.J.; Kissell, K.E.; Crawford, D.L.; Hall, D.S.; BDM Corp., McLean, VA; Kitt Peak National Observatory, Tucson, AZ; Dyer Observatory, Nashville, TN)
1987-01-01
Automatic observatories have the potential of gathering sizable amounts of high-quality astronomical data at low cost. The Automatic Photoelectric Telescope Service (APT Service) has realized this potential and is routinely making photometric observations of a large number of variable stars. However, without observers to provide on-site monitoring, it was necessary to incorporate special quality checks into the operation of the APT Service at its multiple automatic telescope installation on Mount Hopkins. 18 references
30 CFR 77.410 - Mobile equipment; automatic warning devices.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Mobile equipment; automatic warning devices. 77... UNDERGROUND COAL MINES Safeguards for Mechanical Equipment § 77.410 Mobile equipment; automatic warning devices. (a) Mobile equipment such as front-end loaders, forklifts, tractors, graders, and trucks, except...
The Associate Principal Astronomer for AI Management of Automatic Telescopes
Henry, Gregory W.
1998-01-01
This research program in scheduling and management of automatic telescopes had the following objectives: 1. To field test the 1993 Automatic Telescope Instruction Set (ATIS93) programming language, which was specifically developed to allow real-time control of an automatic telescope via an artificial intelligence scheduler running on a remote computer. 2. To develop and test the procedures for two-way communication between a telescope controller and remote scheduler via the Internet. 3. To test various concepts in Al scheduling being developed at NASA Ames Research Center on an automatic telescope operated by Tennessee State University at the Fairborn Observatory site in southern Arizona. and 4. To develop a prototype software package, dubbed the Associate Principal Astronomer, for the efficient scheduling and management of automatic telescopes.
Automatic indexing, compiling and classification
International Nuclear Information System (INIS)
Andreewsky, Alexandre; Fluhr, Christian.
1975-06-01
A review of the principles of automatic indexing, is followed by a comparison and summing-up of work by the authors and by a Soviet staff from the Moscou INFORM-ELECTRO Institute. The mathematical and linguistic problems of the automatic building of thesaurus and automatic classification are examined [fr
AUTOMATIC WINDING GENERATION USING MATRIX REPRESENTATION - ANFRACTUS TOOL 1.0
Directory of Open Access Journals (Sweden)
Daoud Ouamara
2018-02-01
Full Text Available This paper describes an original approach dealing with AC/DC winding design in electrical machines. A research software called “ANFRACTUS Tool 1.0”, allowing automatic generation of all windings in multi-phases electrical machines, has been developed using the matrix representation. Unlike existent methods, where the aim is to synthesize a winding with higher performances, the proposed method provides the opportunity to choose between all doable windings. The specificity of this approach is based on the fact that it take only the slots, phases and layers number as input parameters. The poles number is not requested to run the generation process. Windings generation by matrix representation may be applied for any number of slots, phases and layers. The software do not deal with the manner that coils are connected but just the emplacement of coils in each slot with its current sense. The waveform and the harmonic spectrum of the total magnetomotive force (MMF are given as result.
12 CFR 19.244 - Automatic removal, suspension, and debarment.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Automatic removal, suspension, and debarment. 19.244 Section 19.244 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES... Services § 19.244 Automatic removal, suspension, and debarment. (a) An independent public accountant or...
Automatic contact in DYNA3D for vehicle crashworthiness
International Nuclear Information System (INIS)
Whirley, R.G.; Engelmann, B.E.
1994-01-01
This paper presents a new formulation for the automatic definition and treatment of mechanical contact in explicit, nonlinear, finite element analysis. Automatic contact offers the benefits of significantly reduced model construction time and fewer opportunities for user error, but faces significant challenges in reliability and computational costs. The authors have used a new four-step automatic contact algorithm. Key aspects of the proposed method include (1) automatic identification of adjacent and opposite surfaces in the global search phase, and (2) the use of a smoothly varying surface normal that allows a consistent treatment of shell intersection and corner contact conditions without ad hoc rules. Three examples are given to illustrate the performance of the newly proposed algorithm in the public DYNA3D code
30 CFR 75.1103-2 - Automatic fire sensors; approved components; installation requirements.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic fire sensors; approved components... Protection § 75.1103-2 Automatic fire sensors; approved components; installation requirements. (a) The components of each automatic fire sensor required to be installed in accordance with the provisions of § 75...
Automatic sets and Delone sets
International Nuclear Information System (INIS)
Barbe, A; Haeseler, F von
2004-01-01
Automatic sets D part of Z m are characterized by having a finite number of decimations. They are equivalently generated by fixed points of certain substitution systems, or by certain finite automata. As examples, two-dimensional versions of the Thue-Morse, Baum-Sweet, Rudin-Shapiro and paperfolding sequences are presented. We give a necessary and sufficient condition for an automatic set D part of Z m to be a Delone set in R m . The result is then extended to automatic sets that are defined as fixed points of certain substitutions. The morphology of automatic sets is discussed by means of examples
Development of Automatic Remote Exposure Controller for Gamma Radiography
International Nuclear Information System (INIS)
Joo, Gwang Tae; Shin, Jin Seong; Kim, Dong Eun; Song, Jung Ho; Choo, Seung Hwan; Chang, Hong Keun
2002-01-01
Recently, gamma radiographic equipment have been used about 1,000 sets manually and operated by about 2,500 persons in Korea. In order for a radiography to work effectively with avoiding any hazard of the high level radiation from the source, many field workers have expected developing a wireless automatic remote exposure controller. The KlTCO research team has developed an automatic remote exposure controller that can regulate the speed of 0.4∼1.2m/s by BLDC motor of 24V 200W which has output of 54 kgf·, suitable torque and safety factor for the work. And the developed automatic remote exposure controller can control rpm of motor, pigtail position by photo-sensor and exposure time by timer to RF sensor. Thus, the developed equipment is expected that the unit can be used in many practical applications with benefits in economical advantage to combine the use of both automatic and manual type because attachment is possible existent manual remote exposure controller, AC and DC combined use
Automatic map generalisation from research to production
Nyberg, Rose; Johansson, Mikael; Zhang, Yang
2018-05-01
The manual work of map generalisation is known to be a complex and time consuming task. With the development of technology and societies, the demands for more flexible map products with higher quality are growing. The Swedish mapping, cadastral and land registration authority Lantmäteriet has manual production lines for databases in five different scales, 1 : 10 000 (SE10), 1 : 50 000 (SE50), 1 : 100 000 (SE100), 1 : 250 000 (SE250) and 1 : 1 million (SE1M). To streamline this work, Lantmäteriet started a project to automatically generalise geographic information. Planned timespan for the project is 2015-2022. Below the project background together with the methods for the automatic generalisation are described. The paper is completed with a description of results and conclusions.
1989-12-15
ORDER NO. 1 BOOK 2 OF 5 DATABASE DOCUMENTATION BOOK 00-ALC MANPRA *(C5 MAIN LANDING GEAR- WCD’S) CONTRACT SUMMARY REPORT , 15 DECEMBER 1989 ’.1 - CONTRACT...ORIQ 1 . T A 1~4 M E* X C I" El 1 -:11 E:XCE:EI:IIE:U RE:CORI’ RFiS CvAUiS FOREXE IN REWORK LI[MITS Ill FINAL DESTINATION 22. COOROINATION/INITIATING MCC
Automatisms: bridging clinical neurology with criminal law.
Rolnick, Joshua; Parvizi, Josef
2011-03-01
The law, like neurology, grapples with the relationship between disease states and behavior. Sometimes, the two disciplines share the same terminology, such as automatism. In law, the "automatism defense" is a claim that action was involuntary or performed while unconscious. Someone charged with a serious crime can acknowledge committing the act and yet may go free if, relying on the expert testimony of clinicians, the court determines that the act of crime was committed in a state of automatism. In this review, we explore the relationship between the use of automatism in the legal and clinical literature. We close by addressing several issues raised by the automatism defense: semantic ambiguity surrounding the term automatism, the presence or absence of consciousness during automatisms, and the methodological obstacles that have hindered the study of cognition during automatisms. Copyright © 2010 Elsevier Inc. All rights reserved.
Automatic Computer Mapping of Terrain
Smedes, H. W.
1971-01-01
Computer processing of 17 wavelength bands of visible, reflective infrared, and thermal infrared scanner spectrometer data, and of three wavelength bands derived from color aerial film has resulted in successful automatic computer mapping of eight or more terrain classes in a Yellowstone National Park test site. The tests involved: (1) supervised and non-supervised computer programs; (2) special preprocessing of the scanner data to reduce computer processing time and cost, and improve the accuracy; and (3) studies of the effectiveness of the proposed Earth Resources Technology Satellite (ERTS) data channels in the automatic mapping of the same terrain, based on simulations, using the same set of scanner data. The following terrain classes have been mapped with greater than 80 percent accuracy in a 12-square-mile area with 1,800 feet of relief; (1) bedrock exposures, (2) vegetated rock rubble, (3) talus, (4) glacial kame meadow, (5) glacial till meadow, (6) forest, (7) bog, and (8) water. In addition, shadows of clouds and cliffs are depicted, but were greatly reduced by using preprocessing techniques.
Application of nonlinear transformations to automatic flight control
Meyer, G.; Su, R.; Hunt, L. R.
1984-01-01
The theory of transformations of nonlinear systems to linear ones is applied to the design of an automatic flight controller for the UH-1H helicopter. The helicopter mathematical model is described and it is shown to satisfy the necessary and sufficient conditions for transformability. The mapping is constructed, taking the nonlinear model to canonical form. The performance of the automatic control system in a detailed simulation on the flight computer is summarized.
Directory of Open Access Journals (Sweden)
Yu. A. Zenovich-Leshkevich-Ol’pinskiy
2015-01-01
Full Text Available In order to reduce losses in the cooling source (condenser and to increase effectiveness of fuel-and-power resources utilization, the authors present a modern automatic ball-cleaning system for the pipes of condenser 180-KTsS-1 of turbine unit Т-180/210-130-1 LMZ of Gomel CHP-2. The article examines exploitation challenges of the steam turbine condensers and methods of clearing them from sedimentations. Depending on the sedimentation character and composition, and the quality of cooling water at the power plant, they apply various methods of the condenser tubes clearing: heat drying, vacuum dehydration, acid-washing, pipes-shooting with water and water-air pistols, ablution with high-pressure water jet etc. All the applied cleaning methods are the periodical means to fight the sedimentations and require the turbine halting or unloading, predetermine the equipment operating between clearings with constantly smearing cooling surfaces of the condensers, i.e. with reduced efficiency of equipment operation.The installation of the ball-cleaning system practically excludes defects of the chemical and mechanical cleaning methods, which leads to the condenser pipes life-in-service increase, the full-flow condensate quality improvement, reliability and efficient performance enhancement of the steam turbines equipment. The authors consider developed algorithms of data processing and designed system control of the condenser cleaning that allowed realizing its operation in automatic mode.
Insulin stimulates the expression of the SHARP-1 gene via multiple signaling pathways.
Takagi, K; Asano, K; Haneishi, A; Ono, M; Komatsu, Y; Yamamoto, T; Tanaka, T; Ueno, H; Ogawa, W; Tomita, K; Noguchi, T; Yamada, K
2014-06-01
The rat enhancer of split- and hairy-related protein-1 (SHARP-1) is a basic helix-loop-helix transcription factor. An issue of whether SHARP-1 is an insulin-inducible transcription factor was examined. Insulin rapidly increased the level of SHARP-1 mRNA both in vivo and in vitro. Then, signaling pathways involved with the increase of SHARP-1 mRNA by insulin were determined in H4IIE rat hepatoma cells. Pretreatments with LY294002, wortmannin, and staurosporine completely blocked the induction effect, suggesting the involvement of both phosphoinositide 3-kinase (PI 3-K) and protein kinase C (PKC) pathways. In fact, overexpression of a dominant negative form of atypical protein kinase C lambda (aPKCλ) significantly decreased the induction of the SHARP-1 mRNA. In addition, inhibitors for the small GTPase Rac or Jun N-terminal kinase (JNK) also blocked the induction of SHARP-1 mRNA by insulin. Overexpression of a dominant negative form of Rac1 prevented the activation by insulin. Furthermore, actinomycin D and cycloheximide completely blocked the induction of SHARP-1 mRNA by insulin. Finally, when a SHARP-1 expression plasmid was transiently transfected with various reporter plasmids into H4IIE cells, the promoter activity of PEPCK reporter plasmid was specifically decreased. Thus, we conclude that insulin induces the SHARP-1 gene expression at the transcription level via a both PI 3-K/aPKCλ/JNK- and a PI 3-K/Rac/JNK-signaling pathway; protein synthesis is required for this induction; and that SHARP-1 is a potential repressor of the PEPCK gene expression. © Georg Thieme Verlag KG Stuttgart · New York.
Servant, Mathieu; Cassey, Peter; Woodman, Geoffrey F.; Logan, Gordon D.
2018-01-01
Automaticity allows us to perform tasks in a fast, efficient, and effortless manner after sufficient practice. Theories of automaticity propose that across practice processing transitions from being controlled by working memory to being controlled by long-term memory retrieval. Recent event-related potential (ERP) studies have sought to test this…
30 CFR 75.1103-6 - Automatic fire sensors; actuation of fire suppression systems.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic fire sensors; actuation of fire... Protection § 75.1103-6 Automatic fire sensors; actuation of fire suppression systems. Point-type heat sensors or automatic fire sensor and warning device systems may be used to actuate deluge-type water systems...
Liu, J.
2008-01-01
A presumption of most consumer research is that consumers endeavor to maximize the utility of their choices and are in complete control of their purchasing and consumption behavior. However, everyday life experience suggests that many of our choices are not all that reasoned or conscious. Indeed, automaticity, one facet of behavior, is indispensable to complete the portrait of consumers. Despite its importance, little attention is paid to how the automatic side of behavior can be captured and...
Diagnostic accuracy of automatic normalization of CBV in glioma grading using T1- weighted DCE-MRI.
Sahoo, Prativa; Gupta, Rakesh K; Gupta, Pradeep K; Awasthi, Ashish; Pandey, Chandra M; Gupta, Mudit; Patir, Rana; Vaishya, Sandeep; Ahlawat, Sunita; Saha, Indrajit
2017-12-01
Aim of this retrospective study was to compare diagnostic accuracy of proposed automatic normalization method to quantify the relative cerebral blood volume (rCBV) with existing contra-lateral region of interest (ROI) based CBV normalization method for glioma grading using T1-weighted dynamic contrast enhanced MRI (DCE-MRI). Sixty patients with histologically confirmed gliomas were included in this study retrospectively. CBV maps were generated using T1-weighted DCE-MRI and are normalized by contralateral ROI based method (rCBV_contra), unaffected white matter (rCBV_WM) and unaffected gray matter (rCBV_GM), the latter two of these were generated automatically. An expert radiologist with >10years of experience in DCE-MRI and a non-expert with one year experience were used independently to measure rCBVs. Cutoff values for glioma grading were decided from ROC analysis. Agreement of histology with rCBV_WM, rCBV_GM and rCBV_contra respectively was studied using Kappa statistics and intra-class correlation coefficient (ICC). The diagnostic accuracy of glioma grading using the measured rCBV_contra by expert radiologist was found to be high (sensitivity=1.00, specificity=0.96, pnormalization method showed same percentage of agreement for both expert and non-expert user. rCBV_WM showed an agreement of 88.33% (kappa=0.76,pnormalization of CBV using the proposed method could provide better diagnostic accuracy compared to the manual contralateral based approach. Copyright © 2017 Elsevier Inc. All rights reserved.
Automatic welding and cladding in heavy fabrication
International Nuclear Information System (INIS)
Altamer, A. de
1980-01-01
A description is given of the automatic welding processes used by an Italian fabricator of pressure vessels for petrochemical and nuclear plant. The automatic submerged arc welding, submerged arc strip cladding, pulsed TIG, hot wire TIG and MIG welding processes have proved satisfactory in terms of process reliability, metal deposition rate, and cost effectiveness for low alloy and carbon steels. An example shows sequences required during automatic butt welding, including heat treatments. Factors which govern satisfactory automatic welding include automatic anti-drift rotator device, electrode guidance and bead programming system, the capability of single and dual head operation, flux recovery and slag removal systems, operator environment and controls, maintaining continuity of welding and automatic reverse side grinding. Automatic welding is used for: joining vessel sections; joining tubes to tubeplate; cladding of vessel rings and tubes, dished ends and extruded nozzles; nozzle to shell and butt welds, including narrow gap welding. (author)
Experience in designing the automatic nuclear power plant control system
International Nuclear Information System (INIS)
Sedov, V.K.; Busygin, B.F.; Eliseeva, O.V.; Mikhajlov, V.A.
1981-01-01
The integrated automatic control system (ACS) is designed at the Novovoronezh NPP (NVNPP). It comprises automatic technological control of all the five power un+ts and the plant in the whole (ACST) and automatic organizational-economic production control system (ACSP). The NVNPP ACS is designed as a two-level system. The two M-4030 and M-4030-1 computers are the technical base of the upper layer while a set of block NPP (computer-M-60 and M-700 for unit 5; M-60 and SM-2 for units 1-4) of the lower level. Block diagram of the NVNPP ACS, flowsheet of NVNPP ACS technical means and external communications of the control centre are described. The NVNPP ACS is supposed to be put into operation by stages. It is noted that design and introduction of the typical NPP ACS at the NVNPP permits to maximally reduce in the future the period of developing automatic control systems at nly introduced units and NPPs with the WWER reactors [ru
Simplified automatic on-line document searching
International Nuclear Information System (INIS)
Ebinuma, Yukio
1983-01-01
The author proposed searching method for users who need not-comprehensive retrieval. That is to provide flexible number of related documents for the users automatically. A group of technical terms are used as search terms to express an inquiry. Logical sums of the terms in the ascending order of frequency of the usage are prepared sequentially and automatically, and then the search formulas, qsub(m) and qsub(m-1) which meet certain threshold values are selected automatically also. Users justify precision of the search output up to 20 items retrieved by the formula qsub(m). If a user wishes more than 30% of recall ratio, the serach result should be output by qsub(m), and if he wishes less than 30% of it, it should be output by qsub(m-1). The search by this method using one year volume of INIS Database (76,600 items) and five inquiries resulted in 32% of recall ratio and 36% of precision ratio on the average in the case of qsub(m). The connecting time of a terminal was within 15 minutes per an inquiry. It showed more efficiency than that of an inexperienced searcher. The method can be applied to on-line searching system for database in which natural language only or natural language and controlled vocabulary are used. (author)
Automatic differentiation of functions
International Nuclear Information System (INIS)
Douglas, S.R.
1990-06-01
Automatic differentiation is a method of computing derivatives of functions to any order in any number of variables. The functions must be expressible as combinations of elementary functions. When evaluated at specific numerical points, the derivatives have no truncation error and are automatically found. The method is illustrated by simple examples. Source code in FORTRAN is provided
A new uranium automatic analyzer
International Nuclear Information System (INIS)
Xia Buyun; Zhu Yaokun; Wang Bin; Cong Peiyuan; Zhang Lan
1993-01-01
A new uranium automatic analyzer based on the flow injection analysis (FIA) principle has been developed. It consists of a multichannel peristaltic pump, an injection valve, a photometric detector, a single-chip microprocessor system and electronic circuit. The new designed multifunctional auto-injection valve can automatically change the injection volume of the sample and the channels so that the determination ranges and items can easily be changed. It also can make the instrument vary the FIA operation modes that it has functions of a universal instrument. A chromatographic column with extractant-containing resin was installed in the manifold of the analyzer for the concentration and separation of trace uranium. The 2-(5-bromo-2-pyridylazo)-5-diethyl-aminophenol (Br-PADAP) was used as colour reagent. Uranium was determined in the aqueous solution by adding cetyl-pyridium bromide (CPB). The uranium in the solution in the range 0.02-500 mg · L -1 can be directly determined without any pretreatment. A sample throughput rate of 30-90 h -1 and reproducibility of 1-2% were obtained. The analyzer has been satisfactorily applied to the laboratory and the plant
Application of automatic gain control for radiometer diagnostic in SST-1 tokamak.
Makwana, Foram R; Siju, Varsha; Edappala, Praveenlal; Pathak, S K
2017-12-01
This paper describes the characterisation of a negative feedback type of automatic gain control (AGC) circuit that will be an integral part of the heterodyne radiometer system operating at a frequency range of 75-86 GHz at SST-1 tokamak. The developed AGC circuit is a combination of variable gain amplifier and log amplifier which provides both gain and attenuation typically up to 15 dB and 45 dB, respectively, at a fixed set point voltage and it has been explored for the first time in tokamak radiometry application. The other important characteristics are that it exhibits a very fast response time of 390 ns to understand the fast dynamics of electron cyclotron emission and can operate at very wide input RF power dynamic range of around 60 dB that ensures signal level within the dynamic range of the detection system.
Facilitating coronary artery evaluation in MDCT using a 3D automatic vessel segmentation tool
International Nuclear Information System (INIS)
Fawad Khan, M.; Gurung, Jessen; Maataoui, Adel; Brehmer, Boris; Herzog, Christopher; Vogl, Thomas J.; Wesarg, Stefan; Dogan, Selami; Ackermann, Hanns; Assmus, Birgit
2006-01-01
The purpose of this study was to investigate a 3D coronary artery segmentation algorithm using 16-row MDCT data sets. Fifty patients underwent cardiac CT (Sensation 16, Siemens) and coronary angiography. Automatic and manual detection of coronary artery stenosis was performed. A 3D coronary artery segmentation algorithm (Fraunhofer Institute for Computer Graphics, Darmstadt) was used for automatic evaluation. All significant stenoses (>50%) in vessels >1.5 mm in diameter were protocoled. Each detection tool was used by one reader who was blinded to the results of the other detection method and the results of coronary angiography. Sensitivity and specificity were determined for automatic and manual detection as well as was the time for both CT-based evaluation methods. The overall sensitivity and specificity of the automatic and manual approach were 93.1 vs. 95.83% and 86.1 vs. 81.9%. The time required for automatic evaluation was significantly shorter than with the manual approach, i.e., 246.04±43.17 s for the automatic approach and 526.88±45.71 s for the manual approach (P<0.0001). In 94% of the coronary artery branches, automatic detection required less time than the manual approach. Automatic coronary vessel evaluation is feasible. It reduces the time required for cardiac CT evaluation with similar sensitivity and specificity as well as facilitates the evaluation of MDCT coronary angiography in a standardized fashion. (orig.)
Solar Powered Automatic Shrimp Feeding System
Directory of Open Access Journals (Sweden)
Dindo T. Ani
2015-12-01
Full Text Available - Automatic system has brought many revolutions in the existing technologies. One among the technologies, which has greater developments, is the solar powered automatic shrimp feeding system. For instance, the solar power which is a renewable energy can be an alternative solution to energy crisis and basically reducing man power by using it in an automatic manner. The researchers believe an automatic shrimp feeding system may help solve problems on manual feeding operations. The project study aimed to design and develop a solar powered automatic shrimp feeding system. It specifically sought to prepare the design specifications of the project, to determine the methods of fabrication and assembly, and to test the response time of the automatic shrimp feeding system. The researchers designed and developed an automatic system which utilizes a 10 hour timer to be set in intervals preferred by the user and will undergo a continuous process. The magnetic contactor acts as a switch connected to the 10 hour timer which controls the activation or termination of electrical loads and powered by means of a solar panel outputting electrical power, and a rechargeable battery in electrical communication with the solar panel for storing the power. By undergoing through series of testing, the components of the modified system were proven functional and were operating within the desired output. It was recommended that the timer to be used should be tested to avoid malfunction and achieve the fully automatic system and that the system may be improved to handle changes in scope of the project.
Efficient Semi-Automatic 3D Segmentation for Neuron Tracing in Electron Microscopy Images
Jones, Cory; Liu, Ting; Cohan, Nathaniel Wood; Ellisman, Mark; Tasdizen, Tolga
2015-01-01
0.1. Background In the area of connectomics, there is a significant gap between the time required for data acquisition and dense reconstruction of the neural processes contained in the same dataset. Automatic methods are able to eliminate this timing gap, but the state-of-the-art accuracy so far is insufficient for use without user corrections. If completed naively, this process of correction can be tedious and time consuming. 0.2. New Method We present a new semi-automatic method that can be used to perform 3D segmentation of neurites in EM image stacks. It utilizes an automatic method that creates a hierarchical structure for recommended merges of superpixels. The user is then guided through each predicted region to quickly identify errors and establish correct links. 0.3. Results We tested our method on three datasets with both novice and expert users. Accuracy and timing were compared with published automatic, semi-automatic, and manual results. 0.4. Comparison with Existing Methods Post-automatic correction methods have also been used in [1] and [2]. These methods do not provide navigation or suggestions in the manner we present. Other semi-automatic methods require user input prior to the automatic segmentation such as [3] and [4] and are inherently different than our method. 0.5. Conclusion Using this method on the three datasets, novice users achieved accuracy exceeding state-of-the-art automatic results, and expert users achieved accuracy on par with full manual labeling but with a 70% time improvement when compared with other examples in publication. PMID:25769273
Experience in automatic processing of 340.000 images from ITEF 3-m magnetic spectrometer
International Nuclear Information System (INIS)
Dzhelyadin, R.I.; Dukhovskoj, I.A.; Ivanov, L.V.; Kishkurno, V.V.; Krutenkova, A.P.; Kulikov, V.V.; Lyulevich, V.I.; Polikarpov, V.M.; Radkevich, I.A.; Fedorets, V.S.; Fedotov, O.P.
1974-01-01
A number of conclusions were made regarding automatic processing of 340.000 pictures (1.020.000 frames) developed on a three-meter magnetic spectrometer with spark chambers. Possibilities for time optimization of automatic processing programs are discussed. The results of processing of a series of photographs were analysed to compare the paramters of automatic ans semi-automatic processing. Some problems relating to organization and technology of picture processing are also autlined [ru
Torres Moreno, Juan Manuel
2014-01-01
This new textbook examines the motivations and the different algorithms for automatic document summarization (ADS). We performed a recent state of the art. The book shows the main problems of ADS, difficulties and the solutions provided by the community. It presents recent advances in ADS, as well as current applications and trends. The approaches are statistical, linguistic and symbolic. Several exemples are included in order to clarify the theoretical concepts. The books currently available in the area of Automatic Document Summarization are not recent. Powerful algorithms have been develop
DEFF Research Database (Denmark)
Moshavegh, Ramin
on the user adjustments on the scanner interface to optimize the scan settings. This explains the huge interest in the subject of this PhD project entitled “AUTOMATIC ULTRASOUND SCANNING”. The key goals of the project have been to develop automated techniques to minimize the unnecessary settings...... on the scanners, and to improve the computer-aided diagnosis (CAD) in ultrasound by introducing new quantitative measures. Thus, four major issues concerning automation of the medical ultrasound are addressed in this PhD project. They touch upon gain adjustments in ultrasound, automatic synthetic aperture image...
Detecting accuracy of flaws by manual and automatic ultrasonic inspections
International Nuclear Information System (INIS)
Iida, K.
1988-01-01
As the final stage work in the nine year project on proving tests of the ultrasonic inspection technique applied to the ISI of LWR plants, automatic ultrasonic inspection tests were carried out on EDM notches, surface fatigue cracks, weld defects and stress corrosion cracks, which were deliberately introduced in full size structural components simulating a 1,100 MWe BWR. Investigated items are the performance of a newly assembled automatic inspection apparatus, detection limit of flaws, detection resolution of adjacent collinear or parallel EDM notches, detection reproducibility and detection accuracy. The manual ultrasonic inspection of the same flaws as inspected by the automatic ultrasonic inspection was also carried out in order to have comparative data. This paper reports how it was confirmed that the automatic ultrasonic inspection is much superior to the manual inspection in the flaw detection rate and in the detection reproducibility
Semi-Automatic Removal of Foreground Stars from Images of Galaxies
Frei, Zsolt
1996-07-01
A new procedure, designed to remove foreground stars from galaxy proviles is presented here. Although several programs exist for stellar and faint object photometry, none of them treat star removal from the images very carefully. I present my attempt to develop such a system, and briefly compare the performance of my software to one of the well-known stellar photometry packages, DAOPhot (Stetson 1987). Major steps in my procedure are: (1) automatic construction of an empirical 2D point spread function from well separated stars that are situated off the galaxy; (2) automatic identification of those peaks that are likely to be foreground stars, scaling the PSF and removing these stars, and patching residuals (in the automatically determined smallest possible area where residuals are truly significant); and (3) cosmetic fix of remaining degradations in the image. The algorithm and software presented here is significantly better for automatic removal of foreground stars from images of galaxies than DAOPhot or similar packages, since: (a) the most suitable stars are selected automatically from the image for the PSF fit; (b) after star-removal an intelligent and automatic procedure removes any possible residuals; (c) unlimited number of images can be cleaned in one run without any user interaction whatsoever. (SECTION: Computing and Data Analysis)
Method for automatic control rod operation using rule-based control
International Nuclear Information System (INIS)
Kinoshita, Mitsuo; Yamada, Naoyuki; Kiguchi, Takashi
1988-01-01
An automatic control rod operation method using rule-based control is proposed. Its features are as follows: (1) a production system to recognize plant events, determine control actions and realize fast inference (fast selection of a suitable production rule), (2) use of the fuzzy control technique to determine quantitative control variables. The method's performance was evaluated by simulation tests on automatic control rod operation at a BWR plant start-up. The results were as follows; (1) The performance which is related to stabilization of controlled variables and time required for reactor start-up, was superior to that of other methods such as PID control and program control methods, (2) the process time to select and interpret the suitable production rule, which was the same as required for event recognition or determination of control action, was short (below 1 s) enough for real time control. The results showed that the method is effective for automatic control rod operation. (author)
Automatic control systems engineering
International Nuclear Information System (INIS)
Shin, Yun Gi
2004-01-01
This book gives descriptions of automatic control for electrical electronics, which indicates history of automatic control, Laplace transform, block diagram and signal flow diagram, electrometer, linearization of system, space of situation, state space analysis of electric system, sensor, hydro controlling system, stability, time response of linear dynamic system, conception of root locus, procedure to draw root locus, frequency response, and design of control system.
Evaluation of semi-automatic arterial stenosis quantification
International Nuclear Information System (INIS)
Hernandez Hoyos, M.; Universite Claude Bernard Lyon 1, 69 - Villeurbanne; Univ. de los Andes, Bogota; Serfaty, J.M.; Douek, P.C.; Universite Claude Bernard Lyon 1, 69 - Villeurbanne; Hopital Cardiovasculaire et Pneumologique L. Pradel, Bron; Maghiar, A.; Mansard, C.; Orkisz, M.; Magnin, I.; Universite Claude Bernard Lyon 1, 69 - Villeurbanne
2006-01-01
Object: To assess the accuracy and reproducibility of semi-automatic vessel axis extraction and stenosis quantification in 3D contrast-enhanced Magnetic Resonance Angiography (CE-MRA) of the carotid arteries (CA). Materials and methods: A total of 25 MRA datasets was used: 5 phantoms with known stenoses, and 20 patients (40 CAs) drawn from a multicenter trial database. Maracas software extracted vessel centerlines and quantified the stenoses, based on boundary detection in planes perpendicular to the centerline. Centerline accuracy was visually scored. Semi-automatic measurements were compared with: (1) theoretical phantom morphometric values, and (2) stenosis degrees evaluated by two independent radiologists. Results: Exploitable centerlines were obtained in 97% of CA and in all phantoms. In phantoms, the software achieved a better agreement with theoretic stenosis degrees (weighted kappa Κ W = 0.91) than the radiologists (Κ W = 0.69). In patients, agreement between software and radiologists varied from Κ W =0.67 to 0.90. In both, Maracas was substantially more reproducible than the readers. Mean operating time was within 1 min/ CA. Conclusion: Maracas software generates accurate 3D centerlines of vascular segments with minimum user intervention. Semi-automatic quantification of CA stenosis is also accurate, except in very severe stenoses that cannot be segmented. It substantially reduces the inter-observer variability. (orig.)
14 CFR Appendix I to Part 25 - Installation of an Automatic Takeoff Thrust Control System (ATTCS)
2010-01-01
... Appendix I to Part 25—Installation of an Automatic Takeoff Thrust Control System (ATTCS) I25.1General. (a... crew to increase thrust or power. I25.2Definitions. (a) Automatic Takeoff Thrust Control System (ATTCS... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Installation of an Automatic Takeoff Thrust...
The CHilean Automatic Supernova sEarch
DEFF Research Database (Denmark)
Hamuy, M.; Pignata, G.; Maza, J.
2012-01-01
The CHilean Automatic Supernova sEarch (CHASE) project began in 2007 with the goal to discover young, nearby southern supernovae in order to (1) better understand the physics of exploding stars and their progenitors, and (2) refine the methods to derive extragalactic distances. During the first...
Automatic production of Iodine-123 with PLC 135/U
International Nuclear Information System (INIS)
Moghaddam-Banaem, L.; Afarideh, H.
2004-01-01
In this project, the automatic system for production of Iodine-123 with PLC/135μ Siemens, which is designed and installed for the first time in Iran, is discussed. The PLC (Programmable Logic Controller) is used to control industrial processing, which is similar to a computer and consists of central processing unit and memory and Input/Output units. PLC receives input information from auxiliary units such as sensors, switches, etc. and software processes data in memory and then sends commands to output units such as relays, motors, etc.The target section in Iodine production consists of 8 stages. In order to be sure automation works properly the system can be operated both manually and automatically. First PLC checks Manual/Automatic switch and in the case of automatic mode, PLC runs the program in memory and processing is done automatically. For this purpose, PLC takes the value of pressures and temperatures from analog inputs and after processing them it sends commands to digital output to activate valves or vacuum pumps or heaters. In this paper the following subjects are discussed: 1) Production of Iodine 123 2) PLC structure and auxiliary boards 3) Sensors and actuators and their connection to PLC 4) Software flowchart
International Nuclear Information System (INIS)
Yabuuchi, Noriaki; Nakazawa, Toshio; Takahashi, Hiroki; Shimazaki, Junya; Hoshi, Tsutao
1997-11-01
An automatic operation system has been developed for the purpose of realizing a perfect automatic plant operation after reactor scram events. The goal of the automatic operation after a reactor scram event is to bring the reactor hot stand-by condition automatically. The basic functions of this system are as follows; to monitor actions of the equipments of safety actions after a reactor scram, to control necessary control equipments to bring a reactor to a hot stand-by condition automatically, and to energize a decay heat removal system. The performance evaluation on this system was carried out by comparing the results using to Nuclear Ship Engineering Simulation System (NESSY) and the those measured in the scram test of the nuclear ship 'Mutsu'. As the result, it was showed that this system had the sufficient performance to bring a reactor to a hot syand-by condition quickly and safety. (author)
Energy Technology Data Exchange (ETDEWEB)
Yabuuchi, Noriaki; Nakazawa, Toshio; Takahashi, Hiroki; Shimazaki, Junya; Hoshi, Tsutao [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-11-01
An automatic operation system has been developed for the purpose of realizing a perfect automatic plant operation after reactor scram events. The goal of the automatic operation after a reactor scram event is to bring the reactor hot stand-by condition automatically. The basic functions of this system are as follows; to monitor actions of the equipments of safety actions after a reactor scram, to control necessary control equipments to bring a reactor to a hot stand-by condition automatically, and to energize a decay heat removal system. The performance evaluation on this system was carried out by comparing the results using to Nuclear Ship Engineering Simulation System (NESSY) and the those measured in the scram test of the nuclear ship `Mutsu`. As the result, it was showed that this system had the sufficient performance to bring a reactor to a hot syand-by condition quickly and safety. (author)
Automatic exchange unit for control rod drive device
International Nuclear Information System (INIS)
Nasu, Seiji; Sasaki, Masayoshi.
1982-01-01
Purpose: To enable automatic reoperation and continuation without external power interruption remedy device at the time of recovering the interrupted power soruce during automatic positioning operation. Constitution: In case of an automatic exchange unit for a control rod drive device of the control type for setting the deviation between the positioning target position and the present position of the device to zero, the position data of the drive device of the positioning target value of the device is automatically read, and an interlock of operation inhibit is applied to a control system until the data reading is completed and automatic operation start or restart conditions are sequentially confirmed. After the confirmation, the interlock is released to start the automatic operation or reoperation. Accordingly, the automatic operation can be safely restarted and continued. (Yoshihara, H.)
International Nuclear Information System (INIS)
Qiu, J; Li, H. Harlod; Zhang, T; Yang, D; Ma, F
2015-01-01
Purpose: In RT patient setup 2D images, tissues often cannot be seen well due to the lack of image contrast. Contrast enhancement features provided by image reviewing software, e.g. Mosaiq and ARIA, require manual selection of the image processing filters and parameters thus inefficient and cannot be automated. In this work, we developed a novel method to automatically enhance the 2D RT image contrast to allow automatic verification of patient daily setups as a prerequisite step of automatic patient safety assurance. Methods: The new method is based on contrast limited adaptive histogram equalization (CLAHE) and high-pass filtering algorithms. The most important innovation is to automatically select the optimal parameters by optimizing the image contrast. The image processing procedure includes the following steps: 1) background and noise removal, 2) hi-pass filtering by subtracting the Gaussian smoothed Result, and 3) histogram equalization using CLAHE algorithm. Three parameters were determined through an iterative optimization which was based on the interior-point constrained optimization algorithm: the Gaussian smoothing weighting factor, the CLAHE algorithm block size and clip limiting parameters. The goal of the optimization is to maximize the entropy of the processed Result. Results: A total 42 RT images were processed. The results were visually evaluated by RT physicians and physicists. About 48% of the images processed by the new method were ranked as excellent. In comparison, only 29% and 18% of the images processed by the basic CLAHE algorithm and by the basic window level adjustment process, were ranked as excellent. Conclusion: This new image contrast enhancement method is robust and automatic, and is able to significantly outperform the basic CLAHE algorithm and the manual window-level adjustment process that are currently used in clinical 2D image review software tools
Energy Technology Data Exchange (ETDEWEB)
Qiu, J [Taishan Medical University, Taian, Shandong (China); Washington University in St Louis, St Louis, MO (United States); Li, H. Harlod; Zhang, T; Yang, D [Washington University in St Louis, St Louis, MO (United States); Ma, F [Taishan Medical University, Taian, Shandong (China)
2015-06-15
Purpose: In RT patient setup 2D images, tissues often cannot be seen well due to the lack of image contrast. Contrast enhancement features provided by image reviewing software, e.g. Mosaiq and ARIA, require manual selection of the image processing filters and parameters thus inefficient and cannot be automated. In this work, we developed a novel method to automatically enhance the 2D RT image contrast to allow automatic verification of patient daily setups as a prerequisite step of automatic patient safety assurance. Methods: The new method is based on contrast limited adaptive histogram equalization (CLAHE) and high-pass filtering algorithms. The most important innovation is to automatically select the optimal parameters by optimizing the image contrast. The image processing procedure includes the following steps: 1) background and noise removal, 2) hi-pass filtering by subtracting the Gaussian smoothed Result, and 3) histogram equalization using CLAHE algorithm. Three parameters were determined through an iterative optimization which was based on the interior-point constrained optimization algorithm: the Gaussian smoothing weighting factor, the CLAHE algorithm block size and clip limiting parameters. The goal of the optimization is to maximize the entropy of the processed Result. Results: A total 42 RT images were processed. The results were visually evaluated by RT physicians and physicists. About 48% of the images processed by the new method were ranked as excellent. In comparison, only 29% and 18% of the images processed by the basic CLAHE algorithm and by the basic window level adjustment process, were ranked as excellent. Conclusion: This new image contrast enhancement method is robust and automatic, and is able to significantly outperform the basic CLAHE algorithm and the manual window-level adjustment process that are currently used in clinical 2D image review software tools.
Position automatic determination technology
International Nuclear Information System (INIS)
1985-10-01
This book tells of method of position determination and characteristic, control method of position determination and point of design, point of sensor choice for position detector, position determination of digital control system, application of clutch break in high frequency position determination, automation technique of position determination, position determination by electromagnetic clutch and break, air cylinder, cam and solenoid, stop position control of automatic guide vehicle, stacker crane and automatic transfer control.
Clement, Warren F.; Gorder, Peter J.; Jewell, Wayne F.
1991-01-01
Developing a single-pilot, all-weather nap-of-the-earth (NOE) capability requires fully automatic NOE (ANOE) navigation and flight control. Innovative guidance and control concepts are investigated in a four-fold research effort that: (1) organizes the on-board computer-based storage and real-time updating of NOE terrain profiles and obstacles in course-oriented coordinates indexed to the mission flight plan; (2) defines a class of automatic anticipative pursuit guidance algorithms and necessary data preview requirements to follow the vertical, lateral, and longitudinal guidance commands dictated by the updated flight profiles; (3) automates a decision-making process for unexpected obstacle avoidance; and (4) provides several rapid response maneuvers. Acquired knowledge from the sensed environment is correlated with the forehand knowledge of the recorded environment (terrain, cultural features, threats, and targets), which is then used to determine an appropriate evasive maneuver if a nonconformity of the sensed and recorded environments is observed. This four-fold research effort was evaluated in both fixed-based and moving-based real-time piloted simulations, thereby, providing a practical demonstration for evaluating pilot acceptance of the automated concepts, supervisory override, manual operation, and re-engagement of the automatic system. Volume one describes the major components of the guidance and control laws as well as the results of the piloted simulations. Volume two describes the complete mathematical model of the fully automatic guidance system for rotorcraft NOE flight following planned flight profiles.
Automatic ultrasound image enhancement for 2D semi-automatic breast-lesion segmentation
Lu, Kongkuo; Hall, Christopher S.
2014-03-01
Breast cancer is the fastest growing cancer, accounting for 29%, of new cases in 2012, and second leading cause of cancer death among women in the United States and worldwide. Ultrasound (US) has been used as an indispensable tool for breast cancer detection/diagnosis and treatment. In computer-aided assistance, lesion segmentation is a preliminary but vital step, but the task is quite challenging in US images, due to imaging artifacts that complicate detection and measurement of the suspect lesions. The lesions usually present with poor boundary features and vary significantly in size, shape, and intensity distribution between cases. Automatic methods are highly application dependent while manual tracing methods are extremely time consuming and have a great deal of intra- and inter- observer variability. Semi-automatic approaches are designed to counterbalance the advantage and drawbacks of the automatic and manual methods. However, considerable user interaction might be necessary to ensure reasonable segmentation for a wide range of lesions. This work proposes an automatic enhancement approach to improve the boundary searching ability of the live wire method to reduce necessary user interaction while keeping the segmentation performance. Based on the results of segmentation of 50 2D breast lesions in US images, less user interaction is required to achieve desired accuracy, i.e. < 80%, when auto-enhancement is applied for live-wire segmentation.
MRI in assessing children with learning disability, focal findings, and reduced automaticity.
Urion, David K; Huff, Hanalise V; Carullo, Maria Paulina
2015-08-18
In children with clinically diagnosed learning disabilities with focal findings on neurologic or neuropsychological evaluations, there is a hypothesized association between disorders in automaticity and focal structural abnormalities observed in brain MRIs. We undertook a retrospective analysis of cases referred to a tertiary-hospital-based learning disabilities program. Individuals were coded as having a focal deficit if either neurologic or neuropsychological evaluation demonstrated focal dysfunction. Those with abnormal MRI findings were categorized based on findings. Children with abnormalities from each of these categories were compared in terms of deficits in automaticity, as measured by the tasks of Rapid Automatized Naming, Rapid Alternating Stimulus Naming, or the timed motor performance battery from the Physical and Neurological Examination for Soft Signs. Data were compared in children with and without disorders of automaticity regarding type of brain structure abnormality. Of the 1,587 children evaluated, 127 had a focal deficit. Eighty-seven had a brain MRI (52 on 1.5-tesla machines and 35 on 3.0-tesla machines). Forty of these images were found to be abnormal. These children were compared with a clinic sample of 150 patients with learning disabilities and no focal findings on examination, who also had undergone MRI. Only 5 of the latter group had abnormalities on MRI. Reduced verbal automaticity was associated with cerebellar abnormalities, whereas reduced automaticity on motor or motor and verbal tasks was associated with white matter abnormalities. Reduced automaticity of retrieval and slow timed motor performance appear to be highly associated with MRI findings. © 2015 American Academy of Neurology.
Calvete, Esther; Orue, Izaskun; Hankin, Benjamin L
2013-04-01
Cognitive models state that cognitions are organized hierarchically, so that the underlying schemas affect behavior via more automatic, superficial cognitive processes. This study aimed to demonstrate that early maladaptive schemas predict anxious automatic thoughts, and to show that such automatic thoughts act as mediators between schemas and prospective changes in social anxiety symptoms. The study also examined an alternative reverse model in which schemas acted as mediators between automatic thoughts and social anxiety. A total of 1052 adolescents (499 girls and 553 boys; M(age)=13.43; SD(age)=1.29) completed measures of early maladaptive schemas, socially anxious automatic thoughts, and social anxiety symptoms at Times 1, 2, and 3. The results revealed bidirectional longitudinal relationships among schemas and automatic thoughts that were consistent in content (e.g., the disconnection/rejection schemas and automatic thoughts of negative self-concept). Furthermore, the automatic thoughts of anticipatory negative evaluation by others at Time 2 mediated the relationship between the other-directedness schemas at Time 1 and social anxiety symptoms at Time 3. These findings are consistent with hierarchical cognitive models of social anxiety given that deeper schemas predict more surface-level thoughts. They also support that these more surface-level thoughts contribute to perpetuating schemas. Finally, results show that early maladaptive schemas of the other-directedness domain play a relevant role in the development and maintenance of social anxiety. Copyright © 2013 Elsevier Ltd. All rights reserved.
The ‘Continuing Misfortune’ of Automatism in Early Surrealism
Directory of Open Access Journals (Sweden)
Tessel M. Bauduin
2015-09-01
Full Text Available In the 1924 Manifesto of Surrealism surrealist leader André Breton (1896-1966 defined Surrealism as ‘psychic automatism in its pure state,’ positioning ‘psychic automatism’ as both a concept and a technique. This definition followed upon an intense period of experimentation with various forms of automatism among the proto-surrealist group; predominantly automatic writing, but also induced dream states. This article explores how surrealist ‘psychic automatism’ functioned as a mechanism for communication, or the expression of thought as directly as possible through the unconscious, in the first two decades of Surrealism. It touches upon automatic writing, hysteria as an automatic bodily performance of the unconscious, dreaming and the experimentation with induced dream states, and automatic drawing and other visual arts-techniques that could be executed more or less automatically as well. For all that the surrealists reinvented automatism for their own poetic, artistic and revolutionary aims, the automatic techniques were primarily drawn from contemporary Spiritualism, psychical research and experimentation with mediums, and the article teases out the connections to mediumistic automatism. It is demonstrated how the surrealists effectively and successfully divested automatism of all things spiritual. It furthermore becomes clear that despite various mishaps, automatism in many forms was a very successful creative technique within Surrealism.
Programmable automatic alpha--beta air sample counter
International Nuclear Information System (INIS)
Howell, W.P.
1978-01-01
A programmable automatic alpha-beta air sample counter was developed for routine sample counting by operational health physics personnel. The system is composed of an automatic sample changer utilizing a large silicon diode detector, an electronic counting system with energy analysis capability, an automatic data acquisition controller, an interface module, and a teletypewriter with paper tape punch and paper tape reader. The system is operated through the teletypewriter keyboard and the paper tape reader, which are used to instruct the automatic data acquisition controller. Paper tape programs are provided for background counting, Chi 2 test, and sample counting. Output data are printed by the teletypewriter on standard continuous roll or multifold paper. Data are automatically corrected for background and counter efficiency
Energy Technology Data Exchange (ETDEWEB)
Carrisoza B, Vicente; Bernal M, Hector M [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Cortazar F, Segio [Petroleos Mexicanos (Mexico)
2002-07-01
The Management of Supervision of Processes (GSP) in collaboration with the Management of Control and Instrumentation (GCI) of the Instituto de Investigaciones Electricas (IIE), has developed a system able to respond in a opportune and coordinated way to the attention and handling of emergencies, optimization of the number of reports and its content, reduction of the time in which the reports of industrial security and environmental protection arrive at their destiny, diminution of the manual process in the elaboration of reports and information and, finally, able to automatically calculate the associated performance indicators related to the efficiency of actions in each one the involved areas. [Spanish] La Gerencia de Supervision de Procesos (GSP) en colaboracion con la Gerencia de Control e Instrumentacion (GCI) del Instituto de Investigaciones Electricas (IIE), ha desarrollado un sistema capaz de responder de manera oportuna y coordinada a la atencion y manejo de emergencias, optimizacion del numero de reportes y su contenido, reduccion del tiempo en que los reportes de seguridad industrial y proteccion ambiental llegan a su destino, disminucion del proceso manual en la elaboracion de reportes e informes y, finalmente, capaz de calcular automaticamente los indicadores de desempeno asociados a la eficiencia de las acciones en cada una las areas involucradas.
Sensitivity analysis and design optimization through automatic differentiation
International Nuclear Information System (INIS)
Hovland, Paul D; Norris, Boyana; Strout, Michelle Mills; Bhowmick, Sanjukta; Utke, Jean
2005-01-01
Automatic differentiation is a technique for transforming a program or subprogram that computes a function, including arbitrarily complex simulation codes, into one that computes the derivatives of that function. We describe the implementation and application of automatic differentiation tools. We highlight recent advances in the combinatorial algorithms and compiler technology that underlie successful implementation of automatic differentiation tools. We discuss applications of automatic differentiation in design optimization and sensitivity analysis. We also describe ongoing research in the design of language-independent source transformation infrastructures for automatic differentiation algorithms
Automatically sweeping dual-channel boxcar integrator
International Nuclear Information System (INIS)
Keefe, D.J.; Patterson, D.R.
1978-01-01
An automatically sweeping dual-channel boxcar integrator has been developed to automate the search for a signal that repeatedly follows a trigger pulse by a constant or slowly varying time delay when that signal is completely hidden in random electrical noise and dc-offset drifts. The automatically sweeping dual-channel boxcar integrator improves the signal-to-noise ratio and eliminates dc-drift errors in the same way that a conventional dual-channel boxcar integrator does, but, in addition, automatically locates the hidden signal. When the signal is found, its time delay is displayed with 100-ns resolution, and its peak value is automatically measured and displayed. This relieves the operator of the tedious, time-consuming, and error-prone search for the signal whenever the time delay changes. The automatically sweeping boxcar integrator can also be used as a conventional dual-channel boxcar integrator. In either mode, it can repeatedly integrate a signal up to 990 times and thus make accurate measurements of the signal pulse height in the presence of random noise, dc offsets, and unsynchronized interfering signals
Automatic 1H-NMR Screening of Fatty Acid Composition in Edible Oils
Directory of Open Access Journals (Sweden)
David Castejón
2016-02-01
Full Text Available In this work, we introduce an NMR-based screening method for the fatty acid composition analysis of edible oils. We describe the evaluation and optimization needed for the automated analysis of vegetable oils by low-field NMR to obtain the fatty acid composition (FAC. To achieve this, two scripts, which automatically analyze and interpret the spectral data, were developed. The objective of this work was to drive forward the automated analysis of the FAC by NMR. Due to the fact that this protocol can be carried out at low field and that the complete process from sample preparation to printing the report only takes about 3 min, this approach is promising to become a fundamental technique for high-throughput screening. To demonstrate the applicability of this method, the fatty acid composition of extra virgin olive oils from various Spanish olive varieties (arbequina, cornicabra, hojiblanca, manzanilla, and picual was determined by 1H-NMR spectroscopy according to this protocol.
Automatic referral to cardiac rehabilitation.
Fischer, Jane P
2008-01-01
The pervasive negative impact of cardiovascular disease in the United States is well documented. Although advances have been made, the campaign to reduce the occurrence, progression, and mortality continues. Determining evidence-based data is only half the battle. Implementing new and updated clinical guidelines into daily practice is a challenging task. Cardiac rehabilitation is an example of a proven intervention whose benefit is hindered through erratic implementation. The American Association of Cardiovascular and Pulmonary Rehabilitation (AACVPR), the American College of Cardiology (ACC), and the American Heart Association (AHA) have responded to this problem by publishing the AACVPR/ACC/AHA 2007 Performance Measures on Cardiac Rehabilitation for Referral to and Delivery of Cardiac Rehabilitation/Secondary Prevention Services. This new national guideline recommends automatic referral to cardiac rehabilitation for every eligible patient (performance measure A-1). This article offers guidance for the initiation of an automatic referral system, including individualizing your protocol with regard to electronic or paper-based order entry structures.
Jones, Manon W.; Snowling, Margaret J.; Moll, Kristina
2016-01-01
Reading fluency is often predicted by rapid automatized naming (RAN) speed, which as the name implies, measures the automaticity with which familiar stimuli (e.g., letters) can be retrieved and named. Readers with dyslexia are considered to have less "automatized" access to lexical information, reflected in longer RAN times compared with…
Automatic differentiation algorithms in model analysis
Huiskes, M.J.
2002-01-01
Title: Automatic differentiation algorithms in model analysis
Author: M.J. Huiskes
Date: 19 March, 2002
In this thesis automatic differentiation algorithms and derivative-based methods
30 CFR 75.1107-4 - Automatic fire sensors and manual actuators; installation; minimum requirements.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Automatic fire sensors and manual actuators... § 75.1107-4 Automatic fire sensors and manual actuators; installation; minimum requirements. (a)(1... sensors or equivalent shall be installed for each 50 square feet of top surface area, or fraction thereof...
Automatic path proposal computation for CT-guided percutaneous liver biopsy.
Helck, A; Schumann, C; Aumann, J; Thierfelder, K; Strobl, F F; Braunagel, M; Niethammer, M; Clevert, D A; Hoffmann, R T; Reiser, M; Sandner, T; Trumm, C
2016-12-01
To evaluate feasibility of automatic software-based path proposals for CT-guided percutaneous biopsies. Thirty-three patients (60 [Formula: see text] 12 years) referred for CT-guided biopsy of focal liver lesions were consecutively included. Pre-interventional CT and dedicated software (FraunhoferMeVis Pathfinder) were used for (semi)automatic segmentation of relevant structures. The software subsequently generated three path proposals in downward quality for CT-guided biopsy. Proposed needle paths were compared with consensus proposal of two experts (comparable, less suitable, not feasible). In case of comparable results, equivalent approach to software-based path proposal was used. Quality of segmentation process was evaluated (Likert scale, 1 [Formula: see text] best, 6 [Formula: see text] worst), and time for processing was registered. All biopsies were performed successfully without complications. In 91 % one of the three automatic path proposals was rated comparable to experts' proposal. None of the first proposals was rated not feasible, and 76 % were rated comparable to the experts' proposal. 7 % automatic path proposals were rated not feasible, all being second choice ([Formula: see text]) or third choice ([Formula: see text]). In 79 %, segmentation at least was good. Average total time for establishing automatic path proposal was 42 [Formula: see text] 9 s. Automatic software-based path proposal for CT-guided liver biopsies in the majority provides path proposals that are easy to establish and comparable to experts' insertion trajectories.
Automatic noninvasive measurement of systolic blood pressure using photoplethysmography
Directory of Open Access Journals (Sweden)
Glik Zehava
2009-10-01
Full Text Available Abstract Background Automatic measurement of arterial blood pressure is important, but the available commercial automatic blood pressure meters, mostly based on oscillometry, are of low accuracy. Methods In this study, we present a cuff-based technique for automatic measurement of systolic blood pressure, based on photoplethysmographic signals measured simultaneously in fingers of both hands. After inflating the pressure cuff to a level above systolic blood pressure in a relatively slow rate, it is slowly deflated. The cuff pressure for which the photoplethysmographic signal reappeared during the deflation of the pressure-cuff was taken as the systolic blood pressure. The algorithm for the detection of the photoplethysmographic signal involves: (1 determination of the time-segments in which the photoplethysmographic signal distal to the cuff is expected to appear, utilizing the photoplethysmographic signal in the free hand, and (2 discrimination between random fluctuations and photoplethysmographic pattern. The detected pulses in the time-segments were identified as photoplethysmographic pulses if they met two criteria, based on the pulse waveform and on the correlation between the signal in each segment and the signal in the two neighboring segments. Results Comparison of the photoplethysmographic-based automatic technique to sphygmomanometry, the reference standard, shows that the standard deviation of their differences was 3.7 mmHg. For subjects with systolic blood pressure above 130 mmHg the standard deviation was even lower, 2.9 mmHg. These values are much lower than the 8 mmHg value imposed by AAMI standard for automatic blood pressure meters. Conclusion The photoplethysmographic-based technique for automatic measurement of systolic blood pressure, and the algorithm which was presented in this study, seems to be accurate.
International Nuclear Information System (INIS)
Zhang Tiezhi; Chi Yuwei; Meldolesi, Elisa; Yan Di
2007-01-01
Purpose: To develop and validate a fully automatic region-of-interest (ROI) delineation method for on-line adaptive radiotherapy. Methods and Materials: On-line adaptive radiotherapy requires a robust and automatic image segmentation method to delineate ROIs in on-line volumetric images. We have implemented an atlas-based image segmentation method to automatically delineate ROIs of head-and-neck helical computed tomography images. A total of 32 daily computed tomography images from 7 head-and-neck patients were delineated using this automatic image segmentation method. Manually drawn contours on the daily images were used as references in the evaluation of automatically delineated ROIs. Two methods were used in quantitative validation: (1) the dice similarity coefficient index, which indicates the overlapping ratio between the manually and automatically delineated ROIs; and (2) the distance transformation, which yields the distances between the manually and automatically delineated ROI surfaces. Results: Automatic segmentation showed agreement with manual contouring. For most ROIs, the dice similarity coefficient indexes were approximately 0.8. Similarly, the distance transformation evaluation results showed that the distances between the manually and automatically delineated ROI surfaces were mostly within 3 mm. The distances between two surfaces had a mean of 1 mm and standard deviation of <2 mm in most ROIs. Conclusion: With atlas-based image segmentation, it is feasible to automatically delineate ROIs on the head-and-neck helical computed tomography images in on-line adaptive treatments
Automatic intelligent cruise control
Stanton, NA; Young, MS
2006-01-01
This paper reports a study on the evaluation of automatic intelligent cruise control (AICC) from a psychological perspective. It was anticipated that AICC would have an effect upon the psychology of driving—namely, make the driver feel like they have less control, reduce the level of trust in the vehicle, make drivers less situationally aware, but might reduce the workload and make driving might less stressful. Drivers were asked to drive in a driving simulator under manual and automatic inte...
Automatic and creative skills in reading Automatic and creative skills in reading
Directory of Open Access Journals (Sweden)
Leonor Scliar Cabral
2008-04-01
Full Text Available In this article I will discuss the automatic and creative skills in reading, focusing on the differences between 1 processes involved while learning how to read and processes employed by the proficient reader and 2 knowledge for using language and metalinguistic awareness. The arguments will derive mainly from the definition of reading as a process where the receivers combine the information extracted from the written material with their specialized knowledge activated during this process (i.e. linguistic systems and correspondent rules and enciclopedic knowledge in order to comprehend, interpret and internalize structured new information and/or to experience aesthetic pleasure. Evidence to illustrate the arguments comes from experiments (1 with pre-school children and beginning readers on narrativity and on the dichotic paradigm, and with illiterate and literate adults with diferent levels of proficiency of reading in a task of erasing an initial syllable and an initial consonant. In this article I will discuss the automatic and creative skills in reading, focusing on the differences between 1 processes involved while learning how to read and processes employed by the proficient reader and 2 knowledge for using language and metalinguistic awareness. The arguments will derive mainly from the definition of reading as a process where the receivers combine the information extracted from the written material with their specialized knowledge activated during this process (i.e. linguistic systems and correspondent rules and enciclopedic knowledge in order to comprehend, interpret and internalize structured new information and/or to experience aesthetic pleasure. Evidence to illustrate the arguments comes from experiments (1 with pre-school children and beginning readers on narrativity and on the dichotic paradigm, and with illiterate and literate adults with diferent levels of proficiency of reading in a task of erasing an initial syllable
Genital automatisms: Reappraisal of a remarkable but ignored symptom of focal seizures.
Dede, Hava Özlem; Bebek, Nerses; Gürses, Candan; Baysal-Kıraç, Leyla; Baykan, Betül; Gökyiğit, Ayşen
2018-03-01
Genital automatisms (GAs) are uncommon clinical phenomena of focal seizures. They are defined as repeated fondling, grabbing, or scratching of the genitals. The aim of this study was to determine the lateralizing and localizing value and associated clinical characteristics of GAs. Three hundred thirteen consecutive patients with drug-resistant seizures who were referred to our tertiary center for presurgical evaluation between 2009 and 2016 were investigated. The incidence of specific kinds of behavior, clinical semiology, associated symptoms/signs with corresponding ictal electroencephalography (EEG) findings, and their potential role in seizure localization and lateralization were evaluated. Fifteen (4.8%) of 313 patients had GAs. Genital automatisms were identified in 19 (16.4%) of a total 116 seizures. Genital automatisms were observed to occur more often in men than in women (M/F: 10/5). Nine of fifteen patients (60%) had temporal lobe epilepsy (right/left: 4/5) and three (20%) had frontal lobe epilepsy (right/left: 1/2), whereas the remaining two patients could not be classified. One patient was diagnosed as having Rasmussen encephalitis. Genital automatisms were ipsilateral to epileptic focus in 12 patients and contralateral in only one patient according to ictal-interictal EEG and neuroimaging findings. Epileptic focus could not be lateralized in the last 2 patients. Genital automatisms were associated with unilateral hand automatisms such as postictal nose wiping or manual automatisms in 13 (86.7%) of 15 and contralateral dystonia was seen in 6 patients. All patients had amnesia of the performance of GAs. Genital automatisms are more frequent in seizures originating from the temporal lobe, and they can also be seen in frontal lobe seizures. Genital automatisms seem to have a high lateralizing value to the ipsilateral hemisphere and are mostly concordant with other unilateral hand automatisms. Men exhibit GAs more often than women. Copyright © 2017
Coordinated hybrid automatic repeat request
Makki, Behrooz
2014-11-01
We develop a coordinated hybrid automatic repeat request (HARQ) approach. With the proposed scheme, if a user message is correctly decoded in the first HARQ rounds, its spectrum is allocated to other users, to improve the network outage probability and the users\\' fairness. The results, which are obtained for single- and multiple-antenna setups, demonstrate the efficiency of the proposed approach in different conditions. For instance, with a maximum of M retransmissions and single transmit/receive antennas, the diversity gain of a user increases from M to (J+1)(M-1)+1 where J is the number of users helping that user.
Automatic control unit for A neutron diffraction crystal spectrometer
Energy Technology Data Exchange (ETDEWEB)
Adib, M.; Abbas, Y.; Mostafa, M.; Hamouda, I.
1982-01-01
An automatic transistorized unit has been designed and constructed to control the operation of the double axis crystal spectrometer installed in front of one of the horizontal channels of the ET-RR-1 reactor. The function of the automatic unit is to store the diffracted neutrons at a certain angle with respect to the direction of the incident neutron beam in a selected channel of a 1024-multichannel analyzer for a certain preadjusted time period. AT the end of this time period the unit rotates the spectrometer's arm to another angle, selects the next channel of the MCA and provides the measurement of the diffracted neutron for the same time period. Such a sequence is repeated automatically over all angles required for the neutron diffraction pattern of the sample under investigation. As a result, the stored information at the MCA provides the neutron diffraction pattern as a function of channel number, where each channel corresponds to a certain scattering angle. The stored distribution at MCA can be obtained through the analyzer read out unit. The designed automatic unit has the possibility of providing the neutron diffraction pattern using a 6-digit scaler and a printer.
Automatic radioxenon analyzer for CTBT monitoring
International Nuclear Information System (INIS)
Bowyer, T.W.; Abel, K.H.; Hensley, W.K.
1996-12-01
Over the past 3 years, with support from US DOE's NN-20 Comprehensive Test Ban Treaty (CTBT) R ampersand D program, PNNL has developed and demonstrated a fully automatic analyzer for collecting and measuring the four Xe radionuclides, 131m Xe(11.9 d), 133m Xe(2.19 d), 133 Xe (5.24 d), and 135 Xe(9.10 h), in the atmosphere. These radionuclides are important signatures in monitoring for compliance to a CTBT. Activity ratios permit discriminating radioxenon from nuclear detonation and that from nuclear reactor operations, nuclear fuel reprocessing, or medical isotope production and usage. In the analyzer, Xe is continuously and automatically separated from the atmosphere at flow rates of about 7 m 3 /h on sorption bed. Aliquots collected for 6-12 h are automatically analyzed by electron-photon coincidence spectrometry to produce sensitivities in the range of 20-100 μBq/m 3 of air, about 100-fold better than with reported laboratory-based procedures for short time collection intervals. Spectral data are automatically analyzed and the calculated radioxenon concentrations and raw gamma- ray spectra automatically transmitted to data centers
Automatic DNA Diagnosis for 1D Gel Electrophoresis Images using Bio-image Processing Technique.
Intarapanich, Apichart; Kaewkamnerd, Saowaluck; Shaw, Philip J; Ukosakit, Kittipat; Tragoonrung, Somvong; Tongsima, Sissades
2015-01-01
DNA gel electrophoresis is a molecular biology technique for separating different sizes of DNA fragments. Applications of DNA gel electrophoresis include DNA fingerprinting (genetic diagnosis), size estimation of DNA, and DNA separation for Southern blotting. Accurate interpretation of DNA banding patterns from electrophoretic images can be laborious and error prone when a large number of bands are interrogated manually. Although many bio-imaging techniques have been proposed, none of them can fully automate the typing of DNA owing to the complexities of migration patterns typically obtained. We developed an image-processing tool that automatically calls genotypes from DNA gel electrophoresis images. The image processing workflow comprises three main steps: 1) lane segmentation, 2) extraction of DNA bands and 3) band genotyping classification. The tool was originally intended to facilitate large-scale genotyping analysis of sugarcane cultivars. We tested the proposed tool on 10 gel images (433 cultivars) obtained from polyacrylamide gel electrophoresis (PAGE) of PCR amplicons for detecting intron length polymorphisms (ILP) on one locus of the sugarcanes. These gel images demonstrated many challenges in automated lane/band segmentation in image processing including lane distortion, band deformity, high degree of noise in the background, and bands that are very close together (doublets). Using the proposed bio-imaging workflow, lanes and DNA bands contained within are properly segmented, even for adjacent bands with aberrant migration that cannot be separated by conventional techniques. The software, called GELect, automatically performs genotype calling on each lane by comparing with an all-banding reference, which was created by clustering the existing bands into the non-redundant set of reference bands. The automated genotype calling results were verified by independent manual typing by molecular biologists. This work presents an automated genotyping tool from DNA
Automatic DNA Diagnosis for 1D Gel Electrophoresis Images using Bio-image Processing Technique
2015-01-01
Background DNA gel electrophoresis is a molecular biology technique for separating different sizes of DNA fragments. Applications of DNA gel electrophoresis include DNA fingerprinting (genetic diagnosis), size estimation of DNA, and DNA separation for Southern blotting. Accurate interpretation of DNA banding patterns from electrophoretic images can be laborious and error prone when a large number of bands are interrogated manually. Although many bio-imaging techniques have been proposed, none of them can fully automate the typing of DNA owing to the complexities of migration patterns typically obtained. Results We developed an image-processing tool that automatically calls genotypes from DNA gel electrophoresis images. The image processing workflow comprises three main steps: 1) lane segmentation, 2) extraction of DNA bands and 3) band genotyping classification. The tool was originally intended to facilitate large-scale genotyping analysis of sugarcane cultivars. We tested the proposed tool on 10 gel images (433 cultivars) obtained from polyacrylamide gel electrophoresis (PAGE) of PCR amplicons for detecting intron length polymorphisms (ILP) on one locus of the sugarcanes. These gel images demonstrated many challenges in automated lane/band segmentation in image processing including lane distortion, band deformity, high degree of noise in the background, and bands that are very close together (doublets). Using the proposed bio-imaging workflow, lanes and DNA bands contained within are properly segmented, even for adjacent bands with aberrant migration that cannot be separated by conventional techniques. The software, called GELect, automatically performs genotype calling on each lane by comparing with an all-banding reference, which was created by clustering the existing bands into the non-redundant set of reference bands. The automated genotype calling results were verified by independent manual typing by molecular biologists. Conclusions This work presents an
Automatic plasma control in magnetic traps
International Nuclear Information System (INIS)
Samojlenko, Y.; Chuyanov, V.
1984-01-01
Hot plasma is essentially in thermodynamic non-steady state. Automatic plasma control basically means monitoring deviations from steady state and producing a suitable magnetic or electric field which brings the plasma back to its original state. Briefly described are two systems of automatic plasma control: control with a magnetic field using a negative impedance circuit, and control using an electric field. It appears that systems of automatic plasma stabilization will be an indispensable component of the fusion reactor and its possibilities will in many ways determine the reactor economy. (Ha)
Combining Stereo SECCHI COR2 and HI1 Images for Automatic CME Front Edge Tracking
Kirnosov, Vladimir; Chang, Lin-Ching; Pulkkinen, Antti
2016-01-01
COR2 coronagraph images are the most commonly used data for coronal mass ejection (CME) analysis among the various types of data provided by the STEREO (Solar Terrestrial Relations Observatory) SECCHI (Sun-Earth Connection Coronal and Heliospheric Investigation) suite of instruments. The field of view (FOV) in COR2 images covers 215 solar radii (Rs) that allow for tracking the front edge of a CME in its initial stage to forecast the lead-time of a CME and its chances of reaching the Earth. However, estimating the lead-time of a CME using COR2 images gives a larger lead-time, which may be associated with greater uncertainty. To reduce this uncertainty, CME front edge tracking should be continued beyond the FOV of COR2 images. Therefore, heliospheric imager (HI1) data that covers 1590 Rs FOV must be included. In this paper, we propose a novel automatic method that takes both COR2 and HI1 images into account and combine the results to track the front edges of a CME continuously. The method consists of two modules: pre-processing and tracking. The pre-processing module produces a set of segmented images, which contain the signature of a CME, for both COR2 and HI1 separately. In addition, the HI1 images are resized and padded, so that the center of the Sun is the central coordinate of the resized HI1 images. The resulting COR2 andHI1 image set is then fed into the tracking module to estimate the position angle (PA) and track the front edge of a CME. The detected front edge is then used to produce a height-time profile that is used to estimate the speed of a CME. The method was validated using 15 CME events observed in the period from January 1, 2008 to August 31, 2009. The results demonstrate that the proposed method is effective for CME front edge tracking in both COR2 and HI1 images. Using this method, the CME front edge can now be tracked automatically and continuously in a much larger range, i.e., from 2 to 90 Rs, for the first time. These improvement scan greatly
An automatic tooth preparation technique: A preliminary study
Yuan, Fusong; Wang, Yong; Zhang, Yaopeng; Sun, Yuchun; Wang, Dangxiao; Lyu, Peijun
2016-04-01
The aim of this study is to validate the feasibility and accuracy of a new automatic tooth preparation technique in dental healthcare. An automatic tooth preparation robotic device with three-dimensional motion planning software was developed, which controlled an ultra-short pulse laser (USPL) beam (wavelength 1,064 nm, pulse width 15 ps, output power 30 W, and repeat frequency rate 100 kHz) to complete the tooth preparation process. A total of 15 freshly extracted human intact first molars were collected and fixed into a phantom head, and the target preparation shapes of these molars were designed using customised computer-aided design (CAD) software. The accuracy of tooth preparation was evaluated using the Geomagic Studio and Imageware software, and the preparing time of each tooth was recorded. Compared with the target preparation shape, the average shape error of the 15 prepared molars was 0.05-0.17 mm, the preparation depth error of the occlusal surface was approximately 0.097 mm, and the error of the convergence angle was approximately 1.0°. The average preparation time was 17 minutes. These results validated the accuracy and feasibility of the automatic tooth preparation technique.
Session II-E. Socioeconomic evaluations
International Nuclear Information System (INIS)
Finley, J.R.
1981-01-01
Major tasks of the socioeconomic program are designed to address and resolve issues raised by federal, state, and local agencies and the public, and to meet legal and regulatory requirements. The tasks are intended to: (1) characterize socioeconomic and other nontechnical issues, and recommend possible resolution, (2) develop socioeconomic impact methodologies and provide impact assessments, (3) design and implement a community development approach to impact mitigation, and (4)conduct institutional and organizational analyses. The following papers relate to these socioeconomic tasks: (1) an integrated approach to socioeconomic considerations in nuclear waste management; (2)ethical considerations surrounding nuclear waste isolation and mitigation; (3) institutional issues in transportation of nuclear wastes; (4) framework for evaluating the utility of incentive systems for radioactive waste repository siting; (5)special issues in impact mitigation; (6) effective programs for public participation in siting large public facilities; (7) a program for community development assistance; and (8) examination of factors affecting socioeconomic mitigation costs
Word Processing in Dyslexics: An Automatic Decoding Deficit?
Yap, Regina; Van Der Leu, Aryan
1993-01-01
Compares dyslexic children with normal readers on measures of phonological decoding and automatic word processing. Finds that dyslexics have a deficit in automatic phonological decoding skills. Discusses results within the framework of the phonological deficit and the automatization deficit hypotheses. (RS)
Automatic Strain-Rate Controller,
1976-12-01
D—AO37 9~e2 ROME AIR DEVELOPMENT CENTER GRIFFISS AFB N 1’ FIG 13/ 6AUTOMATIC STRAIN—RATE CONTROLLER, (U) DEC 76 R L HUNTSINGER. J A ADAMSK I...goes to zero. CONTROLLER, Leeds and Northrup Series 80 CAT with proportional band , rate , reset, and approach controls . Input from deviation output...8) through ( 16) . (8) Move the set-point slowl y up to 3 or 4. (9) If the recorder po inter hunts , adjust the func t ion controls on tine Ser
SAFETY MANAGEMENT FOR WOMEN THROUGH AUTOMATIC GPS LOCATION TRACKER
P.Nivetha*1, S.Kiruthika2 & J.B.Kavitha3
2018-01-01
The project “SAFETY MANAGEMENT FOR WOMEN THROUGH AUTOMATIC GPS LOCATION TRACKER” is designed using Standard Android 4.0.3 platform. The platform used to develop the application is Eclipse IDE (Mars) with Java 1.6 Standard Edition. It’s an android app which will help people in their crucial time. For example if a person is in trouble and he needs a help so there should be an app through which he/she can contact with their one to help them by just clicking on one button, it will automatically s...
10 CFR 431.132 - Definitions concerning automatic commercial ice makers.
2010-01-01
... CERTAIN COMMERCIAL AND INDUSTRIAL EQUIPMENT Automatic Commercial Ice Makers § 431.132 Definitions... necessarily shipped in 1 package) that— (1) Consists of a condensing unit and ice-making section operating as...
Draft Automatic Data Acquisition System Plan
International Nuclear Information System (INIS)
1987-04-01
This Automatic Data Acquisition System (ADAS) Plan has been prepared in support of the requirement for detailed site characterization of the Deaf Smith County candidate repository site in salt, and describes the data acquisition system which will be used for unattended data collection from the geotechnical instrumentation installed at the site. Section 1.1 discusses the programmatic background to the plan, Section 1.2 presents the scope and purpose of the plan, and the organization of the document is given in Section 1.3. 31 refs., 34 figs., 8 tabs
Directory of Open Access Journals (Sweden)
Anke Soellner
2013-05-01
Full Text Available The idea of automatic decision making approximating normatively optimal decisions without necessitating much cognitive effort is intriguing. Whereas recent findings support the notion that such fast, automatic processes explain empirical data well, little is known about the conditions under which such processes are selected rather than more deliberate stepwise strategies. We investigate the role of the format of information presentation, focusing explicitly on the ease of information acquisition and its influence on information integration processes. In a probabilistic inference task, the standard matrix employed in prior research was contrasted with a newly created map presentation format and additional variations of both presentation formats. Across three experiments, a robust presentation format effect emerged: Automatic decision making was more prevalent in the matrix (with high information accessibility, whereas sequential decision strategies prevailed when the presentation format demanded more information acquisition effort. Further scrutiny of the effect showed that it is not driven by the presentation format as such, but rather by the extent of information search induced by a format. Thus, if information is accessible with minimal need for information search, information integration is likely to proceed in a perception-like, holistic manner. In turn, a moderate demand for information search decreases the likelihood of behavior consistent with the assumptions of automatic decision making.
Directory of Open Access Journals (Sweden)
Prahathees Eswaramoorthy
2014-08-01
Full Text Available Sporulation in the bacterium Bacillus subtilis is a developmental program in which a progenitor cell differentiates into two different cell types, the smaller of which eventually becomes a dormant cell called a spore. The process begins with an asymmetric cell division event, followed by the activation of a transcription factor, σF, specifically in the smaller cell. Here, we show that the structural protein DivIVA localizes to the polar septum during sporulation and is required for asymmetric division and the compartment-specific activation of σF. Both events are known to require a protein called SpoIIE, which also localizes to the polar septum. We show that DivIVA copurifies with SpoIIE and that DivIVA may anchor SpoIIE briefly to the assembling polar septum before SpoIIE is subsequently released into the forespore membrane and recaptured at the polar septum. Finally, using super-resolution microscopy, we demonstrate that DivIVA and SpoIIE ultimately display a biased localization on the side of the polar septum that faces the smaller compartment in which σF is activated.
Itoh, Makoto; Fujiwara, Yusuke; Inagaki, Toshiyuki
This paper discusses driver's behavioral changes as a result of driver's use of an automatic brake system for preventing a rear-end collision from occurring. Three types of automatic brake systems are investigated in this study. Type 1 brake system applies a strong automatic brake when a collision is very imminent. Type 2 brake system initiates brake operation softly when a rear-end crash may be anticipated. Types 1 and 2 are for avoidance of a collision. Type 3 brake system, on the other hand, applies a strong automatic brake to reduce the damage when a collision can not be avoided. An experiment was conducted with a driving simulator in order to analyze the driver's possible behavioral changes. The results showed that the time headway (THW) during car following phase was reduced by use of an automatic brake system of any type. The inverse of time to collision (TTC), which is an index of the driver's brake timing, increased by use of Type 1 brake system when the deceleration rate of the lead vehicle was relatively low. However, the brake timing did not change when the drivers used Type 2 or 3 brake system. As a whole, dangerous behavioral changes, such as overreliance on a brake system, were not observed for either type of brake system.
Directory of Open Access Journals (Sweden)
Huapeng Wang
2015-01-01
Full Text Available Forensic speaker recognition is experiencing a remarkable paradigm shift in terms of the evaluation framework and presentation of voice evidence. This paper proposes a new method of forensic automatic speaker recognition using the likelihood ratio framework to quantify the strength of voice evidence. The proposed method uses a reference database to calculate the within- and between-speaker variability. Some acoustic-phonetic features are extracted automatically using the software VoiceSauce. The effectiveness of the approach was tested using two Mandarin databases: A mobile telephone database and a landline database. The experiment's results indicate that these acoustic-phonetic features do have some discriminating potential and are worth trying in discrimination. The automatic acoustic-phonetic features have acceptable discriminative performance and can provide more reliable results in evidence analysis when fused with other kind of voice features.
Neuro-fuzzy system modeling based on automatic fuzzy clustering
Institute of Scientific and Technical Information of China (English)
Yuangang TANG; Fuchun SUN; Zengqi SUN
2005-01-01
A neuro-fuzzy system model based on automatic fuzzy clustering is proposed.A hybrid model identification algorithm is also developed to decide the model structure and model parameters.The algorithm mainly includes three parts:1) Automatic fuzzy C-means (AFCM),which is applied to generate fuzzy rules automatically,and then fix on the size of the neuro-fuzzy network,by which the complexity of system design is reducesd greatly at the price of the fitting capability;2) Recursive least square estimation (RLSE).It is used to update the parameters of Takagi-Sugeno model,which is employed to describe the behavior of the system;3) Gradient descent algorithm is also proposed for the fuzzy values according to the back propagation algorithm of neural network.Finally,modeling the dynamical equation of the two-link manipulator with the proposed approach is illustrated to validate the feasibility of the method.
Directory of Open Access Journals (Sweden)
Yves Lafond
2010-04-01
Full Text Available Un règlement athénien, daté du IIe siècle de notre ère, nous plonge dans une séance de l’assemblée des Iobacches convoquée pour ratifier les statuts (δόγματα présentés à l’occasion d’un renouvellement du prêtre et du vice-prêtre de l’association. La lecture des statuts soulève les acclamations : « Observons-les (ces statuts pour toujours », τούτοις ἀεὶ χρώμεθα,« Restitue les statuts », ἀνάκτησαι τ’ ὰ δόγματα, « Qu’on mette les statuts sur une stèle », ἐν στήλῃ τὰ δόγματα. Il est alors procé...
49 CFR 236.825 - System, automatic train control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false System, automatic train control. 236.825 Section..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.825 System, automatic train control. A system so arranged that its operation will automatically...
Full Automatic synthesis of [18F]FMISO
International Nuclear Information System (INIS)
Seung Jun Oh; Se Hun Kang; Jin-Sook Ryu; Dae Hyuk Moon
2004-01-01
[ 18 F]FMISO is a radiopharmaceutical for hypoxia imaging. Although it was developed in 1986, there has been no report about automatic synthesis. In this experiment, we established the full automatic synthesis of [ 18 F]FMISO and evaluate the stability according to ICH guideline. Method: We used GE MicroLab MX for automatic synthesis. Sequence program was modified to control of the module as follows: [ 18 F]Fluoride drying→[ 18 F]fluorination→trapping of reaction mixture on C18 cartridge→purification-elution of reaction mixture→hydrolysis and HPLC purification. We used disposable cassette for each synthesis and discard it after synthesis. To find optimal synthesis condition, we tested 90 120 degree C as reaction temperature, 5 15 mg of 1-(2-nitro-1-imidazolyl) -2-O-tetrahtdropyranyl-3-O-toluenesulfonyl-propanediol as precursor and 5 15 min as [ 18 F]fluorination time. HPLC purification condition was EtOH:H20 = 5:95, 5ml/min with Alltech Econosil column. To check the stability of production, we performed 30 times of run. We checked the radiochemical stability until 6 hours at 25 degree C and 40% humidity condition. We also performed the stability test at 50 70 degree C with 60-80% humidity condition or under UV light for 6 hours after synthesis for acceleration test, Results: The optimal [ 18 F] fluorination condition was 10mg of precursor and 15 min incubation at 110 degree C. Hydrolysis was performed at 105 degree C for 5 min. After HPLC purification, radiochemical yields and purity were 45±2.8 and 98±1.2%, respectively. Total synthesis time was 60±5.2 min. [ 18 F]FMISO was stable until 6 hours after production with 97±2.4% of radiochemical purity. [ 18 F]FMISO was also stable in acceleration test and photochemical test with 97±2.4 and 97±2.8% of radiochemical purity, respectively. Conclusion: We established the full automatic synthesis method of [ 18 F]FMISO with reproducible high production yield. [18F]FMISO synthesized by this method was stable
Automatic validation of numerical solutions
DEFF Research Database (Denmark)
Stauning, Ole
1997-01-01
This thesis is concerned with ``Automatic Validation of Numerical Solutions''. The basic theory of interval analysis and self-validating methods is introduced. The mean value enclosure is applied to discrete mappings for obtaining narrow enclosures of the iterates when applying these mappings...... differential equations, but in this thesis, we describe how to use the methods for enclosing iterates of discrete mappings, and then later use them for discretizing solutions of ordinary differential equations. The theory of automatic differentiation is introduced, and three methods for obtaining derivatives...... are described: The forward, the backward, and the Taylor expansion methods. The three methods have been implemented in the C++ program packages FADBAD/TADIFF. Some examples showing how to use the three metho ds are presented. A feature of FADBAD/TADIFF not present in other automatic differentiation packages...
Directory of Open Access Journals (Sweden)
David J Clark
2015-05-01
Full Text Available Automaticity is a hallmark feature of walking in adults who are healthy and well-functioning. In the context of walking, ‘automaticity’ refers to the ability of the nervous system to successfully control typical steady state walking with minimal use of attention-demanding executive control resources. Converging lines of evidence indicate that walking deficits and disorders are characterized in part by a shift in the locomotor control strategy from healthy automaticity to compensatory executive control. This is potentially detrimental to walking performance, as an executive control strategy is not optimized for locomotor control. Furthermore, it places excessive demands on a limited pool of executive reserves. The result is compromised ability to perform basic and complex walking tasks and heightened risk for adverse mobility outcomes including falls. Strategies for rehabilitation of automaticity are not well defined, which is due to both a lack of systematic research into the causes of impaired automaticity and to a lack of robust neurophysiological assessments by which to gauge automaticity. These gaps in knowledge are concerning given the serious functional implications of compromised automaticity. Therefore, the objective of this article is to advance the science of automaticity of walking by consolidating evidence and identifying gaps in knowledge regarding: a functional significance of automaticity; b neurophysiology of automaticity; c measurement of automaticity; d mechanistic factors that compromise automaticity; and e strategies for rehabilitation of automaticity.
The Use of Automatic Indexing for Authority Control.
Dillon, Martin; And Others
1981-01-01
Uses an experimental system for authority control on a collection of bibliographic records to demonstrate the resemblance between thesaurus-based automatic indexing and automatic authority control. Details of the automatic indexing system are given, results discussed, and the benefits of the resemblance examined. Included are a rules appendix and…
Automatic detection of osteoporotic vertebral fractures in routine thoracic and abdominal MDCT
Energy Technology Data Exchange (ETDEWEB)
Baum, Thomas; Dobritz, Martin; Rummeny, Ernst J.; Noel, Peter B. [Technische Universitaet Muenchen, Institut fuer Radiologie, Klinikum rechts der Isar, Muenchen (Germany); Bauer, Jan S. [Technische Universitaet Muenchen, Abteilung fuer Neuroradiologie, Klinikum rechts der Isar, Muenchen (Germany); Klinder, Tobias; Lorenz, Cristian [Philips Research Laboratories, Hamburg (Germany)
2014-04-15
To develop a prototype algorithm for automatic spine segmentation in MDCT images and use it to automatically detect osteoporotic vertebral fractures. Cross-sectional routine thoracic and abdominal MDCT images of 71 patients including 8 males and 9 females with 25 osteoporotic vertebral fractures and longitudinal MDCT images of 9 patients with 18 incidental fractures in the follow-up MDCT were retrospectively selected. The spine segmentation algorithm localised and identified the vertebrae T5-L5. Each vertebra was automatically segmented by using corresponding vertebra surface shape models that were adapted to the original images. Anterior, middle, and posterior height of each vertebra was automatically determined; the anterior-posterior ratio (APR) and middle-posterior ratio (MPR) were computed. As the gold standard, radiologists graded vertebral fractures from T5 to L5 according to the Genant classification in consensus. Using ROC analysis to differentiate vertebrae without versus with prevalent fracture, AUC values of 0.84 and 0.83 were obtained for APR and MPR, respectively (p < 0.001). Longitudinal changes in APR and MPR were significantly different between vertebrae without versus with incidental fracture (ΔAPR: -8.5 % ± 8.6 % versus -1.6 % ± 4.2 %, p = 0.002; ΔMPR: -11.4 % ± 7.7 % versus -1.2 % ± 1.6 %, p < 0.001). This prototype algorithm may support radiologists in reporting currently underdiagnosed osteoporotic vertebral fractures so that appropriate therapy can be initiated. circle This spine segmentation algorithm automatically localised, identified, and segmented the vertebrae in MDCT images. (orig.)
International Nuclear Information System (INIS)
Terakado, Tsuguo; Suzuki, Shinya; Kawai, Masashi; Aoki, Hiroshi; Ohkubo, Toshiyuki
1999-10-01
The automatic control rod operation system was developed to control the JOYO reactor power automatically in all operation modes(critical approach, cooling system heat up, power ascent, power descent), development began in 1989. Prior to applying the system, verification tests of the automatic control rod operation guide system was conducted during 32nd duty cycles of JOYO' from Dec. 1997 to Feb. 1998. The automatic control rod operation guide system consists of the control rod operation guide function and the plant operation guide function. The control rod operation guide function provides information on control rod movement and position, while the plant operation guide function provide guidance for plant operations corresponding to reactor power changes(power ascent or power descent). Control rod insertion or withdrawing are predicted by fuzzy algorithms. (J.P.N.)
Lifescience Database Archive (English)
Full Text Available s*ryvtrtn*sngktn*rettri*n*kkc*kifrs*t*s**rkrnc*i*rtn*iie nhinavytrssr*gpakvfansmfedvdsdddrinfrfknclsfiw*yfnw...yvtrtn*sngktn*rettri*n*kkc*kifrs*t*s**rkrnc*i*rtn*iie nhinavytrssr*gpakvfansmfedvdsdddrinfrfknclsfiw*yfnwfil
Model study of an automatic controller of the IBR-2 pulsed reactor
International Nuclear Information System (INIS)
Pepelyshev, Yu.N.; Popov, A.K.
2007-01-01
For calculation of power transients in the IBR-2 reactor a special mathematical model of dynamics taking into account the discontinuous jump of reactivity by an automatic controller with the step motor is created. In the model the nonlinear dependence of the energy of power pulse on the reactivity and the influence of warming up of the reactor on the reactivity by means of introduction of a nonlinear feedback 'power-pulse energy - reactivity' are taken into account. With the help of the model the transients of relative deviation of power-pulse energy are calculated at various (random, mixed and regular) reactivity disturbances at the reactor mean power 1.475 MW. It is shown that to improve the quality of processes the choice of such regular values of parameters of the automatic controller is expedient, at which the least effect of smoothing of a signal acting on an automatic controller and the least speed of an automatic controller are provided, and the reduction of efficiency of one step of the automatic controller and introduction of a five-percent dead space are also expedient
Dosimetric Evaluation of Automatic Segmentation for Adaptive IMRT for Head-and-Neck Cancer
International Nuclear Information System (INIS)
Tsuji, Stuart Y.; Hwang, Andrew; Weinberg, Vivian; Yom, Sue S.; Quivey, Jeanne M.; Xia Ping
2010-01-01
Purpose: Adaptive planning to accommodate anatomic changes during treatment requires repeat segmentation. This study uses dosimetric endpoints to assess automatically deformed contours. Methods and Materials: Sixteen patients with head-and-neck cancer had adaptive plans because of anatomic change during radiotherapy. Contours from the initial planning computed tomography (CT) were deformed to the mid-treatment CT using an intensity-based free-form registration algorithm then compared with the manually drawn contours for the same CT using the Dice similarity coefficient and an overlap index. The automatic contours were used to create new adaptive plans. The original and automatic adaptive plans were compared based on dosimetric outcomes of the manual contours and on plan conformality. Results: Volumes from the manual and automatic segmentation were similar; only the gross tumor volume (GTV) was significantly different. Automatic plans achieved lower mean coverage for the GTV: V95: 98.6 ± 1.9% vs. 89.9 ± 10.1% (p = 0.004) and clinical target volume: V95: 98.4 ± 0.8% vs. 89.8 ± 6.2% (p 3 of the spinal cord 39.9 ± 3.7 Gy vs. 42.8 ± 5.4 Gy (p = 0.034), but no difference for the remaining structures. Conclusions: Automatic segmentation is not robust enough to substitute for physician-drawn volumes, particularly for the GTV. However, it generates normal structure contours of sufficient accuracy when assessed by dosimetric end points.
Directory of Open Access Journals (Sweden)
Renata Mota Mamede de Carvallo
2008-09-01
Full Text Available Objective: The aim of the present investigation was to check Transient Evoked Otoacoustic Emissions and Automatic Auditory Brainstem Response tests applied together in regular nurseries and Newborn Intensive Care Units (NICU, as well as to describe and compare the results obtained in both groups. Methods: We tested 150 newborns from regular nurseries and 70 from NICU. Rresults: The newborn hearing screening results using Transient Evoked Otoacoustic Emissions and Automatic Auditory Brainstem Response tests could be applied to all babies. The “pass” result for the group of babies from the nursery was 94.7% using Transient Evoked Otoacoustic Emissions and 96% using Automatic Auditory Brainstem Response. The newborn intensive care unit group obtained 87.1% on Transient Evoked Otoacoustic Emissions and 80% on the Automatic Auditory Brainstem Response, and there was no statistical difference between the procedures when the groups were evaluated individually. However, comparing the groups, Transient Evoked Otoacoustic Emissions were presented in 94.7% of the nursery babies and in 87.1% in the group from the newborn intensive care unit. Considering the Automatic Auditory Brainstem Response, we found 96 and 87%, respectively. Cconclusions: Transient Evoked Otoacoustic Emissions and Automatic Auditory Brainstem Response had similar “pass” and “fail” results when the procedures were applied to neonates from the regular nursery, and the combined tests were more precise to detect hearing impairment in the newborn intensive care unit babies.
Radiation dosimetry by automatic image analysis of dicentric chromosomes
International Nuclear Information System (INIS)
Bayley, R.; Carothers, A.; Farrow, S.; Gordon, J.; Ji, L.; Piper, J.; Rutovitz, D.; Stark, M.; Chen, X.; Wald, N.; Pittsburgh Univ., PA
1991-01-01
A system for scoring dicentric chromosomes by image analysis comprised fully automatic location of mitotic cells, automatic retrieval, focus and digitisation at high resolution, automatic rejection of nuclei and debris and detection and segmentation of chromosome clusters, automatic centromere location, and subsequent rapid interactive visual review of potential dicentric chromosomes to confirm positives and reject false positives. A calibration set of about 15000 cells was used to establish the quadratic dose response for 60 Co γ-irradiation. The dose-response function parameters were established by a maximum likelihood technique, and confidence limits in the dose response and in the corresponding inverse curve, of estimated dose for observed dicentric frequency, were established by Monte Carlo techniques. The system was validated in a blind trial by analysing a test comprising a total of about 8000 cells irradiated to 1 of 10 dose levels, and estimating the doses from the observed dicentric frequency. There was a close correspondence between the estimated and true doses. The overall sensitivity of the system in terms of the proportion of the total population of dicentrics present in the cells analysed that were detected by the system was measured to be about 40%. This implies that about 2.5 times more cells must be analysed by machine than by visual analysis. Taking this factor into account, the measured review time and false positive rates imply that analysis by the system of sufficient cells to provide the equivalent of a visual analysis of 500 cells would require about 1 h for operator review. (author). 20 refs.; 4 figs.; 5 tabs
Scanner OPC signatures: automatic vendor-to-vendor OPE matching
Renwick, Stephen P.
2009-03-01
As 193nm lithography continues to be stretched and the k1 factor decreases, optical proximity correction (OPC) has become a vital part of the lithographer's tool kit. Unfortunately, as is now well known, the design variations of lithographic scanners from different vendors cause them to have slightly different optical-proximity effect (OPE) behavior, meaning that they print features through pitch in distinct ways. This in turn means that their response to OPC is not the same, and that an OPC solution designed for a scanner from Company 1 may or may not work properly on a scanner from Company 2. Since OPC is not inexpensive, that causes trouble for chipmakers using more than one brand of scanner. Clearly a scanner-matching procedure is needed to meet this challenge. Previously, automatic matching has only been reported for scanners of different tool generations from the same manufacturer. In contrast, scanners from different companies have been matched using expert tuning and adjustment techniques, frequently requiring laborious test exposures. Automatic matching between scanners from Company 1 and Company 2 has remained an unsettled problem. We have recently solved this problem and introduce a novel method to perform the automatic matching. The success in meeting this challenge required three enabling factors. First, we recognized the strongest drivers of OPE mismatch and are thereby able to reduce the information needed about a tool from another supplier to that information readily available from all modern scanners. Second, we developed a means of reliably identifying the scanners' optical signatures, minimizing dependence on process parameters that can cloud the issue. Third, we carefully employed standard statistical techniques, checking for robustness of the algorithms used and maximizing efficiency. The result is an automatic software system that can predict an OPC matching solution for scanners from different suppliers without requiring expert intervention.
Semi Automatic Ontology Instantiation in the domain of Risk Management
Makki, Jawad; Alquier, Anne-Marie; Prince, Violaine
One of the challenging tasks in the context of Ontological Engineering is to automatically or semi-automatically support the process of Ontology Learning and Ontology Population from semi-structured documents (texts). In this paper we describe a Semi-Automatic Ontology Instantiation method from natural language text, in the domain of Risk Management. This method is composed from three steps 1 ) Annotation with part-of-speech tags, 2) Semantic Relation Instances Extraction, 3) Ontology instantiation process. It's based on combined NLP techniques using human intervention between steps 2 and 3 for control and validation. Since it heavily relies on linguistic knowledge it is not domain dependent which is a good feature for portability between the different fields of risk management application. The proposed methodology uses the ontology of the PRIMA1 project (supported by the European community) as a Generic Domain Ontology and populates it via an available corpus. A first validation of the approach is done through an experiment with Chemical Fact Sheets from Environmental Protection Agency2.
Precision about the automatic emotional brain.
Vuilleumier, Patrik
2015-01-01
The question of automaticity in emotion processing has been debated under different perspectives in recent years. Satisfying answers to this issue will require a better definition of automaticity in terms of relevant behavioral phenomena, ecological conditions of occurrence, and a more precise mechanistic account of the underlying neural circuits.
Automatic control of nuclear power plants
International Nuclear Information System (INIS)
Jover, P.
1976-01-01
The fundamental concepts in automatic control are surveyed, and the purpose of the automatic control of pressurized water reactors is given. The response characteristics for the main components are then studied and block diagrams are given for the main control loops (turbine, steam generator, and nuclear reactors) [fr
Automatic processing of radioimmunological research data on a computer
International Nuclear Information System (INIS)
Korolyuk, I.P.; Gorodenko, A.N.; Gorodenko, S.I.
1979-01-01
A program ''CRITEST'' in the language PL/1 for the EC computer intended for automatic processing of the results of radioimmunological research has been elaborated. The program works in the operation system of the OC EC computer and is performed in the section OC 60 kb. When compiling the program Eitken's modified algorithm was used. The program was clinically approved when determining a number of hormones: CTH, T 4 , T 3 , TSH. The automatic processing of the radioimmunological research data on the computer makes it possible to simplify the labour-consuming analysis and to raise its accuracy
A Microcontroller-Based Automatic Transfer Switching System for a ...
African Journals Online (AJOL)
Michael
2015-06-01
Jun 1, 2015 ... Most industries still employ the manual method of power supply changeover, ... This paper presents a Microcontroller-Based Automatic Transfer Switching System ..... and currently has special research interest in Wireless.
Interactivity in automatic control: foundations and experiences
Dormido Bencomo, Sebastián; Guzmán Sánchez, José Luis; Costa Castelló, Ramon; Berenguel, M
2012-01-01
The first part of this paper presents the concepts of interactivity and visualization and its essential role in learning the fundamentals and techniques of automatic control. More than 10 years experience of the authors in the development and design of interactive tools dedicated to the study of automatic control concepts are also exposed. The second part of the paper summarizes the main features of the “Automatic Control with Interactive Tools” text that has been recently published by Pea...
Towards unifying inheritance and automatic program specialization
DEFF Research Database (Denmark)
Schultz, Ulrik Pagh
2002-01-01
with covariant specialization to control the automatic application of program specialization to class members. Lapis integrates object-oriented concepts, block structure, and techniques from automatic program specialization to provide both a language where object-oriented designs can be e#ciently implemented......Inheritance allows a class to be specialized and its attributes refined, but implementation specialization can only take place by overriding with manually implemented methods. Automatic program specialization can generate a specialized, effcient implementation. However, specialization of programs...
Preliminary study on computer automatic quantification of brain atrophy
International Nuclear Information System (INIS)
Li Chuanfu; Zhou Kangyuan
2006-01-01
Objective: To study the variability of normal brain volume with the sex and age, and put forward an objective standard for computer automatic quantification of brain atrophy. Methods: The cranial volume, brain volume and brain parenchymal fraction (BPF) of 487 cases of brain atrophy (310 males, 177 females) and 1901 cases of normal subjects (993 males, 908 females) were calculated with the newly developed algorithm of automatic quantification for brain atrophy. With the technique of polynomial curve fitting, the mathematical relationship of BPF with age in normal subjects was analyzed. Results: The cranial volume, brain volume and BPF of normal subjects were (1 271 322 ± 128 699) mm 3 , (1 211 725 ± 122 077) mm 3 and (95.3471 ± 2.3453)%, respectively, and those of atrophy subjects were (1 276 900 ± 125 180) mm 3 , (1 203 400 ± 117 760) mm 3 and BPF(91.8115 ± 2.3035)% respectively. The difference of BPF between the two groups was extremely significant (P 0.05). The expression P(x)=-0.0008x 2 + 0.0193x + 96.9999 could accurately describe the mathematical relationship between BPF and age in normal subject (lower limit of 95% CI y=-0.0008x 2 +0.0184x+95.1090). Conclusion: The lower limit of 95% confidence interval mathematical relationship between BPF and age could be used as an objective criteria for automatic quantification of brain atrophy with computer. (authors)
Automatic NAA. Saturation activities
International Nuclear Information System (INIS)
Westphal, G.P.; Grass, F.; Kuhnert, M.
2008-01-01
A system for Automatic NAA is based on a list of specific saturation activities determined for one irradiation position at a given neutron flux and a single detector geometry. Originally compiled from measurements of standard reference materials, the list may be extended also by the calculation of saturation activities from k 0 and Q 0 factors, and f and α values of the irradiation position. A systematic improvement of the SRM approach is currently being performed by pseudo-cyclic activation analysis, to reduce counting errors. From these measurements, the list of saturation activities is recalculated in an automatic procedure. (author)
Automatic measurement for solid state track detectors
International Nuclear Information System (INIS)
Ogura, Koichi
1982-01-01
Since in solid state track detectors, their tracks are measured with a microscope, observers are forced to do hard works that consume time and labour. This causes to obtain poor statistic accuracy or to produce personal error. Therefore, many researches have been done to aim at simplifying and automating track measurement. There are two categories in automating the measurement: simple counting of the number of tracks and the requirements to know geometrical elements such as the size of tracks or their coordinates as well as the number of tracks. The former is called automatic counting and the latter automatic analysis. The method to generally evaluate the number of tracks in automatic counting is the estimation of the total number of tracks in the total detector area or in a field of view of a microscope. It is suitable for counting when the track density is higher. The method to count tracks one by one includes the spark counting and the scanning microdensitometer. Automatic analysis includes video image analysis in which the high quality images obtained with a high resolution video camera are processed with a micro-computer, and the tracks are automatically recognized and measured by feature extraction. This method is described in detail. In many kinds of automatic measurements reported so far, frequently used ones are ''spark counting'' and ''video image analysis''. (Wakatsuki, Y.)
International Nuclear Information System (INIS)
Iwabuchi, Masashi; Tomita, Jinji; Nishihara, Katsunori.
1978-01-01
Automatization of welding is one of the effective measures for securing high degree of quality of nuclear power equipment, as well as for correspondence to the environment at the site of plant. As the latest ones of the automatic welders practically used for welding of nuclear power apparatuses in factories of Toshiba and IHI, those for pipes and lining tanks are described here. The pipe welder performs the battering welding on the inside of pipe end as the so-called IGSCC countermeasure and the succeeding butt welding through the same controller. The lining tank welder is able to perform simultaneous welding of two parallel weld lines on a large thin plate lining tank. Both types of the welders are demonstrating excellent performance at the shops as well as at the plant site. (author)
Chiu, Stephanie J; Izatt, Joseph A; O'Connell, Rachelle V; Winter, Katrina P; Toth, Cynthia A; Farsiu, Sina
2012-01-05
To automatically segment retinal spectral domain optical coherence tomography (SD-OCT) images of eyes with age-related macular degeneration (AMD) and various levels of image quality to advance the study of retinal pigment epithelium (RPE)+drusen complex (RPEDC) volume changes indicative of AMD progression. A general segmentation framework based on graph theory and dynamic programming was used to segment three retinal boundaries in SD-OCT images of eyes with drusen and geographic atrophy (GA). A validation study for eyes with nonneovascular AMD was conducted, forming subgroups based on scan quality and presence of GA. To test for accuracy, the layer thickness results from two certified graders were compared against automatic segmentation results for 220 B-scans across 20 patients. For reproducibility, automatic layer volumes were compared that were generated from 0° versus 90° scans in five volumes with drusen. The mean differences in the measured thicknesses of the total retina and RPEDC layers were 4.2 ± 2.8 and 3.2 ± 2.6 μm for automatic versus manual segmentation. When the 0° and 90° datasets were compared, the mean differences in the calculated total retina and RPEDC volumes were 0.28% ± 0.28% and 1.60% ± 1.57%, respectively. The average segmentation time per image was 1.7 seconds automatically versus 3.5 minutes manually. The automatic algorithm accurately and reproducibly segmented three retinal boundaries in images containing drusen and GA. This automatic approach can reduce time and labor costs and yield objective measurements that potentially reveal quantitative RPE changes in longitudinal clinical AMD studies. (ClinicalTrials.gov number, NCT00734487.).
Cai, Wei; He, Baochun; Fan, Yingfang; Fang, Chihua; Jia, Fucang
2016-11-08
This study was to evaluate the accuracy, consistency, and efficiency of three liver volumetry methods- one interactive method, an in-house-developed 3D medical Image Analysis (3DMIA) system, one automatic active shape model (ASM)-based segmentation, and one automatic probabilistic atlas (PA)-guided segmentation method on clinical contrast-enhanced CT images. Forty-two datasets, including 27 normal liver and 15 space-occupying liver lesion patients, were retrospectively included in this study. The three methods - one semiautomatic 3DMIA, one automatic ASM-based, and one automatic PA-based liver volumetry - achieved an accuracy with VD (volume difference) of -1.69%, -2.75%, and 3.06% in the normal group, respectively, and with VD of -3.20%, -3.35%, and 4.14% in the space-occupying lesion group, respectively. However, the three methods achieved an efficiency of 27.63 mins, 1.26 mins, 1.18 mins on average, respectively, compared with the manual volumetry, which took 43.98 mins. The high intraclass correlation coefficient between the three methods and the manual method indicated an excel-lent agreement on liver volumetry. Significant differences in segmentation time were observed between the three methods (3DMIA, ASM, and PA) and the manual volumetry (p volumetries (ASM and PA) and the semiautomatic volumetry (3DMIA) (p < 0.001). The semiautomatic interactive 3DMIA, automatic ASM-based, and automatic PA-based liver volum-etry agreed well with manual gold standard in both the normal liver group and the space-occupying lesion group. The ASM- and PA-based automatic segmentation have better efficiency in clinical use. © 2016 The Authors.
An automatic control unit for A neutron diffraction crystal spectrometer
International Nuclear Information System (INIS)
Adib, M.; Abbas, Y.; Mostafa, M.; Hamouda, I.
1982-01-01
An automatic transistorized unit has been designed and constructed to control the operation of the double axis crystal spectrometer installed in front of one of the horizontal channels of the ET-RR-1 reactor. The function of the automatic unit is to store the diffracted neutrons at a certain angle with respect to the direction of the incident neutron beam in a selected channel of a 1024-multichannel analyzer for a certain preadjusted time period. AT the end of this time period the unit rotates the spectrometer's arm to another angle, selects the next channel of the MCA and provides the measurement of the diffracted neutron for the same time period. Such a sequence is repeated automatically over all angles required for the neutron diffraction pattern of the sample under investigation. As a result, the stored information at the MCA provides the neutron diffraction pattern as a function of channel number, where each channel corresponds to a certain scattering angle. The stored distribution at MCA can be obtained through the analyzer read out unit. The designed automatic unit has the possibility of providing the neutron diffraction pattern using a 6-digit scaler and a printer
Finite element fatigue analysis of rectangular clutch spring of automatic slack adjuster
Xu, Chen-jie; Luo, Zai; Hu, Xiao-feng; Jiang, Wen-song
2015-02-01
The failure of rectangular clutch spring of automatic slack adjuster directly affects the work of automatic slack adjuster. We establish the structural mechanics model of automatic slack adjuster rectangular clutch spring based on its working principle and mechanical structure. In addition, we upload such structural mechanics model to ANSYS Workbench FEA system to predict the fatigue life of rectangular clutch spring. FEA results show that the fatigue life of rectangular clutch spring is 2.0403×105 cycle under the effect of braking loads. In the meantime, fatigue tests of 20 automatic slack adjusters are carried out on the fatigue test bench to verify the conclusion of the structural mechanics model. The experimental results show that the mean fatigue life of rectangular clutch spring is 1.9101×105, which meets the results based on the finite element analysis using ANSYS Workbench FEA system.
Speed and automaticity of word recognition - inseparable twins?
DEFF Research Database (Denmark)
Poulsen, Mads; Asmussen, Vibeke; Elbro, Carsten
'Speed and automaticity' of word recognition is a standard collocation. However, it is not clear whether speed and automaticity (i.e., effortlessness) make independent contributions to reading comprehension. In theory, both speed and automaticity may save cognitive resources for comprehension...... processes. Hence, the aim of the present study was to assess the unique contributions of word recognition speed and automaticity to reading comprehension while controlling for decoding speed and accuracy. Method: 139 Grade 5 students completed tests of reading comprehension and computer-based tests of speed...... of decoding and word recognition together with a test of effortlessness (automaticity) of word recognition. Effortlessness was measured in a dual task in which participants were presented with a word enclosed in an unrelated figure. The task was to read the word and decide whether the figure was a triangle...
Automatic Mosaicking of Satellite Imagery Considering the Clouds
Kang, Yifei; Pan, Li; Chen, Qi; Zhang, Tong; Zhang, Shasha; Liu, Zhang
2016-06-01
With the rapid development of high resolution remote sensing for earth observation technology, satellite imagery is widely used in the fields of resource investigation, environment protection, and agricultural research. Image mosaicking is an important part of satellite imagery production. However, the existence of clouds leads to lots of disadvantages for automatic image mosaicking, mainly in two aspects: 1) Image blurring may be caused during the process of image dodging, 2) Cloudy areas may be passed through by automatically generated seamlines. To address these problems, an automatic mosaicking method is proposed for cloudy satellite imagery in this paper. Firstly, modified Otsu thresholding and morphological processing are employed to extract cloudy areas and obtain the percentage of cloud cover. Then, cloud detection results are used to optimize the process of dodging and mosaicking. Thus, the mosaic image can be combined with more clear-sky areas instead of cloudy areas. Besides, clear-sky areas will be clear and distortionless. The Chinese GF-1 wide-field-of-view orthoimages are employed as experimental data. The performance of the proposed approach is evaluated in four aspects: the effect of cloud detection, the sharpness of clear-sky areas, the rationality of seamlines and efficiency. The evaluation results demonstrated that the mosaic image obtained by our method has fewer clouds, better internal color consistency and better visual clarity compared with that obtained by traditional method. The time consumed by the proposed method for 17 scenes of GF-1 orthoimages is within 4 hours on a desktop computer. The efficiency can meet the general production requirements for massive satellite imagery.
Automatic terrain modeling using transfinite element analysis
Collier, Nathan; Calo, Victor M.
2010-01-01
An automatic procedure for modeling terrain is developed based on L2 projection-based interpolation of discrete terrain data onto transfinite function spaces. The function space is refined automatically by the use of image processing techniques
Towards automatic exchange of information
Oberson, Xavier
2015-01-01
This article describes the various steps that led towards automatic exchange of information as the global standard and the issues that remain to be solved. First, the various competing models of exchange information, such as Double Tax Treaty (DTT), TIEA's, FATCA or UE Directives are described with a view to show how they interact between themselves. Second, the so-called Rubik Strategy is summarized and compared with an automatic exchange of information (AEOI). The third part then describes ...
Automatically processed alpha-track radon monitor
International Nuclear Information System (INIS)
Langner, G.H. Jr.
1993-01-01
An automatically processed alpha-track radon monitor is provided which includes a housing having an aperture allowing radon entry, and a filter that excludes the entry of radon daughters into the housing. A flexible track registration material is located within the housing that records alpha-particle emissions from the decay of radon and radon daughters inside the housing. The flexible track registration material is capable of being spliced such that the registration material from a plurality of monitors can be spliced into a single strip to facilitate automatic processing of the registration material from the plurality of monitors. A process for the automatic counting of radon registered by a radon monitor is also provided
Disentangling Complexity in Bayesian Automatic Adaptive Quadrature
Adam, Gheorghe; Adam, Sanda
2018-02-01
The paper describes a Bayesian automatic adaptive quadrature (BAAQ) solution for numerical integration which is simultaneously robust, reliable, and efficient. Detailed discussion is provided of three main factors which contribute to the enhancement of these features: (1) refinement of the m-panel automatic adaptive scheme through the use of integration-domain-length-scale-adapted quadrature sums; (2) fast early problem complexity assessment - enables the non-transitive choice among three execution paths: (i) immediate termination (exceptional cases); (ii) pessimistic - involves time and resource consuming Bayesian inference resulting in radical reformulation of the problem to be solved; (iii) optimistic - asks exclusively for subrange subdivision by bisection; (3) use of the weaker accuracy target from the two possible ones (the input accuracy specifications and the intrinsic integrand properties respectively) - results in maximum possible solution accuracy under minimum possible computing time.
Automatic Lamp and Fan Control Based on Microcontroller
Widyaningrum, V. T.; Pramudita, Y. D.
2018-01-01
In general, automation can be described as a process following pre-determined sequential steps with a little or without any human exertion. Automation is provided with the use of various sensors suitable to observe the production processes, actuators and different techniques and devices. In this research, the automation system developed is an automatic lamp and an automatic fan on the smart home. Both of these systems will be processed using an Arduino Mega 2560 microcontroller. A microcontroller is used to obtain values of physical conditions through sensors connected to it. In the automatic lamp system required sensors to detect the light of the LDR (Light Dependent Resistor) sensor. While the automatic fan system required sensors to detect the temperature of the DHT11 sensor. In tests that have been done lamps and fans can work properly. The lamp can turn on automatically when the light begins to darken, and the lamp can also turn off automatically when the light begins to bright again. In addition, it can concluded also that the readings of LDR sensors are placed outside the room is different from the readings of LDR sensors placed in the room. This is because the light intensity received by the existing LDR sensor in the room is blocked by the wall of the house or by other objects. Then for the fan, it can also turn on automatically when the temperature is greater than 25°C, and the fan speed can also be adjusted. The fan may also turn off automatically when the temperature is less than equal to 25°C.
Automatic imitation of pro- and antisocial gestures: Is implicit social behavior censored?
Cracco, Emiel; Genschow, Oliver; Radkova, Ina; Brass, Marcel
2018-01-01
According to social reward theories, automatic imitation can be understood as a means to obtain positive social consequences. In line with this view, it has been shown that automatic imitation is modulated by contextual variables that constrain the positive outcomes of imitation. However, this work has largely neglected that many gestures have an inherent pro- or antisocial meaning. As a result of their meaning, antisocial gestures are considered taboo and should not be used in public. In three experiments, we show that automatic imitation of symbolic gestures is modulated by the social intent of these gestures. Experiment 1 (N=37) revealed reduced automatic imitation of antisocial compared with prosocial gestures. Experiment 2 (N=118) and Experiment 3 (N=118) used a social priming procedure to show that this effect was stronger in a prosocial context than in an antisocial context. These findings were supported in a within-study meta-analysis using both frequentist and Bayesian statistics. Together, our results indicate that automatic imitation is regulated by internalized social norms that act as a stop signal when inappropriate actions are triggered. Copyright © 2017 Elsevier B.V. All rights reserved.
Automatic Evaluations and Exercising: Systematic Review and Implications for Future Research.
Schinkoeth, Michaela; Antoniewicz, Franziska
2017-01-01
The general purpose of this systematic review was to summarize, structure and evaluate the findings on automatic evaluations of exercising. Studies were eligible for inclusion if they reported measuring automatic evaluations of exercising with an implicit measure and assessed some kind of exercise variable. Fourteen nonexperimental and six experimental studies (out of a total N = 1,928) were identified and rated by two independent reviewers. The main study characteristics were extracted and the grade of evidence for each study evaluated. First, results revealed a large heterogeneity in the applied measures to assess automatic evaluations of exercising and the exercise variables. Generally, small to large-sized significant relations between automatic evaluations of exercising and exercise variables were identified in the vast majority of studies. The review offers a systematization of the various examined exercise variables and prompts to differentiate more carefully between actually observed exercise behavior (proximal exercise indicator) and associated physiological or psychological variables (distal exercise indicator). Second, a lack of transparent reported reflections on the differing theoretical basis leading to the use of specific implicit measures was observed. Implicit measures should be applied purposefully, taking into consideration the individual advantages or disadvantages of the measures. Third, 12 studies were rated as providing first-grade evidence (lowest grade of evidence), five represent second-grade and three were rated as third-grade evidence. There is a dramatic lack of experimental studies, which are essential for illustrating the cause-effect relation between automatic evaluations of exercising and exercise and investigating under which conditions automatic evaluations of exercising influence behavior. Conclusions about the necessity of exercise interventions targeted at the alteration of automatic evaluations of exercising should therefore
30 CFR 75.523-3 - Automatic emergency-parking brakes.
2010-07-01
... immediately by the emergency deenergization device required by 30 CFR 75.523-1 and -75.523-2; (2) Engage automatically within 5.0 seconds when the equipment is deenergized; (3) Safely bring the equipment when fully...
21 CFR 211.68 - Automatic, mechanical, and electronic equipment.
2010-04-01
... SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Equipment § 211.68 Automatic, mechanical, and electronic equipment. (a) Automatic, mechanical, or electronic... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Automatic, mechanical, and electronic equipment...
Automatic Clustering Using FSDE-Forced Strategy Differential Evolution
Yasid, A.
2018-01-01
Clustering analysis is important in datamining for unsupervised data, cause no adequate prior knowledge. One of the important tasks is defining the number of clusters without user involvement that is known as automatic clustering. This study intends on acquiring cluster number automatically utilizing forced strategy differential evolution (AC-FSDE). Two mutation parameters, namely: constant parameter and variable parameter are employed to boost differential evolution performance. Four well-known benchmark datasets were used to evaluate the algorithm. Moreover, the result is compared with other state of the art automatic clustering methods. The experiment results evidence that AC-FSDE is better or competitive with other existing automatic clustering algorithm.
A high reliability automatic multiplier for a mass spectrometer ion detector circuit
International Nuclear Information System (INIS)
Hoshino, Kiichi; Satooka, Sakae
1978-01-01
An automatic multiplier of an ion detector circuit for measurement of isotopic abundance ratio of heavy hydrogen to be used with a single collector has been constructed. This multiplier works at 1/1, 1/5, 1/20, 1/100, 1/500, 1/2000 and infinity, and the input voltage which is required to change the range from 1/1 to 1/5 is 10 mV and that from 1/2000 to infinity is 20 V. As the amplifier preceding the automatic multiplier, a vibrating reed electrometer which generates maximum output of 30 V is used. On measurement, marks which indicate the magnifications are recorded on the chart of electronic recorder. It is possible to set the minimum magnification at 1/1, 1/5, or 1/20 by a switch for setting the minimum magnification. (author)
Spreeuwers, Lieuwe Jan; Hendrikse, A.J.; Gerritsen, K.J.; Brömme, A.; Busch, C.
2012-01-01
Automatic border control at airports using automated facial recognition for checking the passport is becoming more and more common. A problem is that it is not clear how reliable these automatic gates are. Very few independent studies exist that assess the reliability of automated facial recognition
Wang, Jieqiong; Miao, Wen; Li, Jing; Li, Meng; Zhen, Zonglei; Sabel, Bernhard; Xian, Junfang; He, Huiguang
2015-11-30
The lateral geniculate nucleus (LGN) is a key relay center of the visual system. Because the LGN morphology is affected by different diseases, it is of interest to analyze its morphology by segmentation. However, existing LGN segmentation methods are non-automatic, inefficient and prone to experimenters' bias. To address these problems, we proposed an automatic LGN segmentation algorithm based on T1-weighted imaging. First, the prior information of LGN was used to create a prior mask. Then region growing was applied to delineate LGN. We evaluated this automatic LGN segmentation method by (1) comparison with manually segmented LGN, (2) anatomically locating LGN in the visual system via LGN-based tractography, (3) application to control and glaucoma patients. The similarity coefficients of automatic segmented LGN and manually segmented one are 0.72 (0.06) for the left LGN and 0.77 (0.07) for the right LGN. LGN-based tractography shows the subcortical pathway seeding from LGN passes the optic tract and also reaches V1 through the optic radiation, which is consistent with the LGN location in the visual system. In addition, LGN asymmetry as well as LGN atrophy along with age is observed in normal controls. The investigation of glaucoma effects on LGN volumes demonstrates that the bilateral LGN volumes shrink in patients. The automatic LGN segmentation is objective, efficient, valid and applicable. Experiment results proved the validity and applicability of the algorithm. Our method will speed up the research on visual system and greatly enhance studies of different vision-related diseases. Copyright © 2015 Elsevier B.V. All rights reserved.
An introduction to automatic radioactive sample counters
International Nuclear Information System (INIS)
1980-01-01
The subject is covered in chapters, entitled; the detection of radiation in sample counters; nucleonic equipment; liquid scintillation counting; basic features of automatic sample counters; statistics of counting; data analysis; purchase, installation, calibration and maintenance of automatic sample counters. (U.K.)
Automatic Cobb Angle Determination From Radiographic Images
Sardjono, Tri Arief; Wilkinson, Michael H. F.; Veldhuizen, Albert G.; van Ooijen, Peter M. A.; Purnama, Ketut E.; Verkerke, Gijsbertus J.
2013-01-01
Study Design. Automatic measurement of Cobb angle in patients with scoliosis. Objective. To test the accuracy of an automatic Cobb angle determination method from frontal radiographical images. Summary of Background Data. Thirty-six frontal radiographical images of patients with scoliosis. Methods.
Observed use of automatic seat belts in 1987 cars.
Williams, A F; Wells, J K; Lund, A K; Teed, N
1989-10-01
Usage of the automatic belt systems supplied by six large-volume automobile manufacturers to meet the federal requirements for automatic restraints were observed in suburban Washington, D.C., Chicago, Los Angeles, and Philadelphia. The different belt systems studied were: Ford and Toyota (motorized, nondetachable automatic shoulder belt), Nissan (motorized, detachable shoulder belt), VW and Chrysler (nonmotorized, detachable shoulder belt), and GM (nonmotorized detachable lap and shoulder belt). Use of automatic belts was significantly greater than manual belt use in otherwise comparable late-model cars for all manufacturers except Chrysler; in Chrysler cars, automatic belt use was significantly lower than manual belt use. The automatic shoulder belts provided by Ford, Nissan, Toyota, and VW increased use rates to about 90%. Because use rates were lower in Ford cars with manual belts, their increase was greater. GM cars had the smallest increase in use rates; however, lap belt use was highest in GM cars. The other manufacturers supply knee bolsters to supplement shoulder belt protection; all--except VW--also provide manual lap belts, which were used by about half of those who used the automatic shoulder belt. The results indicate that some manufacturers have been more successful than others in providing automatic belt systems that result in high use that, in turn, will mean fewer deaths and injuries in those cars.
Automatic sample changers maintenance manual
International Nuclear Information System (INIS)
Myers, T.A.
1978-10-01
This manual describes and provides trouble-shooting aids for the Automatic Sample Changer electronics on the automatic beta counting system, developed by the Los Alamos Scientific Laboratory Group CNC-11. The output of a gas detector is shaped by a preamplifier, then is coupled to an amplifier. Amplifier output is discriminated and is the input to a scaler. An identification number is associated with each sample. At a predetermined count length, the identification number, scaler data plus other information is punched out on a data card. The next sample to be counted is automatically selected. The beta counter uses the same electronics as the prior count did, the only difference being the sample identification number and sample itself. This manual is intended as a step-by-step aid in trouble-shooting the electronics associated with positioning the sample, counting the sample, and getting the needed data punched on an 80-column data card
Automatic, semi-automatic and manual validation of urban drainage data.
Branisavljević, N; Prodanović, D; Pavlović, D
2010-01-01
Advances in sensor technology and the possibility of automated long distance data transmission have made continuous measurements the preferable way of monitoring urban drainage processes. Usually, the collected data have to be processed by an expert in order to detect and mark the wrong data, remove them and replace them with interpolated data. In general, the first step in detecting the wrong, anomaly data is called the data quality assessment or data validation. Data validation consists of three parts: data preparation, validation scores generation and scores interpretation. This paper will present the overall framework for the data quality improvement system, suitable for automatic, semi-automatic or manual operation. The first two steps of the validation process are explained in more detail, using several validation methods on the same set of real-case data from the Belgrade sewer system. The final part of the validation process, which is the scores interpretation, needs to be further investigated on the developed system.
Automatic short axis orientation of the left ventricle in 3D ultrasound recordings
Pedrosa, João.; Heyde, Brecht; Heeren, Laurens; Engvall, Jan; Zamorano, Jose; Papachristidis, Alexandros; Edvardsen, Thor; Claus, Piet; D'hooge, Jan
2016-04-01
The recent advent of three-dimensional echocardiography has led to an increased interest from the scientific community in left ventricle segmentation frameworks for cardiac volume and function assessment. An automatic orientation of the segmented left ventricular mesh is an important step to obtain a point-to-point correspondence between the mesh and the cardiac anatomy. Furthermore, this would allow for an automatic division of the left ventricle into the standard 17 segments and, thus, fully automatic per-segment analysis, e.g. regional strain assessment. In this work, a method for fully automatic short axis orientation of the segmented left ventricle is presented. The proposed framework aims at detecting the inferior right ventricular insertion point. 211 three-dimensional echocardiographic images were used to validate this framework by comparison to manual annotation of the inferior right ventricular insertion point. A mean unsigned error of 8, 05° +/- 18, 50° was found, whereas the mean signed error was 1, 09°. Large deviations between the manual and automatic annotations (> 30°) only occurred in 3, 79% of cases. The average computation time was 666ms in a non-optimized MATLAB environment, which potentiates real-time application. In conclusion, a successful automatic real-time method for orientation of the segmented left ventricle is proposed.
12th Portuguese Conference on Automatic Control
Soares, Filomena; Moreira, António
2017-01-01
The biennial CONTROLO conferences are the main events promoted by The CONTROLO 2016 – 12th Portuguese Conference on Automatic Control, Guimarães, Portugal, September 14th to 16th, was organized by Algoritmi, School of Engineering, University of Minho, in partnership with INESC TEC, and promoted by the Portuguese Association for Automatic Control – APCA, national member organization of the International Federation of Automatic Control – IFAC. The seventy-five papers published in this volume cover a wide range of topics. Thirty-one of them, of a more theoretical nature, are distributed among the first five parts: Control Theory; Optimal and Predictive Control; Fuzzy, Neural and Genetic Control; Modeling and Identification; Sensing and Estimation. The papers go from cutting-edge theoretical research to innovative control applications and show expressively how Automatic Control can be used to increase the well being of people. .
Some experimental results for an automatic helium liquefier
International Nuclear Information System (INIS)
Watanabe, T.; Kudo, T.; Kuraoka, Y.; Sakura, K.; Tsuruga, H.; Watanabe, T.
1984-01-01
This chapter describes the testing of an automatic cooldown system. The liquefying machine examined is a CTi Model 1400. The automatic helium gas liquefying system is operated by using sequence control with a programmable controller. The automatic mode is carried out by operation of two compressors. The monitoring system consists of 41 remote sensors. Liquid level is measured by a superconducting level meter. The J-T valve and return valve, which require precise control, are operated by pulse motors. The advantages of the automatic cooldown system are reduced operator man power; temperatures and pressures are changed smoothly, so that the flow chart of automation is simple; and the system makes continuous liquefier operation possible
Automatic Construction of Finite Algebras
Institute of Scientific and Technical Information of China (English)
张健
1995-01-01
This paper deals with model generation for equational theories,i.e.,automatically generating (finite)models of a given set of (logical) equations.Our method of finite model generation and a tool for automatic construction of finite algebras is described.Some examples are given to show the applications of our program.We argue that,the combination of model generators and theorem provers enables us to get a better understanding of logical theories.A brief comparison betwween our tool and other similar tools is also presented.
Grinding Parts For Automatic Welding
Burley, Richard K.; Hoult, William S.
1989-01-01
Rollers guide grinding tool along prospective welding path. Skatelike fixture holds rotary grinder or file for machining large-diameter rings or ring segments in preparation for welding. Operator grasps handles to push rolling fixture along part. Rollers maintain precise dimensional relationship so grinding wheel cuts precise depth. Fixture-mounted grinder machines surface to quality sufficient for automatic welding; manual welding with attendant variations and distortion not necessary. Developed to enable automatic welding of parts, manual welding of which resulted in weld bead permeated with microscopic fissures.
46 CFR 171.118 - Automatic ventilators and side ports.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Automatic ventilators and side ports. 171.118 Section 171.118 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY... Bulkhead or Weather Deck § 171.118 Automatic ventilators and side ports. (a) An automatic ventilator must...
Automatic Error Recovery in Robot Assembly Operations Using Reverse Execution
DEFF Research Database (Denmark)
Laursen, Johan Sund; Schultz, Ulrik Pagh; Ellekilde, Lars-Peter
2015-01-01
, in particular for small-batch productions. As an alternative, we propose a system for automatically handling certain classes of errors instead of preventing them. Specifically, we show that many operations can be automatically reversed. Errors can be handled through automatic reverse execution of the control...... program to a safe point, from which forward execution can be resumed. This paper describes the principles behind automatic reversal of robotic assembly operations, and experimentally demonstrates the use of a domain-specific language that supports automatic error handling through reverse execution. Our...
Automatic analyzing device for chlorine ion
International Nuclear Information System (INIS)
Sugibayashi, Shinji; Morikawa, Yoshitake; Fukase, Kazuo; Kashima, Hiromasa.
1997-01-01
The present invention provides a device of automatically analyzing a trance amount of chlorine ions contained in feedwater, condensate and reactor water of a BWR type power plant. Namely, zero-adjustment or span calibration in this device is conducted as follows. (1) A standard chlorine ion liquid is supplied from a tank to a mixer by a constant volume pump, and the liquid is diluted and mixed with purified water to form a standard liquid. (2) The pH of the standard liquid is adjusted by a pH adjuster. (3) The standard liquid is supplied to an electrode cell to conduct zero adjustment or span calibration. Chlorine ions in a specimen are measured by the device of the present invention as follows. (1) The specimen is supplied to a head tank through a line filter. (2) The pH of the specimen is adjusted by a pH adjuster. (3) The specimen is supplied to an electrode cell to electrically measure the concentration of the chlorine ions in the specimen. The device of the present invention can automatically analyze trance amount of chlorine ions at a high accuracy, thereby capable of improving the sensitivity, reducing an operator's burden and radiation exposure. (I.S.)
Automatic ultrasound technique to measure angle of progression during labor.
Conversano, F; Peccarisi, M; Pisani, P; Di Paola, M; De Marco, T; Franchini, R; Greco, A; D'Ambrogio, G; Casciaro, S
2017-12-01
To evaluate the accuracy and reliability of an automatic ultrasound technique for assessment of the angle of progression (AoP) during labor. Thirty-nine pregnant women in the second stage of labor, with fetus in cephalic presentation, underwent conventional labor management with additional translabial sonographic examination. AoP was measured in a total of 95 acquisition sessions, both automatically by an innovative algorithm and manually by an experienced sonographer, who was blinded to the algorithm outcome. The results obtained from the manual measurement were used as the reference against which the performance of the algorithm was assessed. In order to overcome the common difficulties encountered when visualizing by sonography the pubic symphysis, the AoP was measured by considering as the symphysis landmark its centroid rather than its distal point, thereby assuring high measurement reliability and reproducibility, while maintaining objectivity and accuracy in the evaluation of progression of labor. There was a strong and statistically significant correlation between AoP values measured by the algorithm and the reference values (r = 0.99, P < 0.001). The high accuracy provided by the automatic method was also highlighted by the corresponding high values of the coefficient of determination (r 2 = 0.98) and the low residual errors (root mean square error = 2°27' (2.1%)). The global agreement between the two methods, assessed through Bland-Altman analysis, resulted in a negligible mean difference of 1°1' (limits of agreement, 4°29'). The proposed automatic algorithm is a reliable technique for measurement of the AoP. Its (relative) operator-independence has the potential to reduce human errors and speed up ultrasound acquisition time, which should facilitate management of women during labor. Copyright © 2017 ISUOG. Published by John Wiley & Sons Ltd. Copyright © 2017 ISUOG. Published by John Wiley & Sons Ltd.
Vamos¸, C˘alin
2013-01-01
Our book introduces a method to evaluate the accuracy of trend estimation algorithms under conditions similar to those encountered in real time series processing. This method is based on Monte Carlo experiments with artificial time series numerically generated by an original algorithm. The second part of the book contains several automatic algorithms for trend estimation and time series partitioning. The source codes of the computer programs implementing these original automatic algorithms are given in the appendix and will be freely available on the web. The book contains clear statement of the conditions and the approximations under which the algorithms work, as well as the proper interpretation of their results. We illustrate the functioning of the analyzed algorithms by processing time series from astrophysics, finance, biophysics, and paleoclimatology. The numerical experiment method extensively used in our book is already in common use in computational and statistical physics.
Automatic control of commercial computer programs
International Nuclear Information System (INIS)
Rezvov, B.A.; Artem'ev, A.N.; Maevskij, A.G.; Demkiv, A.A.; Kirillov, B.F.; Belyaev, A.D.; Artem'ev, N.A.
2010-01-01
The way of automatic control of commercial computer programs is presented. The developed connection of the EXAFS spectrometer automatic system (which is managed by PC for DOS) is taken with the commercial program for the CCD detector control (which is managed by PC for Windows). The described complex system is used for the automation of intermediate amplitude spectra processing in EXAFS spectrum measurements at Kurchatov SR source
Methodology Investigation Automatic Magnetic Recording Borescope.
1986-01-01
or other brushless signal coupling devices to the extent possible and feasible to reduce or eliminate the need for slip ring and brush type signal...the inspection head, is used to magnetically couple the necessary energy across the rotary interface. Because there is (1) an appreciable air gap in...were written. (2) As required by the contract, the signal conditioners in the MB employ automatic gain control to compensate for the changes in
International Nuclear Information System (INIS)
Yebra, Francisco; Troncoso, Jacobo; Romaní, Luis
2017-01-01
Highlights: • An apparatus for measuring speed of sound of liquids is described. • Pressure and temperature control is fully automatized. • Uncertainty of the measurements is estimated in 0.1%. • Comparison with literature data confirms the reliability of the methodology. - Abstract: An instrument for determining the speed of sound as a function of temperature and pressure for liquids is described. It was totally automatized: pressure and temperature values are controlled and time of flight of the ultrasonic wave data were acquired using a digital system which automatically made all required actions. The instrument calibration was made only at atmospheric pressure using high quality data of water and methanol. For higher pressures, the calibration parameters were predicted using a model for the high pressure cell, through finite-element calculations (FEM), in order to realistically determine the changes in the cell induced by the compression. Uncertainties in pressure and temperature were 20 mK and 0.1 MPa, respectively and in speed of sound it was estimated to be about 0.1%. The speeds of sound for water, methanol, hexane, heptane, octane, toluene, ethanol and 1-propanol were determined in the temperature and pressure ranges (283.15–343.15) K and (0.1–95) MPa. Comparison with literature data reveals the high reliability of the experimental procedure.
Formal Specification Based Automatic Test Generation for Embedded Network Systems
Directory of Open Access Journals (Sweden)
Eun Hye Choi
2014-01-01
Full Text Available Embedded systems have become increasingly connected and communicate with each other, forming large-scaled and complicated network systems. To make their design and testing more reliable and robust, this paper proposes a formal specification language called SENS and a SENS-based automatic test generation tool called TGSENS. Our approach is summarized as follows: (1 A user describes requirements of target embedded network systems by logical property-based constraints using SENS. (2 Given SENS specifications, test cases are automatically generated using a SAT-based solver. Filtering mechanisms to select efficient test cases are also available in our tool. (3 In addition, given a testing goal by the user, test sequences are automatically extracted from exhaustive test cases. We’ve implemented our approach and conducted several experiments on practical case studies. Through the experiments, we confirmed the efficiency of our approach in design and test generation of real embedded air-conditioning network systems.
Automatic blood detection in capsule endoscopy video
Czech Academy of Sciences Publication Activity Database
Novozámský, Adam; Flusser, Jan; Tachecí, I.; Sulík, L.; Bureš, J.; Krejcar, O.
2016-01-01
Roč. 21, č. 12 (2016), s. 1-8, č. článku 126007. ISSN 1083-3668 R&D Projects: GA ČR GA15-16928S Institutional support: RVO:67985556 Keywords : Automatic blood detection * capsule endoscopy video Subject RIV: JD - Computer Applications, Robotics Impact factor: 2.530, year: 2016 http://library.utia.cas.cz/separaty/2016/ZOI/flusser-0466936.pdf
Development of an automatic scaler
International Nuclear Information System (INIS)
He Yuehong
2009-04-01
A self-designed automatic scaler is introduced. A microcontroller LPC936 is used as the master chip in the scaler. A counter integrated with the micro-controller is configured to operate as external pulse counter. Software employed in the scaler is based on a embedded real-time operating system kernel named Small RTOS. Data storage, calculation and some other functions are also provided. The scaler is designed for applications with low cost, low power consumption solutions. By now, the automatic scaler has been applied in a surface contamination instrument. (authors)
Annual review in automatic programming
Goodman, Richard
2014-01-01
Annual Review in Automatic Programming focuses on the techniques of automatic programming used with digital computers. Topics covered range from the design of machine-independent programming languages to the use of recursive procedures in ALGOL 60. A multi-pass translation scheme for ALGOL 60 is described, along with some commercial source languages. The structure and use of the syntax-directed compiler is also considered.Comprised of 12 chapters, this volume begins with a discussion on the basic ideas involved in the description of a computing process as a program for a computer, expressed in
Directory of Open Access Journals (Sweden)
M. Alvioli
2016-11-01
Full Text Available Automatic subdivision of landscapes into terrain units remains a challenge. Slope units are terrain units bounded by drainage and divide lines, but their use in hydrological and geomorphological studies is limited because of the lack of reliable software for their automatic delineation. We present the r.slopeunits software for the automatic delineation of slope units, given a digital elevation model and a few input parameters. We further propose an approach for the selection of optimal parameters controlling the terrain subdivision for landslide susceptibility modeling. We tested the software and the optimization approach in central Italy, where terrain, landslide, and geo-environmental information was available. The software was capable of capturing the variability of the landscape and partitioning the study area into slope units suited for landslide susceptibility modeling and zonation. We expect r.slopeunits to be used in different physiographical settings for the production of reliable and reproducible landslide susceptibility zonations.
Kim, H C; Khanwilkar, P S; Bearnson, G B; Olsen, D B
1997-01-01
An automatic physiological control system for the actively filled, alternately pumped ventricles of the volumetrically coupled, electrohydraulic total artificial heart (EHTAH) was developed for long-term use. The automatic control system must ensure that the device: 1) maintains a physiological response of cardiac output, 2) compensates for an nonphysiological condition, and 3) is stable, reliable, and operates at a high power efficiency. The developed automatic control system met these requirements both in vitro, in week-long continuous mock circulation tests, and in vivo, in acute open-chested animals (calves). Satisfactory results were also obtained in a series of chronic animal experiments, including 21 days of continuous operation of the fully automatic control mode, and 138 days of operation in a manual mode, in a 159-day calf implant.
A Unification of Inheritance and Automatic Program Specialization
DEFF Research Database (Denmark)
Schultz, Ulrik Pagh
2004-01-01
, inheritance is used to control the automatic application of program specialization to class members during compilation to obtain an efficient implementation. This paper presents the language JUST, which integrates object-oriented concepts, block structure, and techniques from automatic program specialization......The object-oriented style of programming facilitates program adaptation and enhances program genericness, but at the expense of efficiency. Automatic program specialization can be used to generate specialized, efficient implementations for specific scenarios, but requires the program...... to be structured appropriately for specialization and is yet another new concept for the programmer to understand and apply. We have unified automatic program specialization and inheritance into a single concept, and implemented this approach in a modified version of Java named JUST. When programming in JUST...
Equipment for fully automatic radiographic pipe inspection
International Nuclear Information System (INIS)
Basler, G.; Sperl, H.; Weinschenk, K.
1977-01-01
The patent describes a device for fully automatic radiographic testing of large pipes with longitudinal welds. Furthermore the invention enables automatic marking of films in radiographic inspection with regard to a ticketing of the test piece and of that part of it where testing took place. (RW) [de
Metabolic changes in occipital lobe epilepsy with automatisms.
Wong, Chong H; Mohamed, Armin; Wen, Lingfeng; Eberl, Stefan; Somerville, Ernest; Fulham, Michael; Bleasel, Andrew F
2014-01-01
Some studies suggest that the pattern of glucose hypometabolism relates not only to the ictal-onset zone but also reflects seizure propagation. We investigated metabolic changes in patients with occipital lobe epilepsy (OLE) that may reflect propagation of ictal discharge during seizures with automatisms. Fifteen patients who had undergone epilepsy surgery for intractable OLE and had undergone interictal Fluorine-18-fluorodeoxyglucose positron-emission tomography ((18)F-FDG-PET) between 1994 and 2004 were divided into two groups (with and without automatisms during seizure). Significant regions of hypometabolism were identified by comparing (18)F-FDG-PET results from each group with 16 healthy controls by using statistical parametric mapping. Significant hypometabolism was confined largely to the epileptogenic occipital lobe in the patient group without automatisms. In patients with automatisms, glucose hypometabolism extended from the epileptogenic occipital lobe into the ipsilateral temporal lobe. We identified a distinctive hypometabolic pattern that was specific for OLE patients with automatisms during a seizure. This finding supports the postulate that seizure propagation is a cause of glucose hypometabolism beyond the region of seizure onset.
30 CFR 75.1403-4 - Criteria-Automatic elevators.
2010-07-01
... appropriate on automatic elevators which will automatically shut-off the power and apply the brakes in the... telephone or other effective communication system by which aid or assistance can be obtained promptly. ...
Automatic positioning control device for automatic control rod exchanger
International Nuclear Information System (INIS)
Nasu, Seiji; Sasaki, Masayoshi.
1982-01-01
Purpose: To attain accurate positioning for a control rod exchanger. Constitution: The present position for an automatic control rod exchanger is detected by a synchro generator. An aimed stopping position for the exchanger, a stop instruction range depending on the distantial operation delay in the control system and the inertia-running distance of the mechanical system, and a coincidence confirmation range depending on the required positioning accuracy are previously set. If there is a difference between the present position and the aimed stopping position, the automatic exchanger is caused to run toward the aimed stopping position. A stop instruction is generated upon arrival at the position within said stop instruction range, and a coincidence confirmation signal is generated upon arrival at the position within the coincidence confirmation range. Since uncertain factors such as operation delay in the control system and the inertia-running distance of the mechanical system that influence the positioning accuracy are made definite by the method of actual measurement or the like and the stop instruction range and the coincidence confirmation range are set based on the measured data, the accuracy for the positioning can be improved. (Ikeda, J.)
International Nuclear Information System (INIS)
Dinu, Camelia; Talpalariu, A.; Constantinescu, G.
2007-01-01
The Prioritization of Generic Safety Issues (NUREG-0933 of October 2006), section 1 task II.E.4 item II.E.4.3 recommends that a method of periodic or continuous testing has to be available, in order to detect unknown gross openings in the nuclear power plants containment structure. The Palisades incident and three other incidents are exemplified, when the reactor was operated for about 1.5 years, while the containment isolation valves in a purge system bypass line were unknowingly locked in the open position. It was estimated that the presence of a GCLM system could identify an unknown breach and reduce the expected unavailability of containment due to containment integrity breach events, to a 1.6x10 -3 /year demand. (authors)
Analysing and evaluating the task of automatic tweet generation: Knowledge to business
Lloret, Elena; Palomar, Manuel
2016-01-01
In this paper a study concerning the evaluation and analysis of natural language tweets is presented. Based on our experience in text summarisation, we carry out a deep analysis on user's perception through the evaluation of tweets manual and automatically generated from news. Specifically, we consider two key issues of a tweet: its informativeness and its interestingness. Therefore, we analyse: (1) do users equally perceive manual and automatic tweets?; (2) what linguistic features a good tw...
Automatic Operation For A Robot Lawn Mower
Huang, Y. Y.; Cao, Z. L.; Oh, S. J.; Kattan, E. U.; Hall, E. L.
1987-02-01
A domestic mobile robot, lawn mower, which performs the automatic operation mode, has been built up in the Center of Robotics Research, University of Cincinnati. The robot lawn mower automatically completes its work with the region filling operation, a new kind of path planning for mobile robots. Some strategies for region filling of path planning have been developed for a partly-known or a unknown environment. Also, an advanced omnidirectional navigation system and a multisensor-based control system are used in the automatic operation. Research on the robot lawn mower, especially on the region filling of path planning, is significant in industrial and agricultural applications.
Automatic face morphing for transferring facial animation
Bui Huu Trung, B.H.T.; Bui, T.D.; Poel, Mannes; Heylen, Dirk K.J.; Nijholt, Antinus; Hamza, H.M.
2003-01-01
In this paper, we introduce a novel method of automatically finding the training set of RBF networks for morphing a prototype face to represent a new face. This is done by automatically specifying and adjusting corresponding feature points on a target face. The RBF networks are then used to transfer
Automatic needle insertion diminishes pain during growth hormone injection
DEFF Research Database (Denmark)
Main, K M; Jørgensen, J T; Hertel, N T
1995-01-01
prototype pens for GH administration, providing either manual or automatic sc needle insertion, using a combined visual analogue/facial scale and a five-item scale in 18 children. With the automatic pen there was a significantly lower maximum pain score compared with the manual pen (median 28.5 versus 52.......0 mm) as well as a lower mean pain score (mean 13.7 versus 23.5 mm). The five-item scale revealed that automatic needle insertion was significantly less painful than manual insertion and 13 patients chose to continue treatment with the automatic pen. In conclusion, pain during GH injection can...
Wallac automatic alarm dosimeter type RAD21
International Nuclear Information System (INIS)
Burgess, P. H.; Iles, W.J.
1980-02-01
The Automatic Alarm Dosimeter type RAD 21 is a batterypowered personal dosemeter and exposure rate alarm monitor, designed to be worn on the body, covering an exposure range from 0.1 to 999.9 mR and has an audible alarm which can be pre-set over the range 1 mR h -1 to 250 mR h -1 . The instrument is designed to measure x- and γ radiation over the energy range 50 keV to 3 MeV. The facilities and controls, the radiation, electrical, environmental and mechanical characteristics, and the manual, have been evaluated. (U.K.)
Exposure to violent video games increases automatic aggressiveness.
Uhlmann, Eric; Swanson, Jane
2004-02-01
The effects of exposure to violent video games on automatic associations with the self were investigated in a sample of 121 students. Playing the violent video game Doom led participants to associate themselves with aggressive traits and actions on the Implicit Association Test. In addition, self-reported prior exposure to violent video games predicted automatic aggressive self-concept, above and beyond self-reported aggression. Results suggest that playing violent video games can lead to the automatic learning of aggressive self-views.
Automatic Knowledge Extraction and Knowledge Structuring for a National Term Bank
DEFF Research Database (Denmark)
Lassen, Tine; Madsen, Bodil Nistrup; Erdman Thomsen, Hanne
2011-01-01
This paper gives an introduction to the plans and ongoing work in a project, the aim of which is to develop methods for automatic knowledge extraction and automatic construction and updating of ontologies. The project also aims at developing methods for automatic merging of terminological data fr...... various existing sources, as well as methods for target group oriented knowledge dissemination. In this paper, we mainly focus on the plans for automatic knowledge extraction and knowledge structuring that will result in ontologies for a national term bank.......This paper gives an introduction to the plans and ongoing work in a project, the aim of which is to develop methods for automatic knowledge extraction and automatic construction and updating of ontologies. The project also aims at developing methods for automatic merging of terminological data from...
Development of automatic ultrasonic testing system and its application
International Nuclear Information System (INIS)
Oh, Sang Hong; Matsuura, Toshihiko; Iwata, Ryusuke; Nakagawa, Michio; Horikawa, Kohsuke; Kim, You Chul
1997-01-01
The radiographic testing (RT) has been usually applied to a nondestructive testing, which is carried out on purpose to detect internal defects at welded joints of a penstock. In the case that RT could not be applied to, the ultrasonic testing (UT) was performed. UT was generally carried out by manual scanning and the inspections data were recorded by the inspector in a site. So, as a weak point, there was no objective inspection records correspond to films of RT. It was expected that the automatic ultrasonic testing system by which automatic scanning and automatic recording are possible was developed. In this respect, the automatic ultrasonic testing system was developed. Using newly developed the automatic ultrasonic testing system, test results to the circumferential welded joints of the penstock at a site were shown in this paper.
Automatic welding of stainless steel tubing
Clautice, W. E.
1978-01-01
The use of automatic welding for making girth welds in stainless steel tubing was investigated as well as the reduction in fabrication costs resulting from the elimination of radiographic inspection. Test methodology, materials, and techniques are discussed, and data sheets for individual tests are included. Process variables studied include welding amperes, revolutions per minute, and shielding gas flow. Strip chart recordings, as a definitive method of insuring weld quality, are studied. Test results, determined by both radiographic and visual inspection, are presented and indicate that once optimum welding procedures for specific sizes of tubing are established, and the welding machine operations are certified, then the automatic tube welding process produces good quality welds repeatedly, with a high degree of reliability. Revised specifications for welding tubing using the automatic process and weld visual inspection requirements at the Kennedy Space Center are enumerated.
Automatic change detection to facial expressions in adolescents
DEFF Research Database (Denmark)
Liu, Tongran; Xiao, Tong; Jiannong, Shi
2016-01-01
Adolescence is a critical period for the neurodevelopment of social-emotional processing, wherein the automatic detection of changes in facial expressions is crucial for the development of interpersonal communication. Two groups of participants (an adolescent group and an adult group) were...... in facial expressions between the two age groups. The current findings demonstrated that the adolescent group featured more negative vMMN amplitudes than the adult group in the fronto-central region during the 120–200 ms interval. During the time window of 370–450 ms, only the adult group showed better...... automatic processing on fearful faces than happy faces. The present study indicated that adolescent’s posses stronger automatic detection of changes in emotional expression relative to adults, and sheds light on the neurodevelopment of automatic processes concerning social-emotional information....
Behnisch, Peter A; Hosoe, Kazunori; Shiozaki, Ken; Ozaki, Hironori; Nakamura, Kazuo; Sakai, Shin-Ichi
2002-12-01
To investigate the dechlorination of fly ash during low-temperature treatment under oxygen-deficient conditions (thermocatalyic treatment or Hagenmaier process), six fly ash samples from six different incineration plants were treated in a laboratory experiment or in the actual plant, either under ideal (400 degrees C, 120 min) or intermediate (300 degrees C, 30 min) conditions. The aim of the present study was to confirm the decrease in the I-TEQ (international toxicity equivalency) of polychlorinated dibenzo-p-dioxins/-furans (PCDD/Fs) and coplanar polychlorinated biphenyls (co-PXBs) and, also for the first time, the decrease in the sum of dioxin-like toxicity (bioassay- or bio-TEQ) of all kinds of other dioxin-like Ah receptor agonists (such as PXDD/Fs, PXBs, PXN, X = Br, F) measured by two state-of-the-art cell-based Ah receptor-dependent bioassays: H4IIE-Ethoxy-Resorufin-o-Deethylase (EROD) and H4IIE-luc/DR-Chemical Activated Luciferase expression (DR-CALUX). The treatment efficiency was calculated on the basis of the reduction in the I-TEQ and bio-TED values. For these fly ash samples, the treatment efficiency, as measured by chemical analysis, was higher than 99%, and 85%-99%, in the case of the bio-TED values, indicating that these Ah receptor binding toxic compounds were sufficiently decomposed. Bio-TEQ values for untreated fly ash samples (n = 6) were on average 1.2 times (range 0.7-1.9), for the H4IIE-EROD assay, and 2.8 times (1.1-4.9), for the DR-CALUX assay, higher than I-TEQ values measured by chemical analyses (sum of PCDD/Fs and co-PCBs). In the case of these fly ash samples treated under ideal conditions and therefore low in contaminants, the bio-TEQ values were on average 1.4 times (range 0.9-1.8), for the H4IIE-EROD assay, and 5.1 times (range 1.2-12), for the DR-CALUX assay, higher than the I-TEQ values.
International Nuclear Information System (INIS)
Tufvesson, Jane; Carlsson, Marcus; Aletras, Anthony H.; Engblom, Henrik; Deux, Jean-François; Koul, Sasha; Sörensson, Peder; Pernow, John; Atar, Dan; Erlinge, David; Arheden, Håkan; Heiberg, Einar
2016-01-01
Efficacy of reperfusion therapy can be assessed as myocardial salvage index (MSI) by determining the size of myocardium at risk (MaR) and myocardial infarction (MI), (MSI = 1-MI/MaR). Cardiovascular magnetic resonance (CMR) can be used to assess MI by late gadolinium enhancement (LGE) and MaR by either T2-weighted imaging or contrast enhanced SSFP (CE-SSFP). Automatic segmentation algorithms have been developed and validated for MI by LGE as well as for MaR by T2-weighted imaging. There are, however, no algorithms available for CE-SSFP. Therefore, the aim of this study was to develop and validate automatic segmentation of MaR in CE-SSFP. The automatic algorithm applies surface coil intensity correction and classifies myocardial intensities by Expectation Maximization to define a MaR region based on a priori regional criteria, and infarct region from LGE. Automatic segmentation was validated against manual delineation by expert readers in 183 patients with reperfused acute MI from two multi-center randomized clinical trials (RCT) (CHILL-MI and MITOCARE) and against myocardial perfusion SPECT in an additional set (n = 16). Endocardial and epicardial borders were manually delineated at end-diastole and end-systole. Manual delineation of MaR was used as reference and inter-observer variability was assessed for both manual delineation and automatic segmentation of MaR in a subset of patients (n = 15). MaR was expressed as percent of left ventricular mass (%LVM) and analyzed by bias (mean ± standard deviation). Regional agreement was analyzed by Dice Similarity Coefficient (DSC) (mean ± standard deviation). MaR assessed by manual and automatic segmentation were 36 ± 10 % and 37 ± 11 %LVM respectively with bias 1 ± 6 %LVM and regional agreement DSC 0.85 ± 0.08 (n = 183). MaR assessed by SPECT and CE-SSFP automatic segmentation were 27 ± 10 %LVM and 29 ± 7 %LVM respectively with bias 2 ± 7 %LVM. Inter-observer variability was 0 ± 3 %LVM for manual delineation and
Implicit self-esteem compensation: automatic threat defense.
Rudman, Laurie A; Dohn, Matthew C; Fairchild, Kimberly
2007-11-01
Four experiments demonstrated implicit self-esteem compensation (ISEC) in response to threats involving gender identity (Experiment 1), implicit racism (Experiment 2), and social rejection (Experiments 3-4). Under conditions in which people might be expected to suffer a blow to self-worth, they instead showed high scores on 2 implicit self-esteem measures. There was no comparable effect on explicit self-esteem. However, ISEC was eliminated following self-affirmation (Experiment 3). Furthermore, threat manipulations increased automatic intergroup bias, but ISEC mediated these relationships (Experiments 2-3). Thus, a process that serves as damage control for the self may have negative social consequences. Finally, pretest anxiety mediated the relationship between threat and ISEC (Experiment 3), whereas ISEC negatively predicted anxiety among high-threat participants (Experiment 4), suggesting that ISEC may function to regulate anxiety. The implications of these findings for automatic emotion regulation, intergroup bias, and implicit self-esteem measures are discussed. (c) 2007 APA, all rights reserved.
Horton, Keith D; Wilson, Daryl E; Vonk, Jennifer; Kirby, Sarah L; Nielsen, Tina
2005-07-01
Using the stem completion task, we compared estimates of automatic retrieval from an implicit memory task, the process dissociation procedure, and the speeded response procedure. Two standard manipulations were employed. In Experiment 1, a depth of processing effect was found on automatic retrieval using the speeded response procedure although this effect was substantially reduced in Experiment 2 when lexical processing was required of all words. In Experiment 3, the speeded response procedure showed an advantage of full versus divided attention at study on automatic retrieval. An implicit condition showed parallel effects in each study, suggesting that implicit stem completion may normally provide a good estimate of automatic retrieval. Also, we replicated earlier findings from the process dissociation procedure, but estimates of automatic retrieval from this procedure were consistently lower than those from the speeded response procedure, except when conscious retrieval was relatively low. We discuss several factors that may contribute to the conflicting outcomes, including the evidence for theoretical assumptions and criterial task differences between implicit and explicit tests.
Automatic Compound Annotation from Mass Spectrometry Data Using MAGMa.
Ridder, L.O.; Hooft, van der J.J.J.; Verhoeven, S.
2014-01-01
The MAGMa software for automatic annotation of mass spectrometry based fragmentation data was applied to 16 MS/MS datasets of the CASMI 2013 contest. Eight solutions were submitted in category 1 (molecular formula assignments) and twelve in category 2 (molecular structure assignment). The MS/MS
Automatic Payroll Deposit System.
Davidson, D. B.
1979-01-01
The Automatic Payroll Deposit System in Yakima, Washington's Public School District No. 7, directly transmits each employee's salary amount for each pay period to a bank or other financial institution. (Author/MLF)
Thai Automatic Speech Recognition
National Research Council Canada - National Science Library
Suebvisai, Sinaporn; Charoenpornsawat, Paisarn; Black, Alan; Woszczyna, Monika; Schultz, Tanja
2005-01-01
.... We focus on the discussion of the rapid deployment of ASR for Thai under limited time and data resources, including rapid data collection issues, acoustic model bootstrap, and automatic generation of pronunciations...
National Research Council Canada - National Science Library
Fichtelberg, Neil D
1985-01-01
.... Significant improvements were made in bead shape and size, and in the automatic selection of the type of bead required and the parameters to use as a function of the prevailing groove geometry...
Culture, attribution and automaticity: a social cognitive neuroscience view.
Mason, Malia F; Morris, Michael W
2010-06-01
A fundamental challenge facing social perceivers is identifying the cause underlying other people's behavior. Evidence indicates that East Asian perceivers are more likely than Western perceivers to reference the social context when attributing a cause to a target person's actions. One outstanding question is whether this reflects a culture's influence on automatic or on controlled components of causal attribution. After reviewing behavioral evidence that culture can shape automatic mental processes as well as controlled reasoning, we discuss the evidence in favor of cultural differences in automatic and controlled components of causal attribution more specifically. We contend that insights emerging from social cognitive neuroscience research can inform this debate. After introducing an attribution framework popular among social neuroscientists, we consider findings relevant to the automaticity of attribution, before speculating how one could use a social neuroscience approach to clarify whether culture affects automatic, controlled or both types of attribution processes.
Directory of Open Access Journals (Sweden)
Piotr Ladyzynski
2018-04-01
Full Text Available The aim of this work was to assess the accuracy of automatic macronutrient and calorie counting based on voice descriptions of meals provided by people with unstable type 1 diabetes using the developed expert system (VoiceDiab in comparison with reference counting made by a dietitian, and to evaluate the impact of insulin doses recommended by a physician on glycemic control in the study’s participants. We also compared insulin doses calculated using the algorithm implemented in the VoiceDiab system. Meal descriptions were provided by 30 hospitalized patients (mean hemoglobin A1c of 8.4%, i.e., 68 mmol/mol. In 16 subjects, the physician determined insulin boluses based on the data provided by the system, and in 14 subjects, by data provided by the dietitian. On one hand, differences introduced by patients who subjectively described their meals compared to those introduced by the system that used the average characteristics of food products, although statistically significant, were low enough not to have a significant impact on insulin doses automatically calculated by the system. On the other hand, the glycemic control of patients was comparable regardless of whether the physician was using the system-estimated or the reference content of meals to determine insulin doses.
Acquisition of automatic imitation is sensitive to sensorimotor contingency.
Cook, Richard; Press, Clare; Dickinson, Anthony; Heyes, Cecilia
2010-08-01
The associative sequence learning model proposes that the development of the mirror system depends on the same mechanisms of associative learning that mediate Pavlovian and instrumental conditioning. To test this model, two experiments used the reduction of automatic imitation through incompatible sensorimotor training to assess whether mirror system plasticity is sensitive to contingency (i.e., the extent to which activation of one representation predicts activation of another). In Experiment 1, residual automatic imitation was measured following incompatible training in which the action stimulus was a perfect predictor of the response (contingent) or not at all predictive of the response (noncontingent). A contingency effect was observed: There was less automatic imitation indicative of more learning in the contingent group. Experiment 2 replicated this contingency effect and showed that, as predicted by associative learning theory, it can be abolished by signaling trials in which the response occurs in the absence of an action stimulus. These findings support the view that mirror system development depends on associative learning and indicate that this learning is not purely Hebbian. If this is correct, associative learning theory could be used to explain, predict, and intervene in mirror system development.
Adaptive pseudolinear compensators of dynamic characteristics of automatic control systems
Skorospeshkin, M. V.; Sukhodoev, M. S.; Timoshenko, E. A.; Lenskiy, F. V.
2016-04-01
Adaptive pseudolinear gain and phase compensators of dynamic characteristics of automatic control systems are suggested. The automatic control system performance with adaptive compensators has been explored. The efficiency of pseudolinear adaptive compensators in the automatic control systems with time-varying parameters has been demonstrated.
DEFF Research Database (Denmark)
Rosendahl, Mads
1989-01-01
One way to analyse programs is to to derive expressions for their computational behaviour. A time bound function (or worst-case complexity) gives an upper bound for the computation time as a function of the size of input. We describe a system to derive such time bounds automatically using abstract...
Process and device for automatically surveying complex installations
International Nuclear Information System (INIS)
Pekrul, P.J.; Thiele, A.W.
1976-01-01
A description is given of a process for automatically analysing separate signal processing channels in real time, one channel per signal, in a facility with significant background noise in signals varying in time and coming from transducers at selected points for the continuous monitoring of the operating conditions of the various components of the installation. The signals are intended to determine potential breakdowns, determine conclusions as to the severity of these potential breakdowns and indicate to an operator the measures to be taken in consequence. The feature of this process is that it comprises the automatic and successive selection of each channel for the purpose of spectral analysis, the automatic processing of the signal of each selected channel to show energy spectrum density data at pre-determined frequencies, the automatic comparison of the energy spectrum density data of each channel with pre-determined sets of limits varying with the frequency, and the automatic indication to the operator of the condition of the various components of the installation associated to each channel and the measures to be taken depending on the set of limits [fr
Metabolic changes in occipital lobe epilepsy with automatisms
Directory of Open Access Journals (Sweden)
Chong H Wong
2014-07-01
Full Text Available Purpose: Some studies suggest that the pattern of glucose hypometabolism relates not only to the ictal-onset zone, but also reflects seizure propagation. We investigated metabolic changes in patients with occipital lobe epilepsy (OLE that may reflect propagation of ictal discharge during seizures with automatisms.Methods: Fifteen patients who had undergone epilepsy surgery for intractable OLE and had undergone interictal Fluorine-18-fluorodeoxyglucose positron emission tomography (18F-FDG-PET between 1994 and 2004 were divided into two groups (with and without automatisms during seizure. Significant regions of hypometabolism were identified by comparing 18F-FDG-PET results from each group with 16 healthy controls by using Statistical Parametric Mapping (SPM 2.Key Findings: Significant hypometabolism was confined largely to the epileptogenic occipital lobe in the patient group without automatisms. In patients with automatisms, glucose hypometabolism extended from the epileptogenic occipital lobe into the ipsilateral temporal lobe.Significance: We identified a distinctive hypometabolic pattern that was specific for OLE patients with automatisms during a seizure. This finding supports the postulate that seizure propagation is a cause of glucose hypometabolism beyond the region of seizure onset.
Automatic Type Recognition and Mapping of Global Tropical Cyclone Disaster Chains (TDC
Directory of Open Access Journals (Sweden)
Ran Wang
2016-10-01
Full Text Available The catastrophic events caused by meteorological disasters are becoming more severe in the context of global warming. The disaster chains triggered by Tropical Cyclones induce the serious losses of population and economy. It is necessary to make the regional type recognition of Tropical Cyclone Disaster Chain (TDC effective in order to make targeted preventions. This study mainly explores the method of automatic recognition and the mapping of TDC and designs a software system. We constructed an automatic recognition system in terms of the characteristics of a hazard-formative environment based on the theory of a natural disaster system. The ArcEngine components enable an intelligent software system to present results by the automatic mapping approach. The study data comes from global metadata such as Digital Elevation Model (DEM, terrain slope, population density and Gross Domestic Product (GDP. The result shows that: (1 according to the characteristic of geomorphology type, we establish a type of recognition system for global TDC; (2 based on the recognition principle, we design a software system with the functions of automatic recognition and mapping; and (3 we validate the type of distribution in terms of real cases of TDC. The result shows that the automatic recognition function has good reliability. The study can provide the basis for targeted regional disaster prevention strategy, as well as regional sustainable development.
Knowledge-based full-automatic control system for a nuclear ship reactor
International Nuclear Information System (INIS)
Shimazaki, J.; Nakazawa, T.; Yabuuchi, N.
2000-01-01
Plant operations aboard nuclear ships require quick judgements and actions due to changing marine conditions such as wind, waves and currents. Furthermore, additional human support is not available for nuclear ship operation at sea, so advanced automatic operations are necessary to reduce the number of operators required finally. Therefore, an advanced automatic operating system has been developed based on operational knowledge of nuclear ship 'Mutsu' plant. The advanced automatic operating system includes both the automatic operation system and the operator-support system which assists operators in completing actions during plant accidents, anomaly diagnosis and plant supervision. These system are largely being developed using artificial intelligent techniques such as neural network, fuzzy logic and knowledge-based expert. The automatic operation system is fundamentally based upon application of an operator's knowledge of both normal (start-up to rated power level) and abnormal (after scram) operations. Comparing plant behaviors from start-up to power level by the automatic operation with by 'Mutsu' manual operation, stable automatic operation was obtained almost same as manual operation within all operating limits. The abnormal automatic system was for hard work of manual operations after scram or LOCA accidents. An integrating system with the normal and the abnormal automatic systems are being developed for interacting smoothly both systems. (author)
AUTOMATIC AND GENERIC MOSAICING OF MULTISENSOR IMAGES: AN APPLICATION TO PLEIADES HR
Directory of Open Access Journals (Sweden)
F. Bignalet-Cazalet
2012-07-01
Full Text Available In the early phase of the Pleiades program, the CNES (the French Space Agency specified and developed a fully automatic mosaicing processing unit, in order to generate satellite image mosaics under operational conditions. This tool can automatically put each input image in a common geometry, homogenize the radiometry, and generate orthomosaics using stitching lines. As the image quality commissioning phase of Pleiades1A is on-going, this mosaicing process is being tested for the first time under operational conditions. The French newly launched high resolution satellite can acquire adjacent images for French Civil and Defense User Ground Segments. This paper presents the very firsts results of mosaicing Pleiades1A images. Beyond Pleiades’ use, our mosaicing tool can process a significant variety of images, including other satellites and airborne acquisitions, using automatically-taken or external ground control points, offering time-based image superposition, and more. This paper also presents the design of the mosaicing tool and describes the processing workflow and the additional capabilities and applications.
Automatic structural scene digitalization.
Tang, Rui; Wang, Yuhan; Cosker, Darren; Li, Wenbin
2017-01-01
In this paper, we present an automatic system for the analysis and labeling of structural scenes, floor plan drawings in Computer-aided Design (CAD) format. The proposed system applies a fusion strategy to detect and recognize various components of CAD floor plans, such as walls, doors, windows and other ambiguous assets. Technically, a general rule-based filter parsing method is fist adopted to extract effective information from the original floor plan. Then, an image-processing based recovery method is employed to correct information extracted in the first step. Our proposed method is fully automatic and real-time. Such analysis system provides high accuracy and is also evaluated on a public website that, on average, archives more than ten thousands effective uses per day and reaches a relatively high satisfaction rate.
Automatic section cutting and forming control of longitudinal-axial-roadheaders
Energy Technology Data Exchange (ETDEWEB)
Jie Tian; Yang Yang; Guo-Qiang Chen; Hong-Yao Wang; Jian-Gong Liu; Miao Wu [China University of Mining and Technology (Beijing), Beijing (China). School of Mechanical, Electronic and Information Engineering
2009-01-15
To reduce the useless driving workload and volume of filling and improve excavating efficiency, a method of laneway section automatic forming control of longitudinal-axial-roadheaders was presented. Firstly, a mine laneway section automatic cutting process was developed according to actual conditions of a coal mine. Then, a kinematic analysis was carried out of the automatic section forming control, including analysis of the swing mechanism, the spatial position of the cutting head and a geometric analysis of its mechanical structure. The geometrical relationship formulas were worked out between the cutter head spatial position coordinate, expansion increment of the hydraulic cylinders and swinging angles of the cantilever. The results show that the control mode of directly measuring swing angles of the cutting head is more simple and effective. The method proposed was put in practice in EBZ160 and EBZ200 boom-type roadheaders and the effect of experiment is very good, laying a foundation for further study on position detection and direction correction of roadheader. 11 refs., 5 figs., 1 tab.
Automatic Keyframe Summarization of User-Generated Video
2014-06-01
over longer periods of space and time. Additionally, the storyline may be less crafted or coherent when compared to professional cinema . As such, shot...attention in videos, whether it be their presence, location, identity , actions, or relationships to other humans. In this regard, automatic human capture...among other things. A person AOC has an identity property. Properties of an AOC that a stakeholder considers important are called POCs. 3.1.3
Development of an automatic prompt gamma-ray activation analysis system
International Nuclear Information System (INIS)
Osawa, Takahito
2013-01-01
An automatic prompt gamma-ray activation analysis system was developed and installed at the Japan Research Reactor No. 3 Modified (JRR-3M). The main control software, referred to as AutoPGA, was developed using LabVIEW 2011 and the hand-made program can control all functions of the analytical system. The core of the new system is an automatic sample exchanger and measurement system with several additional automatic control functions integrated into the system. Up to fourteen samples can be automatically measured by the system. (author)
Automatic segmentation of the heart in radiotherapy for breast cancer
DEFF Research Database (Denmark)
Laugaard Lorenzen, Ebbe; Ewertz, Marianne; Brink, Carsten
2014-01-01
Background. The aim of this study was to evaluate two fully automatic segmentation methods in comparison with manual delineations for their use in delineating the heart on planning computed tomography (CT) used in radiotherapy for breast cancer. Material and methods. Automatic delineation of heart...... in 15 breast cancer patients was performed by two different automatic delineation systems. Analysis of accuracy and precision of the differences between manual and automatic delineations were evaluated on volume, mean dose, maximum dose and spatial distance differences. Two sets of manual delineations...
Multislice CT coronary angiography: evaluation of an automatic vessel detection tool
International Nuclear Information System (INIS)
Dewey, M.; Schnapauff, D.; Lembcke, A.; Hamm, B.; Rogalla, P.; Laule, M.; Borges, A.C.; Rutsch, W.
2004-01-01
Purpose: To investigate the potential of a new detection tool for multisliceCT (MSCT) coronary angiography with automatic display of curved multiplanar reformations and orthogonal cross-sections. Materials and Methods: Thirty-five patients were consecutively enrolled in a prospective intention-to-diagnose study and examined using a MSCT scanner with 16 x 0.5 mm detector collimation and 400 ms gantry rotation time (Aquilion, Toshiba). A multisegment algorithm using up to four segments was applied for ECG-gated reconstruction. Automatic and manual detection of coronary arteries was conducted using the coronary artery CT protocol of a workstation (Vitrea 2, Version 3.3, Vital Images) to detect significant stenoses (≥50%) in all segments of ≥1.5 mm in diameter. Each detection tool was used by one reader who was blinded to the results of the other detection method and the results of conventional coronary angiography. Results: The overall sensitivity, specificity, nondiagnostic rate, and accuracy of the automatic and manual approach were 90 vs. 94%, 89 vs. 84%, 6 vs. 6%, and 89 vs. 88%, respectively (p=n.s.). The vessel length detected with the automatic and manual approach were highly correlated for the left main/left anterior descending (143±30 vs. 146±24 mm, r=0.923, p [de
Group Dynamics in Automatic Imitation.
Gleibs, Ilka H; Wilson, Neil; Reddy, Geetha; Catmur, Caroline
Imitation-matching the configural body movements of another individual-plays a crucial part in social interaction. We investigated whether automatic imitation is not only influenced by who we imitate (ingroup vs. outgroup member) but also by the nature of an expected interaction situation (competitive vs. cooperative). In line with assumptions from Social Identity Theory), we predicted that both social group membership and the expected situation impact on the level of automatic imitation. We adopted a 2 (group membership target: ingroup, outgroup) x 2 (situation: cooperative, competitive) design. The dependent variable was the degree to which participants imitated the target in a reaction time automatic imitation task. 99 female students from two British Universities participated. We found a significant two-way interaction on the imitation effect. When interacting in expectation of cooperation, imitation was stronger for an ingroup target compared to an outgroup target. However, this was not the case in the competitive condition where imitation did not differ between ingroup and outgroup target. This demonstrates that the goal structure of an expected interaction will determine the extent to which intergroup relations influence imitation, supporting a social identity approach.
Automatic programming for critical applications
Loganantharaj, Raj L.
1988-01-01
The important phases of a software life cycle include verification and maintenance. Usually, the execution performance is an expected requirement in a software development process. Unfortunately, the verification and the maintenance of programs are the time consuming and the frustrating aspects of software engineering. The verification cannot be waived for the programs used for critical applications such as, military, space, and nuclear plants. As a consequence, synthesis of programs from specifications, an alternative way of developing correct programs, is becoming popular. The definition, or what is understood by automatic programming, has been changed with our expectations. At present, the goal of automatic programming is the automation of programming process. Specifically, it means the application of artificial intelligence to software engineering in order to define techniques and create environments that help in the creation of high level programs. The automatic programming process may be divided into two phases: the problem acquisition phase and the program synthesis phase. In the problem acquisition phase, an informal specification of the problem is transformed into an unambiguous specification while in the program synthesis phase such a specification is further transformed into a concrete, executable program.
Automatic fault extraction using a modified ant-colony algorithm
International Nuclear Information System (INIS)
Zhao, Junsheng; Sun, Sam Zandong
2013-01-01
The basis of automatic fault extraction is seismic attributes, such as the coherence cube which is always used to identify a fault by the minimum value. The biggest challenge in automatic fault extraction is noise, including that of seismic data. However, a fault has a better spatial continuity in certain direction, which makes it quite different from noise. Considering this characteristic, a modified ant-colony algorithm is introduced into automatic fault identification and tracking, where the gradient direction and direction consistency are used as constraints. Numerical model test results show that this method is feasible and effective in automatic fault extraction and noise suppression. The application of field data further illustrates its validity and superiority. (paper)
Automatically repairing invalid polygons with a constrained triangulation
Ledoux, H.; Arroyo Ohori, K.; Meijers, M.
2012-01-01
Although the validation of single polygons has received considerable attention, the automatic repair of invalid polygons has not. Automated repair methods can be considered as interpreting ambiguous or ill-defined polygons and giving a coherent and clearly defined output. At this moment, automatic
Automatic creation of simulation configuration
International Nuclear Information System (INIS)
Oudot, G.; Poizat, F.
1993-01-01
SIPA, which stands for 'Simulator for Post Accident', includes: 1) a sophisticated software oriented workshop SWORD (which stands for 'Software Workshop Oriented towards Research and Development') designed in the ADA language including integrated CAD system and software tools for automatic generation of simulation software and man-machine interface in order to operate run-time simulation; 2) a 'simulator structure' based on hardware equipment and software for supervision and communications; 3) simulation configuration generated by SWORD, operated under the control of the 'simulator structure' and run on a target computer. SWORD has already been used to generate two simulation configurations (French 900 MW and 1300 MW nuclear power plants), which are now fully operational on the SIPA training simulator. (Z.S.) 1 ref
The irace package: Iterated racing for automatic algorithm configuration
Directory of Open Access Journals (Sweden)
Manuel López-Ibáñez
2016-01-01
Full Text Available Modern optimization algorithms typically require the setting of a large number of parameters to optimize their performance. The immediate goal of automatic algorithm configuration is to find, automatically, the best parameter settings of an optimizer. Ultimately, automatic algorithm configuration has the potential to lead to new design paradigms for optimization software. The irace package is a software package that implements a number of automatic configuration procedures. In particular, it offers iterated racing procedures, which have been used successfully to automatically configure various state-of-the-art algorithms. The iterated racing procedures implemented in irace include the iterated F-race algorithm and several extensions and improvements over it. In this paper, we describe the rationale underlying the iterated racing procedures and introduce a number of recent extensions. Among these, we introduce a restart mechanism to avoid premature convergence, the use of truncated sampling distributions to handle correctly parameter bounds, and an elitist racing procedure for ensuring that the best configurations returned are also those evaluated in the highest number of training instances. We experimentally evaluate the most recent version of irace and demonstrate with a number of example applications the use and potential of irace, in particular, and automatic algorithm configuration, in general.
Mimicry and automatic imitation are not correlated
van Den Bossche, Sofie; Cracco, Emiel; Bardi, Lara; Rigoni, Davide; Brass, Marcel
2017-01-01
It is widely known that individuals have a tendency to imitate each other. However, different psychological disciplines assess imitation in different manners. While social psychologists assess mimicry by means of action observation, cognitive psychologists assess automatic imitation with reaction time based measures on a trial-by-trial basis. Although these methods differ in crucial methodological aspects, both phenomena are assumed to rely on similar underlying mechanisms. This raises the fundamental question whether mimicry and automatic imitation are actually correlated. In the present research we assessed both phenomena and did not find a meaningful correlation. Moreover, personality traits such as empathy, autism traits, and traits related to self- versus other-focus did not correlate with mimicry or automatic imitation either. Theoretical implications are discussed. PMID:28877197
Support vector machine for automatic pain recognition
Monwar, Md Maruf; Rezaei, Siamak
2009-02-01
Facial expressions are a key index of emotion and the interpretation of such expressions of emotion is critical to everyday social functioning. In this paper, we present an efficient video analysis technique for recognition of a specific expression, pain, from human faces. We employ an automatic face detector which detects face from the stored video frame using skin color modeling technique. For pain recognition, location and shape features of the detected faces are computed. These features are then used as inputs to a support vector machine (SVM) for classification. We compare the results with neural network based and eigenimage based automatic pain recognition systems. The experiment results indicate that using support vector machine as classifier can certainly improve the performance of automatic pain recognition system.
Automatic color preference correction for color reproduction
Tsukada, Masato; Funayama, Chisato; Tajima, Johji
2000-12-01
The reproduction of natural objects in color images has attracted a great deal of attention. Reproduction more pleasing colors of natural objects is one of the methods available to improve image quality. We developed an automatic color correction method to maintain preferred color reproduction for three significant categories: facial skin color, green grass and blue sky. In this method, a representative color in an object area to be corrected is automatically extracted from an input image, and a set of color correction parameters is selected depending on the representative color. The improvement in image quality for reproductions of natural image was more than 93 percent in subjective experiments. These results show the usefulness of our automatic color correction method for the reproduction of preferred colors.
TMB: Automatic Differentiation and Laplace Approximation
Directory of Open Access Journals (Sweden)
Kasper Kristensen
2016-04-01
Full Text Available TMB is an open source R package that enables quick implementation of complex nonlinear random effects (latent variable models in a manner similar to the established AD Model Builder package (ADMB, http://admb-project.org/; Fournier et al. 2011. In addition, it offers easy access to parallel computations. The user defines the joint likelihood for the data and the random effects as a C++ template function, while all the other operations are done in R; e.g., reading in the data. The package evaluates and maximizes the Laplace approximation of the marginal likelihood where the random effects are automatically integrated out. This approximation, and its derivatives, are obtained using automatic differentiation (up to order three of the joint likelihood. The computations are designed to be fast for problems with many random effects (≈ 106 and parameters (≈ 103 . Computation times using ADMB and TMB are compared on a suite of examples ranging from simple models to large spatial models where the random effects are a Gaussian random field. Speedups ranging from 1.5 to about 100 are obtained with increasing gains for large problems. The package and examples are available at http://tmb-project.org/.
Automatic emissive probe apparatus for accurate plasma and vacuum space potential measurements
Jianquan, LI; Wenqi, LU; Jun, XU; Fei, GAO; Younian, WANG
2018-02-01
We have developed an automatic emissive probe apparatus based on the improved inflection point method of the emissive probe for accurate measurements of both plasma potential and vacuum space potential. The apparatus consists of a computer controlled data acquisition card, a working circuit composed by a biasing unit and a heating unit, as well as an emissive probe. With the set parameters of the probe scanning bias, the probe heating current and the fitting range, the apparatus can automatically execute the improved inflection point method and give the measured result. The validity of the automatic emissive probe apparatus is demonstrated in a test measurement of vacuum potential distribution between two parallel plates, showing an excellent accuracy of 0.1 V. Plasma potential was also measured, exhibiting high efficiency and convenient use of the apparatus for space potential measurements.
Automatic feature-based grouping during multiple object tracking.
Erlikhman, Gennady; Keane, Brian P; Mettler, Everett; Horowitz, Todd S; Kellman, Philip J
2013-12-01
Contour interpolation automatically binds targets with distractors to impair multiple object tracking (Keane, Mettler, Tsoi, & Kellman, 2011). Is interpolation special in this regard or can other features produce the same effect? To address this question, we examined the influence of eight features on tracking: color, contrast polarity, orientation, size, shape, depth, interpolation, and a combination (shape, color, size). In each case, subjects tracked 4 of 8 objects that began as undifferentiated shapes, changed features as motion began (to enable grouping), and returned to their undifferentiated states before halting. We found that intertarget grouping improved performance for all feature types except orientation and interpolation (Experiment 1 and Experiment 2). Most importantly, target-distractor grouping impaired performance for color, size, shape, combination, and interpolation. The impairments were, at times, large (>15% decrement in accuracy) and occurred relative to a homogeneous condition in which all objects had the same features at each moment of a trial (Experiment 2), and relative to a "diversity" condition in which targets and distractors had different features at each moment (Experiment 3). We conclude that feature-based grouping occurs for a variety of features besides interpolation, even when irrelevant to task instructions and contrary to the task demands, suggesting that interpolation is not unique in promoting automatic grouping in tracking tasks. Our results also imply that various kinds of features are encoded automatically and in parallel during tracking.
Automatic weld torch guidance control system
Smaith, H. E.; Wall, W. A.; Burns, M. R., Jr.
1982-01-01
A highly reliable, fully digital, closed circuit television optical, type automatic weld seam tracking control system was developed. This automatic tracking equipment is used to reduce weld tooling costs and increase overall automatic welding reliability. The system utilizes a charge injection device digital camera which as 60,512 inidividual pixels as the light sensing elements. Through conventional scanning means, each pixel in the focal plane is sequentially scanned, the light level signal digitized, and an 8-bit word transmitted to scratch pad memory. From memory, the microprocessor performs an analysis of the digital signal and computes the tracking error. Lastly, the corrective signal is transmitted to a cross seam actuator digital drive motor controller to complete the closed loop, feedback, tracking system. This weld seam tracking control system is capable of a tracking accuracy of + or - 0.2 mm, or better. As configured, the system is applicable to square butt, V-groove, and lap joint weldments.
2nd International Conference on Mechatronics and Automatic Control
2015-01-01
This book examines mechatronics and automatic control systems. The book covers important emerging topics in signal processing, control theory, sensors, mechanic manufacturing systems and automation. The book presents papers from the second International Conference on Mechatronics and Automatic Control Systems held in Beijing, China on September 20-21, 2014. Examines how to improve productivity through the latest advanced technologies Covering new systems and techniques in the broad field of mechatronics and automatic control systems.
FRICTION - WELDING MACHINE AUTOMATIC CONTROL CIRCUIT DESIGN AND APPLICATION
Hakan ATEŞ; Ramazan BAYINDIR
2003-01-01
In this work, automatic controllability of a laboratory-sized friction-welding machine has been investigated. The laboratory-sized friction-welding machine was composed of motor, brake, rotary and constant samples late pliers, and hydraulic unit. In automatic method, welding parameters such as friction time, friction pressure, forge time and forge pressure can be applied sensitively using time relays and contactors. At the end of the experimental study it's observed that automatic control sys...
Dynamic Analysis of a Pendulum Dynamic Automatic Balancer
Directory of Open Access Journals (Sweden)
Jin-Seung Sohn
2007-01-01
Full Text Available The automatic dynamic balancer is a device to reduce the vibration from unbalanced mass of rotors. Instead of considering prevailing ball automatic dynamic balancer, pendulum automatic dynamic balancer is analyzed. For the analysis of dynamic stability and behavior, the nonlinear equations of motion for a system are derived with respect to polar coordinates by the Lagrange's equations. The perturbation method is applied to investigate the dynamic behavior of the system around the equilibrium position. Based on the linearized equations, the dynamic stability of the system around the equilibrium positions is investigated by the eigenvalue analysis.
Automatic Test Systems Aquisition
National Research Council Canada - National Science Library
1994-01-01
We are providing this final memorandum report for your information and use. This report discusses the efforts to achieve commonality in standards among the Military Departments as part of the DoD policy for automatic test systems (ATS...
Maspero, Matteo; van den Berg, Cornelis A. T.; Zijlstra, Frank; Sikkes, Gonda G.; de Boer, Hans C. J.; Meijer, Gert J.; Kerkmeijer, Linda G. W.; Viergever, Max A.; Lagendijk, Jan J. W.; Seevinck, Peter R.
2017-10-01
An MR-only radiotherapy planning (RTP) workflow would reduce the cost, radiation exposure and uncertainties introduced by CT-MRI registrations. In the case of prostate treatment, one of the remaining challenges currently holding back the implementation of an RTP workflow is the MR-based localisation of intraprostatic gold fiducial markers (FMs), which is crucial for accurate patient positioning. Currently, MR-based FM localisation is clinically performed manually. This is sub-optimal, as manual interaction increases the workload. Attempts to perform automatic FM detection often rely on being able to detect signal voids induced by the FMs in magnitude images. However, signal voids may not always be sufficiently specific, hampering accurate and robust automatic FM localisation. Here, we present an approach that aims at automatic MR-based FM localisation. This method is based on template matching using a library of simulated complex-valued templates, and exploiting the behaviour of the complex MR signal in the vicinity of the FM. Clinical evaluation was performed on seventeen prostate cancer patients undergoing external beam radiotherapy treatment. Automatic MR-based FM localisation was compared to manual MR-based and semi-automatic CT-based localisation (the current gold standard) in terms of detection rate and the spatial accuracy and precision of localisation. The proposed method correctly detected all three FMs in 15/17 patients. The spatial accuracy (mean) and precision (STD) were 0.9 mm and 0.5 mm respectively, which is below the voxel size of 1.1 × 1.1 × 1.2 mm3 and comparable to MR-based manual localisation. FM localisation failed (3/51 FMs) in the presence of bleeding or calcifications in the direct vicinity of the FM. The method was found to be spatially accurate and precise, which is essential for clinical use. To overcome any missed detection, we envision the use of the proposed method along with verification by an observer. This will result in a
Clinical performance of a new hepatitis B surface antigen quantitative assay with automatic dilution
Directory of Open Access Journals (Sweden)
Ta-Wei Liu
2015-01-01
Full Text Available Hepatitis B virus surface antigen (HBsAg levels reflect disease status and can predict the clinical response to antiviral treatment; however, the emergence of HBsAg mutant strains has become a challenge. The Abbott HBsAg quantification assay provides enhanced detection of HBsAg and HBsAg mutants. We aimed to evaluate the performance of the Abbott HBsAg quantification assay with automatic sample dilutions (shortened as automatic Architect assay, compared with the Abbott HBsAg quantification assay with manual sample dilutions (shortened as manual Architect assay and the Roche HBsAg quantification assay with automatic sample dilutions (shortened as Elecsys. A total of 130 sera samples obtained from 87 hepatitis B virus (HBV-infected patients were collected to assess the correlation between the automatic and manual Architect assays. Among the 87 patients, 41 provided 42 sera samples to confirm the linearity and reproducibility of the automatic Architect assay, and find out the correlation among the Elecsys and two Architect assays. The coefficients of variation (0.44–9.53% and R2 = 0.996–1, which were both determined using values obtained from the automatic Architect assay, showed good reproducibility and linearity. Results of the two Architect assays demonstrated a feasible correlation (n = 130 samples; R = 0.898, p 0.93 in all cases. In conclusion, the correlation between the automatic and manual dilution Architect assays was feasible, particularly in the HBeAg-negative and low DNA groups. With lower labor costs and less human error than the manual version, the Abbott automatic dilution Architect assay provided a good clinical performance with regard to the HBsAg levels.
Cai, Wei; He, Baochun; Fang, Chihua
2016-01-01
This study was to evaluate the accuracy, consistency, and efficiency of three liver volumetry methods— one interactive method, an in‐house‐developed 3D medical Image Analysis (3DMIA) system, one automatic active shape model (ASM)‐based segmentation, and one automatic probabilistic atlas (PA)‐guided segmentation method on clinical contrast‐enhanced CT images. Forty‐two datasets, including 27 normal liver and 15 space‐occupying liver lesion patients, were retrospectively included in this study. The three methods — one semiautomatic 3DMIA, one automatic ASM‐based, and one automatic PA‐based liver volumetry — achieved an accuracy with VD (volume difference) of −1.69%,−2.75%, and 3.06% in the normal group, respectively, and with VD of −3.20%,−3.35%, and 4.14% in the space‐occupying lesion group, respectively. However, the three methods achieved an efficiency of 27.63 mins, 1.26 mins, 1.18 mins on average, respectively, compared with the manual volumetry, which took 43.98 mins. The high intraclass correlation coefficient between the three methods and the manual method indicated an excellent agreement on liver volumetry. Significant differences in segmentation time were observed between the three methods (3DMIA, ASM, and PA) and the manual volumetry (pvolumetries (ASM and PA) and the semiautomatic volumetry (3DMIA) (pvolumetry agreed well with manual gold standard in both the normal liver group and the space‐occupying lesion group. The ASM‐ and PA‐based automatic segmentation have better efficiency in clinical use. PACS number(s): 87.55.‐x PMID:27929487
Research on wireless communication technology based on automatic logistics system of welder
Directory of Open Access Journals (Sweden)
Sun Xuan
2018-01-01
Full Text Available In order to meet the requirements of high real-time and high stability of data transmission in automatic welding system, RTU data format and real-time communication mechanism are adopted in this system. In the automatic logistics system through the Ethernet and wireless WIFI technology will palletizer, stacker, AGV car organically together to complete the palletizer automatic crawling the goods, AGV car automatic delivery, stacking machine automatically out of the Dimensional warehouse. .
Research on wireless communication technology based on automatic logistics system of welder
Sun Xuan; Wang Zhi-yong; Ma Zhe-dong
2018-01-01
In order to meet the requirements of high real-time and high stability of data transmission in automatic welding system, RTU data format and real-time communication mechanism are adopted in this system. In the automatic logistics system through the Ethernet and wireless WIFI technology will palletizer, stacker, AGV car organically together to complete the palletizer automatic crawling the goods, AGV car automatic delivery, stacking machine automatically out of the Dimensional warehouse. .
Data mining to detect clinical mastitis with automatic milking
Kamphuis, C.; Mollenhorst, H.; Heesterbeek, J.A.P.; Hogeveen, H.
2010-01-01
Our objective was to use data mining to develop and validate a detection model for clinical mastitis (CM) using sensor data collected at nine Dutch dairy herds milking automatically. Sensor data was available for almost 3.5 million quarter milkings (QM) from 1,109 cows; 348 QM with CM were observed
Keefe, Donald J.
1980-01-01
An automatically sweeping circuit for searching for an evoked response in an output signal in time with respect to a trigger input. Digital counters are used to activate a detector at precise intervals, and monitoring is repeated for statistical accuracy. If the response is not found then a different time window is examined until the signal is found.
Mental imagery affects subsequent automatic defense responses
Directory of Open Access Journals (Sweden)
Muriel A Hagenaars
2015-06-01
Full Text Available Automatic defense responses promote survival and appropriate action under threat. They have also been associated with the development of threat-related psychiatric syndromes. Targeting such automatic responses during threat may be useful in populations with frequent threat exposure. Here, two experiments explored whether mental imagery as a pre-trauma manipulation could influence fear bradycardia (a core characteristic of freezing during subsequent analogue trauma (affective picture viewing. Image-based interventions have proven successful in the treatment of threat-related disorders, and are easily applicable. In Experiment 1 43 healthy participants were randomly assigned to an imagery script condition. Participants executed a passive viewing task with blocks of neutral, pleasant and unpleasant pictures after listening to an auditory script that was either related (with a positive or a negative outcome or unrelated to the unpleasant pictures from the passive viewing task. Heart rate was assessed during script listening and during passive viewing. Imagining negative related scripts resulted in greater bradycardia (neutral-unpleasant contrast than imagining positive scripts, especially unrelated. This effect was replicated in Experiment 2 (N = 51, again in the neutral-unpleasant contrast. An extra no-script condition showed that bradycardia was not induced by the negative related script, but rather that a positive script attenuated bradycardia. These preliminary results might indicate reduced vigilance after unrelated positive events. Future research should replicate these findings using a larger sample. Either way, the findings show that highly automatic defense behavior can be influenced by relatively simple mental imagery manipulations.
Automatic River Network Extraction from LIDAR Data
Maderal, E. N.; Valcarcel, N.; Delgado, J.; Sevilla, C.; Ojeda, J. C.
2016-06-01
National Geographic Institute of Spain (IGN-ES) has launched a new production system for automatic river network extraction for the Geospatial Reference Information (GRI) within hydrography theme. The goal is to get an accurate and updated river network, automatically extracted as possible. For this, IGN-ES has full LiDAR coverage for the whole Spanish territory with a density of 0.5 points per square meter. To implement this work, it has been validated the technical feasibility, developed a methodology to automate each production phase: hydrological terrain models generation with 2 meter grid size and river network extraction combining hydrographic criteria (topographic network) and hydrological criteria (flow accumulation river network), and finally the production was launched. The key points of this work has been managing a big data environment, more than 160,000 Lidar data files, the infrastructure to store (up to 40 Tb between results and intermediate files), and process; using local virtualization and the Amazon Web Service (AWS), which allowed to obtain this automatic production within 6 months, it also has been important the software stability (TerraScan-TerraSolid, GlobalMapper-Blue Marble , FME-Safe, ArcGIS-Esri) and finally, the human resources managing. The results of this production has been an accurate automatic river network extraction for the whole country with a significant improvement for the altimetric component of the 3D linear vector. This article presents the technical feasibility, the production methodology, the automatic river network extraction production and its advantages over traditional vector extraction systems.
AUTOMATIC RIVER NETWORK EXTRACTION FROM LIDAR DATA
Directory of Open Access Journals (Sweden)
E. N. Maderal
2016-06-01
Full Text Available National Geographic Institute of Spain (IGN-ES has launched a new production system for automatic river network extraction for the Geospatial Reference Information (GRI within hydrography theme. The goal is to get an accurate and updated river network, automatically extracted as possible. For this, IGN-ES has full LiDAR coverage for the whole Spanish territory with a density of 0.5 points per square meter. To implement this work, it has been validated the technical feasibility, developed a methodology to automate each production phase: hydrological terrain models generation with 2 meter grid size and river network extraction combining hydrographic criteria (topographic network and hydrological criteria (flow accumulation river network, and finally the production was launched. The key points of this work has been managing a big data environment, more than 160,000 Lidar data files, the infrastructure to store (up to 40 Tb between results and intermediate files, and process; using local virtualization and the Amazon Web Service (AWS, which allowed to obtain this automatic production within 6 months, it also has been important the software stability (TerraScan-TerraSolid, GlobalMapper-Blue Marble , FME-Safe, ArcGIS-Esri and finally, the human resources managing. The results of this production has been an accurate automatic river network extraction for the whole country with a significant improvement for the altimetric component of the 3D linear vector. This article presents the technical feasibility, the production methodology, the automatic river network extraction production and its advantages over traditional vector extraction systems.
Automatic re-contouring in 4D radiotherapy
International Nuclear Information System (INIS)
Lu, Weiguo; Olivera, Gustavo H; Chen, Quan; Chen, Ming-Li; Ruchala, Kenneth J
2006-01-01
Delineating regions of interest (ROIs) on each phase of four-dimensional (4D) computed tomography (CT) images is an essential step for 4D radiotherapy. The requirement of manual phase-by-phase contouring prohibits the routine use of 4D radiotherapy. This paper develops an automatic re-contouring algorithm that combines techniques of deformable registration and surface construction. ROIs are manually contoured slice-by-slice in the reference phase image. A reference surface is constructed based on these reference contours using a triangulated surface construction technique. The deformable registration technique provides the voxel-to-voxel mapping between the reference phase and the test phase. The vertices of the reference surface are displaced in accordance with the deformation map, resulting in a deformed surface. The new contours are reconstructed by cutting the deformed surface slice-by-slice along the transversal, sagittal or coronal direction. Since both the inputs and outputs of our automatic re-contouring algorithm are contours, it is relatively easy to cope with any treatment planning system. We tested our automatic re-contouring algorithm using a deformable phantom and 4D CT images of six lung cancer patients. The proposed algorithm is validated by visual inspections and quantitative comparisons of the automatic re-contours with both the gold standard segmentations and the manual contours. Based on the automatic delineated ROIs, changes of tumour and sensitive structures during respiration are quantitatively analysed. This algorithm could also be used to re-contour daily images for treatment evaluation and adaptive radiotherapy
Preventing SQL Injection through Automatic Query Sanitization with ASSIST
Directory of Open Access Journals (Sweden)
Raymond Mui
2010-09-01
Full Text Available Web applications are becoming an essential part of our everyday lives. Many of our activities are dependent on the functionality and security of these applications. As the scale of these applications grows, injection vulnerabilities such as SQL injection are major security challenges for developers today. This paper presents the technique of automatic query sanitization to automatically remove SQL injection vulnerabilities in code. In our technique, a combination of static analysis and program transformation are used to automatically instrument web applications with sanitization code. We have implemented this technique in a tool named ASSIST (Automatic and Static SQL Injection Sanitization Tool for protecting Java-based web applications. Our experimental evaluation showed that our technique is effective against SQL injection vulnerabilities and has a low overhead.
Automatic reel controls filler wire in welding machines
Millett, A. V.
1966-01-01
Automatic reel on automatic welding equipment takes up slack in the reel-fed filler wire when welding operation is terminated. The reel maintains constant, adjustable tension on the wire during the welding operation and rewinds the wire from the wire feed unit when the welding is completed.
Programs for the automatic gamma-ray measurement with CANBERRA 8100/QUANTA system
International Nuclear Information System (INIS)
Yoshida, Hiroshi; Sakai, Eiji; Kubo, Katsumi.
1982-07-01
Some programs have been prepared for the automatic operation of the CANBERRA 8100/QUANTA System for the gamma-ray spectrum measurement. The main parts of these programs are: (1) to collect and record on magnetic disks the data of gamma-ray spectra automatically, while the recorded data are analyzed to estimate the nuclides which generate photopeaks of spectra and to calculate those concentrations; (2) to draw plotted diagrams of pulse height distributions of gamma-ray spectra data and other data by the additional digital plotter; and etc. (author)
Automatic Vetting for Malice in Android Platforms
2016-05-01
Android Apps from Play Store Infected with Brain Test Malware. http://www.ibtimes.co.uk/google- removes -13- android -apps-play-store-infected- brain-test...AUTOMATIC VETTING FOR MALICE IN ANDROID PLATFORMS IOWA STATE UNIVERSITY MAY 2016 FINAL TECHNICAL REPORT APPROVED...COVERED (From - To) DEC 2013 - DEC 2015 4. TITLE AND SUBTITLE Automatic Vetting for Malice in Android Platforms 5a. CONTRACT NUMBER FA8750-14-2
Automatic penalty continuation in structural topology optimization
DEFF Research Database (Denmark)
Rojas Labanda, Susana; Stolpe, Mathias
2015-01-01
this issue is addressed. We propose an automatic continuation method, where the material penalization parameter is included as a new variable in the problem and a constraint guarantees that the requested penalty is eventually reached. The numerical results suggest that this approach is an appealing...... alternative to continuation methods. Automatic continuation also generally obtains better designs than the classical formulation using a reduced number of iterations....
Functional role of voltage gated Ca2+ channels in heart automaticity
Directory of Open Access Journals (Sweden)
Pietro eMesirca
2015-02-01
Full Text Available Pacemaker activity of automatic cardiac myocytes controls the heartbeat in everyday life. Cardiac automaticity is under the control of several neurotransmitters and hormones and is constantly regulated by the autonomic nervous system to match the physiological needs of the organism. Several classes of ion channels and proteins involved in intracellular Ca2+ dynamics contribute to pacemaker activity. The functional role of voltage-gated calcium channels (VGCCs in heart automaticity and impulse conduction has been matter of debate for 30 years. However, growing evidence shows that VGCCs are important regulators of the pacemaker mechanisms and play also a major role in atrio-ventricular impulse conduction. Incidentally, studies performed in genetically modified mice lacking L-type Cav1.3 (Cav1.3-/- or T-type Cav3.1 (Cav3.1-/- channels show that genetic inactivation of these channels strongly impacts pacemaking. In cardiac pacemaker cells, VGCCs activate at negative voltages at the beginning of the diastolic depolarization and importantly contribute to this phase by supplying inward current. Loss-of-function of these channels also impairs atrio-ventricular conduction. Furthermore, inactivation of Cav1.3 channels promotes also atrial fibrillation and flutter in knockout mice suggesting that these channels can play a role in stabilizing atrial rhythm. Genomic analysis demonstrated that Cav1.3 and Cav3.1 channels are widely expressed in pacemaker tissue of mice, rabbits and humans. Importantly, human diseases of pacemaker activity such as congenital bradycardia and heart block have been attributed to loss-of-function of Cav1.3 and Cav3.1 channels. In this article, we will review the current knowledge on the role of VGCCs in the generation and regulation of heart rate and rhythm. We will discuss also how loss of Ca2+ entry through VGCCs could influence intracellular Ca2+ handling and promote atrial arrhythmias.
Automatic first-break picking using the instantaneous traveltime attribute
Saragiotis, Christos
2012-01-01
Picking the first breaks is an important step in seismic processing. The large volume of the seismic data calls for automatic and objective picking. We introduce a new automatic first-break picker, which uses specifically designed time windows and an iterative procedure based on the instantaneous traveltime attribute. The method is fast as it only uses a few FFT\\'s per trace. We demonstrate the effectiveness of this automatic method by applying it on real test data.
Accessories for Enhancement of the Semi-Automatic Welding Processes
National Research Council Canada - National Science Library
Wheeler, Douglas M; Sawhill, James M
2000-01-01
The project's objective is to identify specific areas of the semi-automatic welding operation that is performed with the major semi-automatic processes, which would be more productive if a suitable...
Temporal Evolution of “Automatic Gain-Scaling”
Pruszynski, J. Andrew; Kurtzer, Isaac; Lillicrap, Timothy P.; Scott, Stephen H.
2009-01-01
The earliest neural response to a mechanical perturbation, the short-latency stretch response (R1: 20–45 ms), is known to exhibit “automatic gain-scaling” whereby its magnitude is proportional to preperturbation muscle activity. Because gain-scaling likely reflects an intrinsic property of the motoneuron pool (via the size-recruitment principle), counteracting this property poses a fundamental challenge for the nervous system, which must ultimately counter the absolute change in load regardle...
Automatic generation of anatomic characteristics from cerebral aneurysm surface models.
Neugebauer, M; Lawonn, K; Beuing, O; Preim, B
2013-03-01
Computer-aided research on cerebral aneurysms often depends on a polygonal mesh representation of the vessel lumen. To support a differentiated, anatomy-aware analysis, it is necessary to derive anatomic descriptors from the surface model. We present an approach on automatic decomposition of the adjacent vessels into near- and far-vessel regions and computation of the axial plane. We also exemplarily present two applications of the geometric descriptors: automatic computation of a unique vessel order and automatic viewpoint selection. Approximation methods are employed to analyze vessel cross-sections and the vessel area profile along the centerline. The resulting transition zones between near- and far- vessel regions are used as input for an optimization process to compute the axial plane. The unique vessel order is defined via projection into the plane space of the axial plane. The viewing direction for the automatic viewpoint selection is derived from the normal vector of the axial plane. The approach was successfully applied to representative data sets exhibiting a broad variability with respect to the configuration of their adjacent vessels. A robustness analysis showed that the automatic decomposition is stable against noise. A survey with 4 medical experts showed a broad agreement with the automatically defined transition zones. Due to the general nature of the underlying algorithms, this approach is applicable to most of the likely aneurysm configurations in the cerebral vasculature. Additional geometric information obtained during automatic decomposition can support correction in case the automatic approach fails. The resulting descriptors can be used for various applications in the field of visualization, exploration and analysis of cerebral aneurysms.
The Potential of Automatic Word Comparison for Historical Linguistics.
List, Johann-Mattis; Greenhill, Simon J; Gray, Russell D
2017-01-01
The amount of data from languages spoken all over the world is rapidly increasing. Traditional manual methods in historical linguistics need to face the challenges brought by this influx of data. Automatic approaches to word comparison could provide invaluable help to pre-analyze data which can be later enhanced by experts. In this way, computational approaches can take care of the repetitive and schematic tasks leaving experts to concentrate on answering interesting questions. Here we test the potential of automatic methods to detect etymologically related words (cognates) in cross-linguistic data. Using a newly compiled database of expert cognate judgments across five different language families, we compare how well different automatic approaches distinguish related from unrelated words. Our results show that automatic methods can identify cognates with a very high degree of accuracy, reaching 89% for the best-performing method Infomap. We identify the specific strengths and weaknesses of these different methods and point to major challenges for future approaches. Current automatic approaches for cognate detection-although not perfect-could become an important component of future research in historical linguistics.
A consideration of the operation of automatic production machines.
Hoshi, Toshiro; Sugimoto, Noboru
2015-01-01
At worksites, various automatic production machines are in use to release workers from muscular labor or labor in the detrimental environment. On the other hand, a large number of industrial accidents have been caused by automatic production machines. In view of this, this paper considers the operation of automatic production machines from the viewpoint of accident prevention, and points out two types of machine operation - operation for which quick performance is required (operation that is not permitted to be delayed) - and operation for which composed performance is required (operation that is not permitted to be performed in haste). These operations are distinguished by operation buttons of suitable colors and shapes. This paper shows that these characteristics are evaluated as "asymmetric on the time-axis". Here, in order for workers to accept the risk of automatic production machines, it is preconditioned in general that harm should be sufficiently small or avoidance of harm is easy. In this connection, this paper shows the possibility of facilitating the acceptance of the risk of automatic production machines by enhancing the asymmetric on the time-axis.
Methodology for Automatic Ontology Generation Using Database Schema Information
Directory of Open Access Journals (Sweden)
JungHyen An
2018-01-01
Full Text Available An ontology is a model language that supports the functions to integrate conceptually distributed domain knowledge and infer relationships among the concepts. Ontologies are developed based on the target domain knowledge. As a result, methodologies to automatically generate an ontology from metadata that characterize the domain knowledge are becoming important. However, existing methodologies to automatically generate an ontology using metadata are required to generate the domain metadata in a predetermined template, and it is difficult to manage data that are increased on the ontology itself when the domain OWL (Ontology Web Language individuals are continuously increased. The database schema has a feature of domain knowledge and provides structural functions to efficiently process the knowledge-based data. In this paper, we propose a methodology to automatically generate ontologies and manage the OWL individual through an interaction of the database and the ontology. We describe the automatic ontology generation process with example schema and demonstrate the effectiveness of the automatically generated ontology by comparing it with existing ontologies using the ontology quality score.
Automatic Deficits can lead to executive deficits in ADHD
Directory of Open Access Journals (Sweden)
Gabriella Martino
2017-12-01
Full Text Available It has been well documented an executive dysfunction in children with Attention Deficit Hyperactivity Disorder (ADHD and with Reading Disorder (RD. The purpose of the present study was to test an alternative hypothesis that deficits in executive functioning within ADHD may be partially due to an impairment of the automatic processing. In addition, since the co-occurrence between ADHD and RD, we tested the hypothesis that the automatic processing may be a possible common cognitive factor between ADHD and RD. We investigated the automatic processing of selective visual attention through two experiments. 12 children with ADHD, 17 with ADHD+RD and 29 typically developing children, matched for age and gender, performed two tasks: Visual Information Processing Task and Clock Test. As expected, ADHD and ADHD+RD groups differed from the control group in controlled process task, suggesting a deficit in executive functioning. All clinical subjects also exhibited a lower performance in automatic processes, compared to control group. The results of this study suggest that executive deficits within ADHD can be partially due to an impairment of automatic processing.
Higher-order automatic differentiation of mathematical functions
Charpentier, Isabelle; Dal Cappello, Claude
2015-04-01
Functions of mathematical physics such as the Bessel functions, the Chebyshev polynomials, the Gauss hypergeometric function and so forth, have practical applications in many scientific domains. On the one hand, differentiation formulas provided in reference books apply to real or complex variables. These do not account for the chain rule. On the other hand, based on the chain rule, the automatic differentiation has become a natural tool in numerical modeling. Nevertheless automatic differentiation tools do not deal with the numerous mathematical functions. This paper describes formulas and provides codes for the higher-order automatic differentiation of mathematical functions. The first method is based on Faà di Bruno's formula that generalizes the chain rule. The second one makes use of the second order differential equation they satisfy. Both methods are exemplified with the aforementioned functions.
Oocytes Polar Body Detection for Automatic Enucleation
Directory of Open Access Journals (Sweden)
Di Chen
2016-02-01
Full Text Available Enucleation is a crucial step in cloning. In order to achieve automatic blind enucleation, we should detect the polar body of the oocyte automatically. The conventional polar body detection approaches have low success rate or low efficiency. We propose a polar body detection method based on machine learning in this paper. On one hand, the improved Histogram of Oriented Gradient (HOG algorithm is employed to extract features of polar body images, which will increase success rate. On the other hand, a position prediction method is put forward to narrow the search range of polar body, which will improve efficiency. Experiment results show that the success rate is 96% for various types of polar bodies. Furthermore, the method is applied to an enucleation experiment and improves the degree of automatic enucleation.
International Nuclear Information System (INIS)
Higashigaito, K.; Becker, A.S.; Sprengel, K.; Simmen, H.-P.; Wanner, G.; Alkadhi, H.
2016-01-01
Aim: To demonstrate the feasibility and accuracy of automatic radiation dose monitoring software for computed tomography (CT) of trauma patients in a clinical setting over time, and to evaluate the potential of radiation dose reduction using iterative reconstruction (IR). Materials and methods: In a time period of 18 months, data from 378 consecutive thoraco-abdominal CT examinations of trauma patients were extracted using automatic radiation dose monitoring software, and patients were split into three cohorts: cohort 1, 64-section CT with filtered back projection, 200 mAs tube current–time product; cohort 2, 128-section CT with IR and identical imaging protocol; cohort 3, 128-section CT with IR, 150 mAs tube current–time product. Radiation dose parameters from the software were compared with the individual patient protocols. Image noise was measured and image quality was semi-quantitatively determined. Results: Automatic extraction of radiation dose metrics was feasible and accurate in all (100%) patients. All CT examinations were of diagnostic quality. There were no differences between cohorts 1 and 2 regarding volume CT dose index (CTDI_v_o_l; p=0.62), dose–length product (DLP), and effective dose (ED, both p=0.95), while noise was significantly lower (chest and abdomen, both −38%, p<0.017). Compared to cohort 1, CTDI_v_o_l, DLP, and ED in cohort 3 were significantly lower (all −25%, p<0.017), similar to the noise in the chest (–32%) and abdomen (–27%, both p<0.017). Compared to cohort 2, CTDI_v_o_l (–28%), DLP, and ED (both –26%) in cohort 3 was significantly lower (all, p<0.017), while noise in the chest (+9%) and abdomen (+18%) was significantly higher (all, p<0.017). Conclusion: Automatic radiation dose monitoring software is feasible and accurate, and can be implemented in a clinical setting for evaluating the effects of lowering radiation doses of CT protocols over time. - Highlights: • Automatic dose monitoring software can be
Automatic Generation of Setup for CNC Spring Coiler Based on Case-based Reasoning
Institute of Scientific and Technical Information of China (English)
KU Xiangchen; WANG Runxiao; LI Jishun; WANG Dongbo
2006-01-01
When producing special-shape spring in CNC spring coiler, the setup of the coiler is often a manual work using a trial-and-error method. As a result, the setup of coiler consumes so much time and becomes the bottleneck of the spring production process. In order to cope with this situation, this paper proposes an automatic generation system of setup for CNC spring coiler using case-based reasoning (CBR). The core of the study contains: (1) integrated reasoning model of CBR system;(2) spatial shape describe of special-shape spring based on feature;(3) coiling case representation using shape feature matrix; and (4) case similarity measure algorithm. The automatic generation system has implemented with C++ Builder 6.0 and is helpful in improving the automaticity and efficiency of spring coiler.
Automatic temporal expectancy: a high-density event-related potential study.
Directory of Open Access Journals (Sweden)
Giovanni Mento
Full Text Available How we compute time is not fully understood. Questions include whether an automatic brain mechanism is engaged in temporally regular environmental structure in order to anticipate events, and whether this can be dissociated from task-related processes, including response preparation, selection and execution. To investigate these issues, a passive temporal oddball task requiring neither time-based motor response nor explicit decision was specifically designed and delivered to participants during high-density, event-related potentials recording. Participants were presented with pairs of audiovisual stimuli (S1 and S2 interspersed with an Inter-Stimulus Interval (ISI that was manipulated according to an oddball probabilistic distribution. In the standard condition (70% of trials, the ISI lasted 1,500 ms, while in the two alternative, deviant conditions (15% each, it lasted 2,500 and 3,000 ms. The passive over-exposition to the standard ISI drove participants to automatically and progressively create an implicit temporal expectation of S2 onset, reflected by the time course of the Contingent Negative Variation response, which always peaked in correspondence to the point of S2 maximum expectation and afterwards inverted in polarity towards the baseline. Brain source analysis of S1- and ISI-related ERP activity revealed activation of sensorial cortical areas and the supplementary motor area (SMA, respectively. In particular, since the SMA time course synchronised with standard ISI, we suggest that this area is the major cortical generator of the temporal CNV reflecting an automatic, action-independent mechanism underlying temporal expectancy.
Automatic schema evolution in Root
International Nuclear Information System (INIS)
Brun, R.; Rademakers, F.
2001-01-01
ROOT version 3 (spring 2001) supports automatic class schema evolution. In addition this version also produces files that are self-describing. This is achieved by storing in each file a record with the description of all the persistent classes in the file. Being self-describing guarantees that a file can always be read later, its structure browsed and objects inspected, also when the library with the compiled code of these classes is missing. The schema evolution mechanism supports the frequent case when multiple data sets generated with many different class versions must be analyzed in the same session. ROOT supports the automatic generation of C++ code describing the data objects in a file
Automatic computation of radioimmunoassay data
International Nuclear Information System (INIS)
Toyota, Takayoshi; Kudo, Mikihiko; Abe, Kanji; Kawamata, Fumiaki; Uehata, Shigeru.
1975-01-01
Radioimmunoassay provided dose response curves which showed linearity by the use of logistic transformation (Rodbard). This transformation which was applicable to radioimmunoassay should be useful for the computer processing of insulin and C-peptide assay. In the present studies, standard curves were analysed by testing the fit of analytic functions to radioimmunoassay of insulin and C-peptides. A program for use in combination with the double antibody technique was made by Dr. Kawamata. This approach was evidenced to be useful in order to allow automatic computation of data derived from the double antibody assays of insulin and C-peptides. Automatic corrected calculations of radioimmunoassay data of insulin was found to be satisfactory. (auth.)
Comparison of manual and automatic MR-CT registration for radiotherapy of prostate cancer.
Korsager, Anne Sofie; Carl, Jesper; Riis Østergaard, Lasse
2016-05-08
In image-guided radiotherapy (IGRT) of prostate cancer, delineation of the clini-cal target volume (CTV) often relies on magnetic resonance (MR) because of its good soft-tissue visualization. Registration of MR and computed tomography (CT) is required in order to add this accurate delineation to the dose planning CT. An automatic approach for local MR-CT registration of the prostate has previously been developed using a voxel property-based registration as an alternative to a manual landmark-based registration. The aim of this study is to compare the two registration approaches and to investigate the clinical potential for replacing the manual registration with the automatic registration. Registrations and analysis were performed for 30 prostate cancer patients treated with IGRT using a Ni-Ti prostate stent as a fiducial marker. The comparison included computing translational and rotational differences between the approaches, visual inspection, and computing the overlap of the CTV. The computed mean translational difference was 1.65, 1.60, and 1.80mm and the computed mean rotational difference was 1.51°, 3.93°, and 2.09° in the superior/inferior, anterior/posterior, and medial/lateral direction, respectively. The sensitivity of overlap was 87%. The results demonstrate that the automatic registration approach performs registrations comparable to the manual registration.
Investigating the Relationship between Stable Personality Characteristics and Automatic Imitation.
Butler, Emily E; Ward, Robert; Ramsey, Richard
2015-01-01
Automatic imitation is a cornerstone of nonverbal communication that fosters rapport between interaction partners. Recent research has suggested that stable dimensions of personality are antecedents to automatic imitation, but the empirical evidence linking imitation with personality traits is restricted to a few studies with modest sample sizes. Additionally, atypical imitation has been documented in autism spectrum disorders and schizophrenia, but the mechanisms underpinning these behavioural profiles remain unclear. Using a larger sample than prior studies (N=243), the current study tested whether performance on a computer-based automatic imitation task could be predicted by personality traits associated with social behaviour (extraversion and agreeableness) and with disorders of social cognition (autistic-like and schizotypal traits). Further personality traits (narcissism and empathy) were assessed in a subsample of participants (N=57). Multiple regression analyses showed that personality measures did not predict automatic imitation. In addition, using a similar analytical approach to prior studies, no differences in imitation performance emerged when only the highest and lowest 20 participants on each trait variable were compared. These data weaken support for the view that stable personality traits are antecedents to automatic imitation and that neural mechanisms thought to support automatic imitation, such as the mirror neuron system, are dysfunctional in autism spectrum disorders or schizophrenia. In sum, the impact that personality variables have on automatic imitation is less universal than initial reports suggest.
Investigating the Relationship between Stable Personality Characteristics and Automatic Imitation.
Directory of Open Access Journals (Sweden)
Emily E Butler
Full Text Available Automatic imitation is a cornerstone of nonverbal communication that fosters rapport between interaction partners. Recent research has suggested that stable dimensions of personality are antecedents to automatic imitation, but the empirical evidence linking imitation with personality traits is restricted to a few studies with modest sample sizes. Additionally, atypical imitation has been documented in autism spectrum disorders and schizophrenia, but the mechanisms underpinning these behavioural profiles remain unclear. Using a larger sample than prior studies (N=243, the current study tested whether performance on a computer-based automatic imitation task could be predicted by personality traits associated with social behaviour (extraversion and agreeableness and with disorders of social cognition (autistic-like and schizotypal traits. Further personality traits (narcissism and empathy were assessed in a subsample of participants (N=57. Multiple regression analyses showed that personality measures did not predict automatic imitation. In addition, using a similar analytical approach to prior studies, no differences in imitation performance emerged when only the highest and lowest 20 participants on each trait variable were compared. These data weaken support for the view that stable personality traits are antecedents to automatic imitation and that neural mechanisms thought to support automatic imitation, such as the mirror neuron system, are dysfunctional in autism spectrum disorders or schizophrenia. In sum, the impact that personality variables have on automatic imitation is less universal than initial reports suggest.
Semi-automatic logarithmic converter of logs
International Nuclear Information System (INIS)
Gol'dman, Z.A.; Bondar's, V.V.
1974-01-01
Semi-automatic logarithmic converter of logging charts. An original semi-automatic converter was developed for use in converting BK resistance logging charts and the time interval, ΔT, of acoustic logs from a linear to a logarithmic scale with a specific ratio for subsequent combining of them with neutron-gamma logging charts in operative interpretation of logging materials by a normalization method. The converter can be used to increase productivity by giving curves different from those obtained in manual, pointwise processing. The equipment operates reliably and is simple in use. (author)
Automatic segmentation of vertebrae from radiographs
DEFF Research Database (Denmark)
Mysling, Peter; Petersen, Peter Kersten; Nielsen, Mads
2011-01-01
Segmentation of vertebral contours is an essential task in the design of automatic tools for vertebral fracture assessment. In this paper, we propose a novel segmentation technique which does not require operator interaction. The proposed technique solves the segmentation problem in a hierarchical...... is constrained by a conditional shape model, based on the variability of the coarse spine location estimates. The technique is evaluated on a data set of manually annotated lumbar radiographs. The results compare favorably to the previous work in automatic vertebra segmentation, in terms of both segmentation...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Will you automatically receive all of your trust funds... § 115.428 Will you automatically receive all of your trust funds when you reach the age of 18? No, we will not automatically send your trust funds to you when you reach the age of 18. ...
FRICTION - WELDING MACHINE AUTOMATIC CONTROL CIRCUIT DESIGN AND APPLICATION
Directory of Open Access Journals (Sweden)
Hakan ATEŞ
2003-02-01
Full Text Available In this work, automatic controllability of a laboratory-sized friction-welding machine has been investigated. The laboratory-sized friction-welding machine was composed of motor, brake, rotary and constant samples late pliers, and hydraulic unit. In automatic method, welding parameters such as friction time, friction pressure, forge time and forge pressure can be applied sensitively using time relays and contactors. At the end of the experimental study it's observed that automatic control system has been worked successfully.
Pries, V. V.; Proskuriakov, N. E.
2018-04-01
To control the assembly quality of multi-element mass-produced products on automatic rotor lines, control methods with operational feedback are required. However, due to possible failures in the operation of the devices and systems of automatic rotor line, there is always a real probability of getting defective (incomplete) products into the output process stream. Therefore, a continuous sampling control of the products completeness, based on the use of statistical methods, remains an important element in managing the quality of assembly of multi-element mass products on automatic rotor lines. The feature of continuous sampling control of the multi-element products completeness in the assembly process is its breaking sort, which excludes the possibility of returning component parts after sampling control to the process stream and leads to a decrease in the actual productivity of the assembly equipment. Therefore, the use of statistical procedures for continuous sampling control of the multi-element products completeness when assembled on automatic rotor lines requires the use of such sampling plans that ensure a minimum size of control samples. Comparison of the values of the limit of the average output defect level for the continuous sampling plan (CSP) and for the automated continuous sampling plan (ACSP) shows the possibility of providing lower limit values for the average output defects level using the ACSP-1. Also, the average sample size when using the ACSP-1 plan is less than when using the CSP-1 plan. Thus, the application of statistical methods in the assembly quality management of multi-element products on automatic rotor lines, involving the use of proposed plans and methods for continuous selective control, will allow to automating sampling control procedures and the required level of quality of assembled products while minimizing sample size.
Design of automatic mobile trolley using ultrasonic sensors
Dodi Suryanto, Eka; Siagian, Hendrik; Perangin-Angin, Despaleri; Sashanti, Rahayu; Yogen, Suthes
2018-04-01
An automatic mobile trolley was a prototype of wheel robot that serves as a trolley or shopping cart. This paper proposed an automatic mobile trolley using ultrasonic sensors. It can follow human movement automatically. It did not need to be encouraged or withdrawn. It would make an easier shopping for people as customers. The trolley controlled by a microcontroller module unit. It can stop, turn right, turn left, forward and backward. It can follow wherever they go, during they were in range. Based on the test results, the trolley succeeded to move forward by 80%, move backward 80%, turn left, 70%, turn right 70%, and stop 80%.
Automatic Sample Changer for X-Ray Spectrometry
International Nuclear Information System (INIS)
Morales Tarre, Orlando; Diaz Castro, Maikel; Rivero Ramirez, Doris; Lopez Pino, Neivy
2011-01-01
The design and construction of an automatic sample changer for Nuclear Analysis Laboratory's X-ray spectrometer at InSTEC is presented by giving basic details about its mechanical structure, control circuits and the software application developed to interact with the data acquisition software of the multichannel analyzer. Results of some test experiments performed with the automatic sample changer are also discussed. The system is currently in use at InSTEC. (Author)
Automatic Control of Freeboard and Turbine Operation
DEFF Research Database (Denmark)
Kofoed, Jens Peter; Frigaard, Peter Bak; Friis-Madsen, Erik
The report deals with the modules for automatic control of freeboard and turbine operation on board the Wave dragon, Nissum Bredning (WD-NB) prototype, and covers what has been going on up to ultimo 2003.......The report deals with the modules for automatic control of freeboard and turbine operation on board the Wave dragon, Nissum Bredning (WD-NB) prototype, and covers what has been going on up to ultimo 2003....
Automatic terrain modeling using transfinite element analysis
Collier, Nathan
2010-05-31
An automatic procedure for modeling terrain is developed based on L2 projection-based interpolation of discrete terrain data onto transfinite function spaces. The function space is refined automatically by the use of image processing techniques to detect regions of high error and the flexibility of the transfinite interpolation to add degrees of freedom to these areas. Examples are shown of a section of the Palo Duro Canyon in northern Texas.
Automatic age and gaze estimation under uncontrolled conditions
Alnajar, F.
2016-01-01
Can the computer learn a person’s age just from analyzing facial images obtained by a simple webcam? If so, you can automatically determine if a person has the right age to buy beer (shops), to use a credit card (retail), and can enter bars (entertainment). Can the computer automatically recognize
Applying Hierarchical Model Calibration to Automatically Generated Items.
Williamson, David M.; Johnson, Matthew S.; Sinharay, Sandip; Bejar, Isaac I.
This study explored the application of hierarchical model calibration as a means of reducing, if not eliminating, the need for pretesting of automatically generated items from a common item model prior to operational use. Ultimately the successful development of automatic item generation (AIG) systems capable of producing items with highly similar…
Application of automatic image analysis in wood science
Charles W. McMillin
1982-01-01
In this paper I describe an image analysis system and illustrate with examples the application of automatic quantitative measurement to wood science. Automatic image analysis, a powerful and relatively new technology, uses optical, video, electronic, and computer components to rapidly derive information from images with minimal operator interaction. Such instruments...
Usage of aids monitoring in automatic braking systems of modern cars
Dembitskyi V.; Mazylyuk P.; Sitovskyi O.
2016-01-01
Increased safety can be carried out at the expense the installation on vehicles of automatic braking systems, that monitor the traffic situation and the actions of the driver. In this paper considered the advantages and disadvantages of automatic braking systems, were analyzed modern tracking tools that are used in automatic braking systems. Based on the statistical data on accidents, are set the main dangers, that the automatic braking system will be reduced. In order to ensure the acc...
Chao, Jane C-J; Chiang, Shih-Wen; Wang, Ching-Chiung; Tsai, Ya-Hui; Wu, Ming-Shun
2006-01-01
AIM: To investigate the effect of hot water-extracted Lycium barbarum (LBE) and Rehmannia glutinosa (RGE) on cell proliferation and apoptosis in rat and/or human hepatocellular carcinoma (HCC) cells. METHODS: Rat (H-4-II-E) and human HCC (HA22T/VGH) cell lines were incubated with various concentrations (0-10 g/L) of hot water-extracted LBE and RGE. After 6-24 h incubation, cell proliferation (n = 6) was measured by a colorimetric method. The apoptotic cells (n = 6) were detected by flow cytometry. The expression of p53 protein (n = 3) was determined by SDS-PAGE and Western blotting. RESULTS: Crude LBE (2-5 g/L) and RGE (2-10 g/L) dose-dependently inhibited proliferation of H-4-II-E cells by 11% (P < 0.05) to 85% (P < 0.01) after 6-24 h treatment. Crude LBE at a dose of 5 g/L suppressed cell proliferation of H-4-II-E cells more effectively than crude RGE after 6-24 h incubation (P < 0.01). Crude LBE (2-10 g/L) and RGE (2-5 g/L) also dose-dependently inhibited proliferation of HA22T/VGH cells by 14%-43% (P < 0.01) after 24 h. Crude LBE at a dose of 10 g/L inhibited the proliferation of HA22T/VGH cells more effectively than crude RGE (56.8% ± 1.6% vs 70.3% ± 3.1% of control, P = 0.0003 < 0.01). The apoptotic cells significantly increased in H-4-II-E cells after 24 h treatment with higher doses of crude LBE (2-5 g/L) and RGE (5-10 g/L) (P < 0.01). The expression of p53 protein in H-4-II-E cells was 119% and 143% of the control group compared with the LBE-treated (2, 5 g/L) groups, and 110% and 132% of the control group compared with the RGE -treated (5, 10 g/L) groups after 24 h. CONCLUSION: Hot water-extracted crude LBE (2-5 g/L) and RGE (5-10 g/L) inhibit proliferation and stimulate p53-mediated apoptosis in HCC cells. PMID:16874858
International Nuclear Information System (INIS)
Keefe, D.J.
1980-01-01
An automatically sweeping circuit for searching for an evoked response in an output signal in time with respect to a trigger input is described. Digital counters are used to activate a detector at precise intervals, and monitoring is repeated for statistical accuracy. If the response is not found then a different time window is examined until the signal is found
Automatic program generation: future of software engineering
Energy Technology Data Exchange (ETDEWEB)
Robinson, J.H.
1979-01-01
At this moment software development is still more of an art than an engineering discipline. Each piece of software is lovingly engineered, nurtured, and presented to the world as a tribute to the writer's skill. When will this change. When will the craftsmanship be removed and the programs be turned out like so many automobiles from an assembly line. Sooner or later it will happen: economic necessities will demand it. With the advent of cheap microcomputers and ever more powerful supercomputers doubling capacity, much more software must be produced. The choices are to double the number of programers, double the efficiency of each programer, or find a way to produce the needed software automatically. Producing software automatically is the only logical choice. How will automatic programing come about. Some of the preliminary actions which need to be done and are being done are to encourage programer plagiarism of existing software through public library mechanisms, produce well understood packages such as compiler automatically, develop languages capable of producing software as output, and learn enough about the whole process of programing to be able to automate it. Clearly, the emphasis must not be on efficiency or size, since ever larger and faster hardware is coming.
МЕTHODOLOGICAL APPROACHES TO EVALUATION OF OPERATION OF INNOVATION INFRASTRUCTURE ENTITIES
Directory of Open Access Journals (Sweden)
E. V. Korolyova
2010-01-01
Full Text Available Innovation infrastructure entities (IIEs have become a new social institution which regulates relations between all stakeholders involved in the technology R&D and introduction process and decrease transaction costs on information dissemination and decision-making. While making IIE efficiency evaluation it is necessary to take into account the following: from one side, an influence of the given entity on the activity of scientific and educational institutions, innovative enterprises, investors, and, from the other side, IIE is to be considered as an institution that influences on social and economic and political processes in the country and correspondingly is subjected to reverse influence of some institutions and economic system as a whole.
Automatic sleep scoring: a search for an optimal combination of measures.
Krakovská, Anna; Mezeiová, Kristína
2011-09-01
The objective of this study is to find the best set of characteristics of polysomnographic signals for the automatic classification of sleep stages. A selection was made from 74 measures, including linear spectral measures, interdependency measures, and nonlinear measures of complexity that were computed for the all-night polysomnographic recordings of 20 healthy subjects. The adopted multidimensional analysis involved quadratic discriminant analysis, forward selection procedure, and selection by the best subset procedure. Two situations were considered: the use of four polysomnographic signals (EEG, EMG, EOG, and ECG) and the use of the EEG alone. For the given database, the best automatic sleep classifier achieved approximately an 81% agreement with the hypnograms of experts. The classifier was based on the next 14 features of polysomnographic signals: the ratio of powers in the beta and delta frequency range (EEG, channel C3), the fractal exponent (EMG), the variance (EOG), the absolute power in the sigma 1 band (EEG, C3), the relative power in the delta 2 band (EEG, O2), theta/gamma (EEG, C3), theta/alpha (EEG, O1), sigma/gamma (EEG, C4), the coherence in the delta 1 band (EEG, O1-O2), the entropy (EMG), the absolute theta 2 (EEG, Fp1), theta/alpha (EEG, Fp1), the sigma 2 coherence (EEG, O1-C3), and the zero-crossing rate (ECG); however, even with only four features, we could perform sleep scoring with a 74% accuracy, which is comparable to the inter-rater agreement between two independent specialists. We have shown that 4-14 carefully selected polysomnographic features were sufficient for successful sleep scoring. The efficiency of the corresponding automatic classifiers was verified and conclusively demonstrated on all-night recordings from healthy adults. Copyright © 2011 Elsevier B.V. All rights reserved.
Pellicioli, M.; Ouadi, A.; Marchand, P.; Foehrenbacher, T.; Schuler, J.; Dick-Schuler, N.; Brasse, D.
2017-05-01
The work presented in this paper gathers three main technical developments aiming at 1) optimizing nuclide production by the mean of solid targets 2) automatically transferring coin targets from vault to hotcell without human intervention 3) processing target dilution and purification in hotcell automatically. This system has been installed on a ACSI TR24 cyclotron in Strasbourg France.
Automatic operation device for control rods
International Nuclear Information System (INIS)
Sekimizu, Koichi
1984-01-01
Purpose: To enable automatic operation of control rods based on the reactor operation planning, and particularly, to decrease the operator's load upon start up and shutdown of the reactor. Constitution: Operation plannings, demand for the automatic operation, break point setting value, power and reactor core flow rate change, demand for operation interrupt, demand for restart, demand for forecasting and the like are inputted to an input device, and an overall judging device performs a long-term forecast as far as the break point by a long-term forecasting device based on the operation plannings. The automatic reactor operation or the like is carried out based on the long-term forecasting and the short time forecasting is performed by the change in the reactor core status due to the control rod operation sequence based on the control rod pattern and the operation planning. Then, it is judged if the operation for the intended control rod is possible or not based on the result of the short time forecasting. (Aizawa, K.)
47 CFR 25.281 - Automatic Transmitter Identification System (ATIS).
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Automatic Transmitter Identification System (ATIS). 25.281 Section 25.281 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.281 Automatic Transmitter...
Age Effect on Automatic Inhibitory Function of the Somatosensory and Motor Cortex: An MEG Study
Directory of Open Access Journals (Sweden)
Chia-Hsiung Cheng
2018-03-01
Full Text Available Age-related deficiency in the top-down modulation of cognitive inhibition has been extensively documented, whereas the effects of age on a bottom-up or automatic operation of inhibitory function were less investigated. It is unknown that whether the older adults (OA’ reduced behavioral performance and neural responses are due to the insufficient bottom-up processes. Compared to behavioral assessments which have been widely used to examine the top-down control of response inhibition, electrophysiological recordings are more suitable to probe the early-stage processes of automatic inhibitory function. Sensory gating (SG, a phenomenon of attenuated neural response to the second identical stimulus in a paired-pulse paradigm, is an indicator to assess automatic inhibitory function of the sensory cortex. On the other hand, electricity-induced beta rebound oscillation in a single-pulse paradigm reflects cortical inhibition of the motor cortex. From the neurophysiological perspective, SG and beta rebound oscillation are replicable indicators to examine the automatic inhibitory function of human sensorimotor cortices. Thus, the present study aimed to use a whole-head magnetoencephalography (MEG to investigate the age-related alterations of SG function in the primary somatosensory cortex (SI and of beta rebound oscillation in the primary motor cortex (MI in 17 healthy younger and 15 older adults. The Stimulus 2/Stimulus 1 (S2/S1 amplitude ratio in response to the paired-pulse electrical stimulation to the left median nerve was used to evaluate the automatic inhibitory function of SI, and the beta rebound response in the single-pulse paradigm was used to evaluate the automatic inhibitory function of MI. Although there were no significant age-related differences found in the SI SG ratios, the MI beta rebound power was reduced and peak latency was prolonged in the OA. Furthermore, significant association between the SI SG ratio and the MI beta rebound
Age Effect on Automatic Inhibitory Function of the Somatosensory and Motor Cortex: An MEG Study
Cheng, Chia-Hsiung; Lin, Mei-Yin; Yang, Shiou-Han
2018-01-01
Age-related deficiency in the top-down modulation of cognitive inhibition has been extensively documented, whereas the effects of age on a bottom-up or automatic operation of inhibitory function were less investigated. It is unknown that whether the older adults (OA)’ reduced behavioral performance and neural responses are due to the insufficient bottom-up processes. Compared to behavioral assessments which have been widely used to examine the top-down control of response inhibition, electrophysiological recordings are more suitable to probe the early-stage processes of automatic inhibitory function. Sensory gating (SG), a phenomenon of attenuated neural response to the second identical stimulus in a paired-pulse paradigm, is an indicator to assess automatic inhibitory function of the sensory cortex. On the other hand, electricity-induced beta rebound oscillation in a single-pulse paradigm reflects cortical inhibition of the motor cortex. From the neurophysiological perspective, SG and beta rebound oscillation are replicable indicators to examine the automatic inhibitory function of human sensorimotor cortices. Thus, the present study aimed to use a whole-head magnetoencephalography (MEG) to investigate the age-related alterations of SG function in the primary somatosensory cortex (SI) and of beta rebound oscillation in the primary motor cortex (MI) in 17 healthy younger and 15 older adults. The Stimulus 2/Stimulus 1 (S2/S1) amplitude ratio in response to the paired-pulse electrical stimulation to the left median nerve was used to evaluate the automatic inhibitory function of SI, and the beta rebound response in the single-pulse paradigm was used to evaluate the automatic inhibitory function of MI. Although there were no significant age-related differences found in the SI SG ratios, the MI beta rebound power was reduced and peak latency was prolonged in the OA. Furthermore, significant association between the SI SG ratio and the MI beta rebound power, which was
Automatic Commercial Permit Sets
Energy Technology Data Exchange (ETDEWEB)
Grana, Paul [Folsom Labs, Inc., San Francisco, CA (United States)
2017-12-21
Final report for Folsom Labs’ Solar Permit Generator project, which has successfully completed, resulting in the development and commercialization of a software toolkit within the cloud-based HelioScope software environment that enables solar engineers to automatically generate and manage draft documents for permit submission.
SU-E-T-253: Open-Source Automatic Software for Quantifying Biological Assays of Radiation Effects
International Nuclear Information System (INIS)
Detappe, A; Korideck, H; Makrigiorgos, G; Berbeco, R
2014-01-01
Purpose: Clonogenic cell survival is a common assay for quantifying the effect of drugs and radiation. Manual counting of surviving colonies can take 30–90seconds per plate, a major limitation for large studies. Currently available automatic counting tools are not easily modified for radiation oncology research. Our goal is to provide an open-source toolkit for precise, accurate and fast analysis of biological assays in radiation oncology. Methods: As an example analysis, we used HeLa cells incubated with gadolinium nanoparticles prior to irradiation. After treatment, the cells are grown for 14days to allow for colony formation. To analyze the colony growth, we capture images of each dish for archiving and automatic computer-based analysis. A FujifilmX20 camera is placed at the top of a box setup, 20cm above the sample, which is backlit by a LED lamp placed at the bottom of the box. We use a Gaussian filter (width=1.3mm) and color threshold (19–255). The minimum size for a colony to be counted is 1mm. For this example, 20 dishes with a large range of colonies were analyzed. Each dish was counted 3 times manually by 3 different users and then compared to our counter. Results: Automatic counting of cell colonies takes an average of 7seconds, enabling the analysis process to be accelerated 4–12 times. The average precision of the automatic counter was 1.7%. The Student t-test demonstrated the non-significant differences between the two counting methods (p=0.64). The ICC demonstrated the reliability of each method with ICC>0.999 (automatic) and ICC=0.95 (manual). Conclusion: We developed an open-source automatic toolkit for the analysis of biological assays in radiation oncology and demonstrated the accuracy, precision and effort savings for clonogenic cell survival quantification. This toolkit is currently being used in two laboratories for routine experimental analysis and will be made freely available on our departmental website
The problem of automatic identification of concepts
International Nuclear Information System (INIS)
Andreewsky, Alexandre
1975-11-01
This paper deals with the problem of the automatic recognition of concepts and describes an important language tool, the ''linguistic filter'', which facilitates the construction of statistical algorithms. Certain special filters, of prepositions, conjunctions, negatives, logical implication, compound words, are presented. This is followed by a detailed description of a statistical algorithm allowing recognition of pronoun referents, and finally the problem of the automatic treatment of negatives in French is discussed [fr
Towards automatic verification of ladder logic programs
Zoubek , Bohumir; Roussel , Jean-Marc; Kwiatkowska , Martha
2003-01-01
International audience; Control system programs are usually validated by testing prior to their deployment. Unfortunately, testing is not exhaustive and therefore it is possible that a program which passed all the required tests still contains errors. In this paper we apply techniques of automatic verification to a control program written in ladder logic. A model is constructed mechanically from the ladder logic program and subjected to automatic verification against requirements that include...
Automatic crown cover mapping to improve forest inventory
Claude Vidal; Jean-Guy Boureau; Nicolas Robert; Nicolas Py; Josiane Zerubia; Xavier Descombes; Guillaume Perrin
2009-01-01
To automatically analyze near infrared aerial photographs, the French National Institute for Research in Computer Science and Control developed together with the French National Forest Inventory (NFI) a method for automatic crown cover mapping. This method uses a Reverse Jump Monte Carlo Markov Chain algorithm to locate the crowns and describe those using ellipses or...
Automatic first-break picking using the instantaneous traveltime attribute
Saragiotis, Christos; Alkhalifah, Tariq Ali
2012-01-01
Picking the first breaks is an important step in seismic processing. The large volume of the seismic data calls for automatic and objective picking. We introduce a new automatic first-break picker, which uses specifically designed time windows
Evolutionary game dynamics of controlled and automatic decision-making.
Toupo, Danielle F P; Strogatz, Steven H; Cohen, Jonathan D; Rand, David G
2015-07-01
We integrate dual-process theories of human cognition with evolutionary game theory to study the evolution of automatic and controlled decision-making processes. We introduce a model in which agents who make decisions using either automatic or controlled processing compete with each other for survival. Agents using automatic processing act quickly and so are more likely to acquire resources, but agents using controlled processing are better planners and so make more effective use of the resources they have. Using the replicator equation, we characterize the conditions under which automatic or controlled agents dominate, when coexistence is possible and when bistability occurs. We then extend the replicator equation to consider feedback between the state of the population and the environment. Under conditions in which having a greater proportion of controlled agents either enriches the environment or enhances the competitive advantage of automatic agents, we find that limit cycles can occur, leading to persistent oscillations in the population dynamics. Critically, however, these limit cycles only emerge when feedback occurs on a sufficiently long time scale. Our results shed light on the connection between evolution and human cognition and suggest necessary conditions for the rise and fall of rationality.
Evolutionary game dynamics of controlled and automatic decision-making
Toupo, Danielle F. P.; Strogatz, Steven H.; Cohen, Jonathan D.; Rand, David G.
2015-07-01
We integrate dual-process theories of human cognition with evolutionary game theory to study the evolution of automatic and controlled decision-making processes. We introduce a model in which agents who make decisions using either automatic or controlled processing compete with each other for survival. Agents using automatic processing act quickly and so are more likely to acquire resources, but agents using controlled processing are better planners and so make more effective use of the resources they have. Using the replicator equation, we characterize the conditions under which automatic or controlled agents dominate, when coexistence is possible and when bistability occurs. We then extend the replicator equation to consider feedback between the state of the population and the environment. Under conditions in which having a greater proportion of controlled agents either enriches the environment or enhances the competitive advantage of automatic agents, we find that limit cycles can occur, leading to persistent oscillations in the population dynamics. Critically, however, these limit cycles only emerge when feedback occurs on a sufficiently long time scale. Our results shed light on the connection between evolution and human cognition and suggest necessary conditions for the rise and fall of rationality.
Automatic T1 bladder tumor detection by using wavelet analysis in cystoscopy images
Freitas, Nuno R.; Vieira, Pedro M.; Lima, Estevão; Lima, Carlos S.
2018-02-01
Correct classification of cystoscopy images depends on the interpreter’s experience. Bladder cancer is a common lesion that can only be confirmed by biopsying the tissue, therefore, the automatic identification of tumors plays a significant role in early stage diagnosis and its accuracy. To our best knowledge, the use of white light cystoscopy images for bladder tumor diagnosis has not been reported so far. In this paper, a texture analysis based approach is proposed for bladder tumor diagnosis presuming that tumors change in tissue texture. As is well accepted by the scientific community, texture information is more present in the medium to high frequency range which can be selected by using a discrete wavelet transform (DWT). Tumor enhancement can be improved by using automatic segmentation, since a mixing with normal tissue is avoided under ideal conditions. The segmentation module proposed in this paper takes advantage of the wavelet decomposition tree to discard poor texture information in such a way that both steps of the proposed algorithm segmentation and classification share the same focus on texture. Multilayer perceptron and a support vector machine with a stratified ten-fold cross-validation procedure were used for classification purposes by using the hue-saturation-value (HSV), red-green-blue, and CIELab color spaces. Performances of 91% in sensitivity and 92.9% in specificity were obtained regarding HSV color by using both preprocessing and classification steps based on the DWT. The proposed method can achieve good performance on identifying bladder tumor frames. These promising results open the path towards a deeper study regarding the applicability of this algorithm in computer aided diagnosis.
Advanced computer-controlled automatic alpha-beta air sample counter
International Nuclear Information System (INIS)
Howell, W.P.; Bruinekool, D.J.; Stapleton, E.E.
1983-01-01
An improved computer controlled automatic alpha-beta air sample counter was developed, based upon an earlier automatic air sample counter design. The system consists of an automatic sample changer, an electronic counting system utilizing a large silicon diode detector, a small desk-type microcomputer, a high speed matrix printer, and the necessary data interfaces. The system is operated by commands from the keyboard and programs stored on magnetic tape cassettes. The programs provide for background counting, Chi 2 test, radon subtraction, and sample counting for sample periods of one day to one week. Output data are printed by the matrix printer on standard multifold paper. The data output includes gross beta, gross alpha, and plutonium results. Data are automatically corrected for background, counter efficiency, and in the gross alpha and plutonium channels, for the presence of radon
Cost-benefit analysis of the ATM automatic deposit service
Directory of Open Access Journals (Sweden)
Ivica Županović
2015-03-01
Full Text Available Bankers and other financial experts have analyzed the value of automated teller machines (ATM in terms of growing consumer demand, rising costs of technology development, decreasing profitability and market share. This paper presents a step-by-step cost-benefit analysis of the ATM automatic deposit service. The first step is to determine user attitudes towards using ATM automatic deposit service by using the Technology Acceptance Model (TAM. The second step is to determine location priorities for ATMs that provide automatic deposit services using the Analytic Hierarchy Process (AHP model. The results of the previous steps enable a highly efficient application of cost-benefit analysis for evaluating costs and benefits of automatic deposit services. To understand fully the proposed procedure outside of theoretical terms, a real-world application of a case study is conducted.
A device for automatically recording information on the reasons for idling of stopes
Energy Technology Data Exchange (ETDEWEB)
Dergachev, L G; Kuzoyatov, G I; Tereshchenko, V N
1979-01-01
One substantial reserve for raising production efficiency in the coal industry is reduction of nonproductive time costs. The state of the art of stoping work and design features of stoping equipment and devices for obtaining information do not presently enable complete automation of the process of obtaining data on the reasons for down times. Therefore, together with automatic data formation manual recording of information is required through remote control equipment to the controlling computer directly from the work place. The Donetsk department of the Giprougleavtomatizatsiy institute has developed the UKIP-1 device for automatic recording of information on the reasons for stope down times. The device is designed for use in an automatic process control system of coal mines. It provides coding of information and its conversion to a form suitable for transmission through remote control channels, further processing, and recording. The device enables recording of information on down times of eight objects of the stope. Up to eight down time reasons can be recorded for each object. The device has 2 contact outputs, on one of which is formed an informational sequential eight-bit code; on the other, 8 clock pulses. The device's code is generated automatically, after it is activated by a switch. The length of the code packet results from the maximum possible information transmission rate of the existing mine remote control systems, and equals 12+2 sec. The clock pulse length equals half the length of the information pulse. The device has been tested at coal mines, and recommended for industrial production. UKIP-1 devices are being used in a pilot model of an automatic production control system of the Sotsialisticheskiy Donbass Newspaper mine of the Donetskugol' production association.
Development of automatic techniques for GPS data management
International Nuclear Information System (INIS)
Park, Pil Ho
2001-06-01
It is necessary for GPS center to establish automatization as effective management of GPS network including data gathering, data transformation, data backup, data sending to IGS (International GPS Service for geodynamics), and precise ephemerides gathering. The operating program of GPS center has been adopted at KCSC (Korea Cadastral Survey Corporation), NGI (National Geography Institute), MOMAF (Ministry of Maritime Affairs and Fisheries) without self-development of core technique. The automatic management of GPS network is consists of GPS data management and data processing. It is also fundamental technique, which should be accomplished by every GPS centers. Therefore, this study carried out analyzing of Japanese GPS center, which has accomplished automatization by module considering applicability for domestic GPS centers
Automatic Grasp Generation and Improvement for Industrial Bin-Picking
DEFF Research Database (Denmark)
Kraft, Dirk; Ellekilde, Lars-Peter; Rytz, Jimmy Alison
2014-01-01
and achieve comparable results and that our learning approach can improve system performance significantly. Automatic bin-picking is an important industrial process that can lead to significant savings and potentially keep production in countries with high labour cost rather than outsourcing it. The presented......This paper presents work on automatic grasp generation and grasp learning for reducing the manual setup time and increase grasp success rates within bin-picking applications. We propose an approach that is able to generate good grasps automatically using a dynamic grasp simulator, a newly developed...
Training shortest-path tractography: Automatic learning of spatial priors
DEFF Research Database (Denmark)
Kasenburg, Niklas; Liptrot, Matthew George; Reislev, Nina Linde
2016-01-01
Tractography is the standard tool for automatic delineation of white matter tracts from diffusion weighted images. However, the output of tractography often requires post-processing to remove false positives and ensure a robust delineation of the studied tract, and this demands expert prior...... knowledge. Here we demonstrate how such prior knowledge, or indeed any prior spatial information, can be automatically incorporated into a shortest-path tractography approach to produce more robust results. We describe how such a prior can be automatically generated (learned) from a population, and we...
Analyzing Program Termination and Complexity Automatically with AProVE
DEFF Research Database (Denmark)
Giesl, Jürgen; Aschermann, Cornelius; Brockschmidt, Marc
2017-01-01
In this system description, we present the tool AProVE for automatic termination and complexity proofs of Java, C, Haskell, Prolog, and rewrite systems. In addition to classical term rewrite systems (TRSs), AProVE also supports rewrite systems containing built-in integers (int-TRSs). To analyze...... programs in high-level languages, AProVE automatically converts them to (int-)TRSs. Then, a wide range of techniques is employed to prove termination and to infer complexity bounds for the resulting rewrite systems. The generated proofs can be exported to check their correctness using automatic certifiers...
Freezing of gait in Parkinson’s disease: disturbances in automaticity and control
Directory of Open Access Journals (Sweden)
Jochen eVandenbossche
2013-01-01
Full Text Available Recent studies emphasize a key role of controlled operations, such as set-shifting and inhibition, in the occurrence of freezing of gait (FOG in Parkinson’s disease (PD. However, FOG can also be characterized as a de-automatization disorder, showing impairments in both the execution and acquisition of automaticity. The observed deficits in automaticity and executive functioning indicate that both processes are malfunctioning in freezers. Therefore, to explain FOG from a cognitive-based perspective, we present a model describing the pathways involved in automatic and controlled processes prior to a FOG episode. Crucially, we focus on disturbances in automaticity and control, regulated by the frontostriatal circuitry. In complex situations, non-freezing PD patients may compensate for deficits in automaticity by switching to increased cognitive control. However, as both automatic and controlled processes are more severely impaired in freezers, this hampers cognitive compensation in FOG, resulting in a potential breakdown. Future directions for cognitive rehabilitation are proposed, based on the cognitive model we put forward.
Fully automatic registration and segmentation of first-pass myocardial perfusion MR image sequences.
Gupta, Vikas; Hendriks, Emile A; Milles, Julien; van der Geest, Rob J; Jerosch-Herold, Michael; Reiber, Johan H C; Lelieveldt, Boudewijn P F
2010-11-01
Derivation of diagnostically relevant parameters from first-pass myocardial perfusion magnetic resonance images involves the tedious and time-consuming manual segmentation of the myocardium in a large number of images. To reduce the manual interaction and expedite the perfusion analysis, we propose an automatic registration and segmentation method for the derivation of perfusion linked parameters. A complete automation was accomplished by first registering misaligned images using a method based on independent component analysis, and then using the registered data to automatically segment the myocardium with active appearance models. We used 18 perfusion studies (100 images per study) for validation in which the automatically obtained (AO) contours were compared with expert drawn contours on the basis of point-to-curve error, Dice index, and relative perfusion upslope in the myocardium. Visual inspection revealed successful segmentation in 15 out of 18 studies. Comparison of the AO contours with expert drawn contours yielded 2.23 ± 0.53 mm and 0.91 ± 0.02 as point-to-curve error and Dice index, respectively. The average difference between manually and automatically obtained relative upslope parameters was found to be statistically insignificant (P = .37). Moreover, the analysis time per slice was reduced from 20 minutes (manual) to 1.5 minutes (automatic). We proposed an automatic method that significantly reduced the time required for analysis of first-pass cardiac magnetic resonance perfusion images. The robustness and accuracy of the proposed method were demonstrated by the high spatial correspondence and statistically insignificant difference in perfusion parameters, when AO contours were compared with expert drawn contours. Copyright © 2010 AUR. Published by Elsevier Inc. All rights reserved.
The design of an automatically-tuned beamline
International Nuclear Information System (INIS)
Ball, M.S.; Ellison, T.J.P.; Hamilton, B.J.; Jones, W.P.
1994-01-01
A new 30 m beamline (BL1C) is being assembled to connect the new High Intensity Polarized Ion Source (HIPIOS) to the IUCF cyclotrons. This line is being instrumented for complete automatic optimization of all transverse and longitudinal ion optical elements by providing a unique feedback signal for each controllable device. Transversely, steerers and 4-quadrant electrostatic pickups are located approximately 90 degree apart in betatron phase advance along the beamline. Each pickup is instrumented with a single-board, 4-layer op-amp circuit (BPM system) which measures the beam intensity, horizontal (H) and vertical (V) position, and H and V 10 Hz position modulation. The transverse beam ellipse parameters are first automatically determined at the entrance to the beamline by measuring the beam size using a wire scanner as a function of the strength of a quadrupole. The computer then programs the amplitude and phase of four 10 Hz modulators which vary the current in 4 steerers to move the beam centroid around this (reduced area) ellipse in 4-dimensional phase space. The BPM system then outputs voltages proportional to the beam intensity, centroid location, and envelope. Computer algorithms will then set the steerers and quadrupoles to correct the beam position, dispersion, and envelope. Longitudinally, hardware feedback loops, with a bandwidth adjustable from 10 Hz to 30 kHz, will phase-lock the beam to the two bunching systems; another hardware system will automatically vary the buncher amplitudes to compensate for the significant and varying space charge defocusing as the beam current fluctuates. The bunchers' quiescent phases and amplitudes will be optimized using software ''synchronous detectors.''
Tao, Qian; Ipek, Esra Gucuk; Shahzad, Rahil; Berendsen, Floris F; Nazarian, Saman; van der Geest, Rob J
2016-08-01
To realize objective atrial scar assessment, this study aimed to develop a fully automatic method to segment the left atrium (LA) and pulmonary veins (PV) from late gadolinium-enhanced (LGE) magnetic resonance imaging (MRI). The extent and distribution of atrial scar, visualized by LGE-MRI, provides important information for clinical treatment of atrial fibrillation (AF) patients. Forty-six AF patients (age 62 ± 8, 14 female) who underwent cardiac MRI prior to RF ablation were included. A contrast-enhanced MR angiography (MRA) sequence was acquired for anatomy assessment followed by an LGE sequence for LA scar assessment. A fully automatic segmentation method was proposed consisting of two stages: 1) global segmentation by multiatlas registration; and 2) local refinement by 3D level-set. These automatic segmentation results were compared with manual segmentation. The LA and PVs were automatically segmented in all subjects. Compared with manual segmentation, the method yielded a surface-to-surface distance of 1.49 ± 0.65 mm in the LA region when using both MRA and LGE, and 1.80 ± 0.93 mm when using LGE alone (P automatic and manual segmentation was comparable to the interobserver difference (P = 0.8 in LA region and P = 0.7 in PV region). We developed a fully automatic method for LA and PV segmentation from LGE-MRI, with comparable performance to a human observer. Inclusion of an MRA sequence further improves the segmentation accuracy. The method leads to automatic generation of a patient-specific model, and potentially enables objective atrial scar assessment for AF patients. J. Magn. Reson. Imaging 2016;44:346-354. © 2016 Wiley Periodicals, Inc.
2011-03-15
healthy control participants (5 female) underwent diffusion tensor imaging ( DTI ) on a Siemens 3T MRI scanner. Voxelwise statistical analyses of white...injury). These exploratory analyses suggest that DTI is sensitive to alteration in white matter microstructure after blast mTBI and changes may...2010 a US Marine sustained popliteal artery injuries rendering both legs ischemic. At Camp Bastion (level IIE) flow was restored with temporary
Automatization of the radiation control measurements
International Nuclear Information System (INIS)
Seki, Akio; Ogata, Harumi; Horikoshi, Yoshinori; Shirai, Kenji
1988-01-01
Plutonium Fuel Production Facility (PFPF) was constructed to fabricate the MOX fuels for 'MONJU' and 'JOYO' reactors and to develop the practical fuel fabricating technology. For the fuel fabrication process in this facility, centralized controlling system is being adopted for the mass production of the fuel and reduction of the radiation exposure dose. Also, the radiation control systems are suitable for the large-scale facility and the automatic-remote process of the fuel fabrication. One of the typical radiation control systems is the self moving survey system which has been developed by PNC and adopted for the automatic routine monitoring. (author)
Development of automatic laser welding system
International Nuclear Information System (INIS)
Ohwaki, Katsura
2002-01-01
Laser are a new production tool for high speed and low distortion welding and applications to automatic welding lines are increasing. IHI has long experience of laser processing for the preservation of nuclear power plants, welding of airplane engines and so on. Moreover, YAG laser oscillators and various kinds of hardware have been developed for laser welding and automation. Combining these welding technologies and laser hardware technologies produce the automatic laser welding system. In this paper, the component technologies are described, including combined optics intended to improve welding stability, laser oscillators, monitoring system, seam tracking system and so on. (author)
Automatic programming of grinding robot restoration of contours
Are Willersrud; Fred Godtliebsen; Trygve Thomessen
1995-01-01
A new programming method has been developed for grinding robots. Instead of using the conventional jog-and-teach method, the workpiece contour is automatically tracked by the robot. During the tracking, the robot position is stored in the robot control system every 8th millisecond. After filtering and reducing this contour data, a robot program is automatically generated.
Statistical pattern recognition for automatic writer identification and verification
Bulacu, Marius Lucian
2007-01-01
The thesis addresses the problem of automatic person identification using scanned images of handwriting.Identifying the author of a handwritten sample using automatic image-based methods is an interesting pattern recognition problem with direct applicability in the forensic and historic document
46 CFR 112.01-10 - Automatic emergency lighting and power system.
2010-10-01
... EMERGENCY LIGHTING AND POWER SYSTEMS Definitions of Emergency Lighting and Power Systems § 112.01-10 Automatic emergency lighting and power system. An automatic emergency lighting and power system is one in... 46 Shipping 4 2010-10-01 2010-10-01 false Automatic emergency lighting and power system. 112.01-10...
Automatic motion inhibit system for a nuclear power generating system
International Nuclear Information System (INIS)
Musick, C.R.; Torres, J.M.
1977-01-01
Disclosed is an automatic motion inhibit system for a nuclear power generating system for inhibiting automatic motion of the control elements to reduce reactor power in response to a turbine load reduction. The system generates a final reactor power level setpoint signal which is continuously compared with a reactor power signal. The final reactor power level setpoint is a setpoint within the capacity of the bypass valves to bypass steam which in no event is lower in value than the lower limit of automatic control of the reactor. If the final reactor power level setpoint is greater than the reactor power, an inhibit signal is generated to inhibit automatic control of the reactor. 6 claims, 5 figures
Adapting Mask-RCNN for Automatic Nucleus Segmentation
Johnson, Jeremiah W.
2018-01-01
Automatic segmentation of microscopy images is an important task in medical image processing and analysis. Nucleus detection is an important example of this task. Mask-RCNN is a recently proposed state-of-the-art algorithm for object detection, object localization, and object instance segmentation of natural images. In this paper we demonstrate that Mask-RCNN can be used to perform highly effective and efficient automatic segmentations of a wide range of microscopy images of cell nuclei, for ...
Effect of automatic recirculation flow control on the transient response for Lungmen ABWR plant
Energy Technology Data Exchange (ETDEWEB)
Tzang, Y.-C., E-mail: yctzang@aec.gov.t [National Tsing Hua University, Department of Engineering and System Science, Hsinchu 30013, Taiwan (China); Chiang, R.-F.; Ferng, Y.-M.; Pei, B.-S. [National Tsing Hua University, Department of Engineering and System Science, Hsinchu 30013, Taiwan (China)
2009-12-15
In this study the automatic mode of the recirculation flow control system (RFCS) for the Lungmen ABWR plant has been modeled and incorporated into the basic RETRAN-02 system model. The integrated system model is then used to perform the analyses for the two transients in which the automatic RFCS is involved. The two transients selected are: (1) one reactor internal pump (RIP) trip, and (2) loss of feedwater heating. In general, the integrated system model can predict well the response of key system parameters, including neutron flux, steam dome pressure, heat flux, RIP flow, core inlet flow, feedwater flow, steam flow, and reactor water level. The transients are also analyzed for manual RFCS case, between the automatic RFCS and the manual RFCS cases, comparisons of the transient response for the key system parameter show that the difference of transient response can be clearly identified. Also, the results show that the DELTACPR (delta critical power ratio) for the transients analyzed may not be less limiting for the automatic RFCS case under certain combination of control system settings.
Gao, Weijie; Jin, Yinghui; Wang, Yan; Sun, Mei; Chen, Baoyuan; Zhou, Ning; Deng, Yuan
2012-06-01
It is costly and time-consuming to conduct the standard manual titration to identify an effective pressure before continuous positive airway pressure (CPAP) treatment for obstructive sleep apnea (OSA) patients. Automatic titration is cheaper and more easily available than manual titration. The purpose of this systematic review was to evaluate the effect of automatic titration in identifying a pressure and on the improvement of apnea/hyponea index (AHI) and somnolence, the change of sleep quality, and the acceptance and compliance of CPAP treatment, compared with the manual titration. A systematic search was made of the PubMed, EMBASE, Cochrane Library, SCI, China Academic Journals Full-text Databases, Chinese Biomedical Literature Database, Chinese Scientific Journals Databases and Chinese Medical Association Journals. Randomized controlled trials comparing automatic titration and manual titration were reviewed. Studies were pooled to yield odds ratios (OR) or mean differences (MD) with 95% confidence intervals (CI). Ten trials involving 849 patients met the inclusion criteria. It is hard to identify a trend in the pressures determined by either automatic or manual titration. Automatic titration can improve the AHI (MD = 0.03/h, 95% CI = -4.48 to 4.53) and Epworth sleepiness scale (SMD = -0.02, 95% CI = -0.34 to 0.31,) as effectively as the manual titration. There is no difference between sleep architecture under automatic titration or manual titration. The acceptance of CPAP treatment (OR = 0.96, 95% CI = 0.60 to 1.55) and the compliance with treatment (MD = -0.04, 95% CI = -0.17 to 0.10) after automatic titration is not different from manual titration. Automatic titration is as effective as standard manual titration in improving AHI, somnolence while maintaining sleep quality similar to the standard method. In addition, automatic titration has the same effect on the acceptance and compliance of CPAP treatment as manual titration. With the potential advantage
Towards automatic quantitative analysis of cardiac MR perfusion images
Breeuwer, M.; Quist, M.; Spreeuwers, Lieuwe Jan; Paetsch, I.; Al-Saadi, N.; Nagel, E.
2001-01-01
Magnetic Resonance Imaging (MRI) is a powerful technique for imaging cardiovascular diseases. The introduction of cardiovascular MRI into clinical practice is however hampered by the lack of efficient and reliable automatic image analysis methods. This paper focuses on the automatic evaluation of
Automatic sign language recognition inspired by human sign perception
Ten Holt, G.A.
2010-01-01
Automatic sign language recognition is a relatively new field of research (since ca. 1990). Its objectives are to automatically analyze sign language utterances. There are several issues within the research area that merit investigation: how to capture the utterances (cameras, magnetic sensors,
A model based method for automatic facial expression recognition
Kuilenburg, H. van; Wiering, M.A.; Uyl, M. den
2006-01-01
Automatic facial expression recognition is a research topic with interesting applications in the field of human-computer interaction, psychology and product marketing. The classification accuracy for an automatic system which uses static images as input is however largely limited by the image
Design of a computerized application for the quality control of film automatic processors
International Nuclear Information System (INIS)
Merillas del Castillo, A.; Guibelalde del Castillo, E.; Fernandez Soto, J.M.; Vano carruana, E.
1997-01-01
The description of a free ware software for quality control of film automatic processors in diagnostic radiology developed by the authors is presented (CC-PRO ver 1.0). The application has been developed for using with automatic scanning densitometers, type X-Rite 380, being also able for manual data acquisition. By means of standard sensitometric techniques and the thus developed software, the trend analysis of the sensitometric variables and the film processor diagnostic could be carried out with an important production improvement, easy management and test consistency. (Author) 6 refs
Comparison of manual and automatic MR‐CT registration for radiotherapy of prostate cancer
Carl, Jesper; Østergaard, Lasse Riis
2016-01-01
In image‐guided radiotherapy (IGRT) of prostate cancer, delineation of the clinical target volume (CTV) often relies on magnetic resonance (MR) because of its good soft‐tissue visualization. Registration of MR and computed tomography (CT) is required in order to add this accurate delineation to the dose planning CT. An automatic approach for local MR‐CT registration of the prostate has previously been developed using a voxel property‐based registration as an alternative to a manual landmark‐based registration. The aim of this study is to compare the two registration approaches and to investigate the clinical potential for replacing the manual registration with the automatic registration. Registrations and analysis were performed for 30 prostate cancer patients treated with IGRT using a Ni‐Ti prostate stent as a fiducial marker. The comparison included computing translational and rotational differences between the approaches, visual inspection, and computing the overlap of the CTV. The computed mean translational difference was 1.65, 1.60, and 1.80 mm and the computed mean rotational difference was 1.51°, 3.93°, and 2.09° in the superior/inferior, anterior/posterior, and medial/lateral direction, respectively. The sensitivity of overlap was 87%. The results demonstrate that the automatic registration approach performs registrations comparable to the manual registration. PACS number(s): 87.57.nj, 87.61.‐c, 87.57.Q‐, 87.56.J‐ PMID:27167285
Directory of Open Access Journals (Sweden)
Dong Jiang
Full Text Available Land cover data represent a fundamental data source for various types of scientific research. The classification of land cover based on satellite data is a challenging task, and an efficient classification method is needed. In this study, an automatic scheme is proposed for the classification of land use using multispectral remote sensing images based on change detection and a semi-supervised classifier. The satellite image can be automatically classified using only the prior land cover map and existing images; therefore human involvement is reduced to a minimum, ensuring the operability of the method. The method was tested in the Qingpu District of Shanghai, China. Using Environment Satellite 1(HJ-1 images of 2009 with 30 m spatial resolution, the areas were classified into five main types of land cover based on previous land cover data and spectral features. The results agreed on validation of land cover maps well with a Kappa value of 0.79 and statistical area biases in proportion less than 6%. This study proposed a simple semi-automatic approach for land cover classification by using prior maps with satisfied accuracy, which integrated the accuracy of visual interpretation and performance of automatic classification methods. The method can be used for land cover mapping in areas lacking ground reference information or identifying rapid variation of land cover regions (such as rapid urbanization with convenience.
Automatic creation of simulation configuration. The SIPA workshop: SWORD
International Nuclear Information System (INIS)
Oudot, G.; Valembois, A.
1994-01-01
SWORD (Software Workshop Oriented towards Research and Development) is not only a software management system but also and mainly a software development system. The SWORD workshop is organised in hierarchical levels: (1) the automatic or manual creation of elementary models based on FORTRAN ANSI standard language; these models have interface variables structured in so-called connection points; Automatic model generators are used for the simulation of standard, repeated equipment: HYTHERNET covers the simulation of hydraulic, thermal, chemistry and activity; CONTRONET covers the simulation of I and C system, i.e. logic, protection and control systems; The capture of system topology for both generators is carried out on a graphic workstation under CAD system, (2) The models assembly generator, in charge of linking models (via connection points) and organizing their calling sequence in order to create a simulation application, (3) The configurations in charge of creation of external environment and of links between models assembly and external environment (connection with control desk, plant computer system, safety parameter display etc.), (4) The configuration generator which exports the simulation configuration to the target machine and generates the appropriate command for compilations and link editions; The workshop Administration ensures management, consistency checks are carried out at each step with warnings generated when applicable, and automatic chaining of the appropriate commands according to engineer request are available. (orig.) (4 refs., 4 figs.)
Automatic programming of grinding robot restoration of contours
Directory of Open Access Journals (Sweden)
Are Willersrud
1995-07-01
Full Text Available A new programming method has been developed for grinding robots. Instead of using the conventional jog-and-teach method, the workpiece contour is automatically tracked by the robot. During the tracking, the robot position is stored in the robot control system every 8th millisecond. After filtering and reducing this contour data, a robot program is automatically generated.
DEFF Research Database (Denmark)
Nielsen, F C; Haselbacher, G; Christiansen, Jan
1993-01-01
In the present study we have analysed the expression of insulin-like growth factor II (IGF-II) in the human rhabdomyosarcoma cell line IN157.IN157 cells express high levels of three IGF-II mRNAs of 6.0 kb, 4.8 kb and 4.2 kb. In contrast, normal skeletal muscle expresses a negligible amount of IGF......-II mRNA. Two forms of IGF-II with molecular masses of 7.5 kDa and 10 kDa, corresponding to the mature IGF-II and IGF-II with a C-terminal extension of 21 amino acids (IGF-IIE21), were secreted into the culture medium at amounts of 17 ng/ml (2.3 nM) and 15 ng/ml (1.5 nM), respectively. IN157 cells also......-II and IGF-IIE21 with Kd values of 0.5 nM and 2 nM, respectively, and IGF-I with about 500 times lower affinity. IGF-II and IGF-IIE21 stimulated DNA synthesis via the IGF-I receptor, whereas the IGF-II/Man 6-P receptor mediated their rapid internalization and inactivation. During culture of IN157 cells about...
Osmanoglu, B.; Ozkan, C.; Sunar, F.
2013-10-01
After air strikes on July 14 and 15, 2006 the Jiyeh Power Station started leaking oil into the eastern Mediterranean Sea. The power station is located about 30 km south of Beirut and the slick covered about 170 km of coastline threatening the neighboring countries Turkey and Cyprus. Due to the ongoing conflict between Israel and Lebanon, cleaning efforts could not start immediately resulting in 12 000 to 15 000 tons of fuel oil leaking into the sea. In this paper we compare results from automatic and semi-automatic slick detection algorithms. The automatic detection method combines the probabilities calculated for each pixel from each image to obtain a joint probability, minimizing the adverse effects of atmosphere on oil spill detection. The method can readily utilize X-, C- and L-band data where available. Furthermore wind and wave speed observations can be used for a more accurate analysis. For this study, we utilize Envisat ASAR ScanSAR data. A probability map is generated based on the radar backscatter, effect of wind and dampening value. The semi-automatic algorithm is based on supervised classification. As a classifier, Artificial Neural Network Multilayer Perceptron (ANN MLP) classifier is used since it is more flexible and efficient than conventional maximum likelihood classifier for multisource and multi-temporal data. The learning algorithm for ANN MLP is chosen as the Levenberg-Marquardt (LM). Training and test data for supervised classification are composed from the textural information created from SAR images. This approach is semiautomatic because tuning the parameters of classifier and composing training data need a human interaction. We point out the similarities and differences between the two methods and their results as well as underlining their advantages and disadvantages. Due to the lack of ground truth data, we compare obtained results to each other, as well as other published oil slick area assessments.
Towards unifying inheritance and automatic program specialization
DEFF Research Database (Denmark)
Schultz, Ulrik Pagh
2002-01-01
and specialization of classes (inheritance) are considered different abstractions. We present a new programming language, Lapis, that unifies inheritance and program specialization at the conceptual, syntactic, and semantic levels. This paper presents the initial development of Lapis, which uses inheritance...... with covariant specialization to control the automatic application of program specialization to class members. Lapis integrates object-oriented concepts, block structure, and techniques from automatic program specialization to provide both a language where object-oriented designs can be e#ciently implemented...
Automatic design of magazine covers
Jahanian, Ali; Liu, Jerry; Tretter, Daniel R.; Lin, Qian; Damera-Venkata, Niranjan; O'Brien-Strain, Eamonn; Lee, Seungyon; Fan, Jian; Allebach, Jan P.
2012-03-01
In this paper, we propose a system for automatic design of magazine covers that quantifies a number of concepts from art and aesthetics. Our solution to automatic design of this type of media has been shaped by input from professional designers, magazine art directors and editorial boards, and journalists. Consequently, a number of principles in design and rules in designing magazine covers are delineated. Several techniques are derived and employed in order to quantify and implement these principles and rules in the format of a software framework. At this stage, our framework divides the task of design into three main modules: layout of magazine cover elements, choice of color for masthead and cover lines, and typography of cover lines. Feedback from professional designers on our designs suggests that our results are congruent with their intuition.
Automatic digitization of SMA data
Väänänen, Mika; Tanskanen, Eija
2017-04-01
In the 1970's and 1980's the Scandinavian Magnetometer Array produced large amounts of excellent data from over 30 stations In Norway, Sweden and Finland. 620 film reels and 20 kilometers of film have been preserved and the longest time series produced in the campaign span almost uninterrupted for five years, but the data has never seen widespread use due to the choice of medium. Film is a difficult medium to digitize efficiently. Previously events of interest were searched for by hand and digitization was done by projecting the film on paper and plotting it by hand. We propose a method of automatically digitizing geomagnetic data stored on film and extracting the numerical values from the digitized data. The automatic digitization process helps in preserving old, valuable data that might otherwise go unused.
Physics of Automatic Target Recognition
Sadjadi, Firooz
2007-01-01
Physics of Automatic Target Recognition addresses the fundamental physical bases of sensing, and information extraction in the state-of-the art automatic target recognition field. It explores both passive and active multispectral sensing, polarimetric diversity, complex signature exploitation, sensor and processing adaptation, transformation of electromagnetic and acoustic waves in their interactions with targets, background clutter, transmission media, and sensing elements. The general inverse scattering, and advanced signal processing techniques and scientific evaluation methodologies being used in this multi disciplinary field will be part of this exposition. The issues of modeling of target signatures in various spectral modalities, LADAR, IR, SAR, high resolution radar, acoustic, seismic, visible, hyperspectral, in diverse geometric aspects will be addressed. The methods for signal processing and classification will cover concepts such as sensor adaptive and artificial neural networks, time reversal filt...
Directory of Open Access Journals (Sweden)
Ly John
2012-04-01
Full Text Available Abstract Background Changes in maximum standardised uptake values (SUVmax between serial PET/CT studies are used to determine disease progression or regression in oncologic patients. To measure these changes manually can be time consuming in a clinical routine. A semi-automatic method for calculation of SUVmax in serial PET/CT studies was developed and compared to a conventional manual method. The semi-automatic method first aligns the serial PET/CT studies based on the CT images. Thereafter, the reader selects an abnormal lesion in one of the PET studies. After this manual step, the program automatically detects the corresponding lesion in the other PET study, segments the two lesions and calculates the SUVmax in both studies as well as the difference between the SUVmax values. The results of the semi-automatic analysis were compared to that of a manual SUVmax analysis using a Philips PET/CT workstation. Three readers did the SUVmax readings in both methods. Sixteen patients with lung cancer or lymphoma who had undergone two PET/CT studies were included. There were a total of 26 lesions. Results Linear regression analysis of changes in SUVmax show that intercepts and slopes are close to the line of identity for all readers (reader 1: intercept = 1.02, R2 = 0.96; reader 2: intercept = 0.97, R2 = 0.98; reader 3: intercept = 0.99, R2 = 0.98. Manual and semi-automatic method agreed in all cases whether SUVmax had increased or decreased between the serial studies. The average time to measure SUVmax changes in two serial PET/CT examinations was four to five times longer for the manual method compared to the semi-automatic method for all readers (reader 1: 53.7 vs. 10.5 s; reader 2: 27.3 vs. 6.9 s; reader 3: 47.5 vs. 9.5 s; p Conclusions Good agreement was shown in assessment of SUVmax changes between manual and semi-automatic method. The semi-automatic analysis was four to five times faster to perform than the manual analysis. These findings show the
Sleep-related automatism and the law.
Ebrahim, Irshaad Osman; Fenwick, Peter
2008-04-01
Crimes carried out during or arising from sleep highlight many difficulties with our current law and forensic sleep medicine clinical practice. There is a need for clarity in the law and agreement between experts on a standardised form of assessment and diagnosis in these challenging cases. We suggest that the time has come for a standardised, internationally recognised diagnostic protocol to be set as a minimum standard in all cases of suspected sleep-related forensic cases. The protocol of a full medical history, sleep history, psychiatric history, neuropsychiatric and psychometric examination and electroencephalography (EEG), should be routine. It should now be mandatory to carry out routine polysomnography (PSG) to establish the presence of precipitating and modulating factors. Sleepwalking is classified as insane automatism in England and Wales and sudden arousal from sleep in a non-sleepwalker as sane automatism. The recent case in England of R v. Lowe (2005) highlights these anomalies. Moreover, the word insanity stigmatises sleepwalkers and should be dropped. The simplest solution to these problems would be for the law to be changed so that there is only one category of defence for all sleep-related offences--not guilty by reason of sleep disorder. This was rejected by the House of Lords for cases of automatism due to epilepsy, and is likely to be rejected for sleepwalkers. Removing the categories of automatism (sane or insane) would be the best solution. Risk assessment is already standard practice in the UK and follow up, subsequent to disposal, by approved specialists should become part of the sentencing process. This will provide support for the defendant and protection of the public.
Cliff : the automatized zipper
Baharom, M.Z.; Toeters, M.J.; Delbressine, F.L.M.; Bangaru, C.; Feijs, L.M.G.
2016-01-01
It is our strong believe that fashion - more specifically apparel - can support us so much more in our daily life than it currently does. The Cliff project takes the opportunity to create a generic automatized zipper. It is a response to the struggle by elderly, people with physical disability, and
The Role of Item Models in Automatic Item Generation
Gierl, Mark J.; Lai, Hollis
2012-01-01
Automatic item generation represents a relatively new but rapidly evolving research area where cognitive and psychometric theories are used to produce tests that include items generated using computer technology. Automatic item generation requires two steps. First, test development specialists create item models, which are comparable to templates…
The profitability of automatic milking on Dutch dariy farms
Bijl, R.; Kooistra, S.R.; Hogeveen, H.
2007-01-01
Several studies have reported on the profitability of automatic milking based on different simulation models, but a data-based study using actual farm data has been lacking. The objective of this study was to analyze the profitability of dairy farms having an automatic milking system (AMS) compared
An automatic system for elaboration of chip breaking diagrams
DEFF Research Database (Denmark)
Andreasen, Jan Lasson; De Chiffre, Leonardo
1998-01-01
A laboratory system for fully automatic elaboration of chip breaking diagrams has been developed and tested. The system is based on automatic chip breaking detection by frequency analysis of cutting forces in connection with programming of a CNC-lathe to scan different feeds, speeds and cutting...
Automatic inference of indexing rules for MEDLINE
Directory of Open Access Journals (Sweden)
Shooshan Sonya E
2008-11-01
Full Text Available Abstract Background: Indexing is a crucial step in any information retrieval system. In MEDLINE, a widely used database of the biomedical literature, the indexing process involves the selection of Medical Subject Headings in order to describe the subject matter of articles. The need for automatic tools to assist MEDLINE indexers in this task is growing with the increasing number of publications being added to MEDLINE. Methods: In this paper, we describe the use and the customization of Inductive Logic Programming (ILP to infer indexing rules that may be used to produce automatic indexing recommendations for MEDLINE indexers. Results: Our results show that this original ILP-based approach outperforms manual rules when they exist. In addition, the use of ILP rules also improves the overall performance of the Medical Text Indexer (MTI, a system producing automatic indexing recommendations for MEDLINE. Conclusion: We expect the sets of ILP rules obtained in this experiment to be integrated into MTI.
Automatic control variac system for electronic accelerator
International Nuclear Information System (INIS)
Zhang Shuocheng; Wang Dan; Jing Lan; Qiao Weimin; Ma Yunhai
2006-01-01
An automatic control variac system is designed in order to satisfy the controlling requirement of the electronic accelerator developed by the Institute. Both design and operational principles, structure of the system as well as the software of industrial PC and micro controller unit are described. The interfaces of the control module are RS232 and RS485. A fiber optical interface (FOC) could be set up if an industrial FOC network is necessary, which will extend the filed of its application and make the communication of the system better. It is shown in practice that the system can adjust the variac output voltage automatically and assure the accurate and automatic control of the electronic accelerator. The system is designed in accordance with the general design principles and possesses the merits such as easy operation and maintenance, good expansibility, and low cost, thus it could also be used in other industrial branches. (authors)
Profiling School Shooters: Automatic Text-Based Analysis
Directory of Open Access Journals (Sweden)
Yair eNeuman
2015-06-01
Full Text Available School shooters present a challenge to both forensic psychiatry and law enforcement agencies. The relatively small number of school shooters, their various charateristics, and the lack of in-depth analysis of all of the shooters prior to the shooting add complexity to our understanding of this problem. In this short paper, we introduce a new methodology for automatically profiling school shooters. The methodology involves automatic analysis of texts and the production of several measures relevant for the identification of the shooters. Comparing texts written by six school shooters to 6056 texts written by a comparison group of male subjects, we found that the shooters' texts scored significantly higher on the Narcissistic Personality dimension as well as on the Humilated and Revengeful dimensions. Using a ranking/priorization procedure, similar to the one used for the automatic identification of sexual predators, we provide support for the validity and relevance of the proposed methodology.
International Nuclear Information System (INIS)
Ishii, Hirotake; Yang, Shoufeng; Yan, Weida; Shimoda, Hiroshi; Izumi, Masanori
2009-01-01
In this study, an automatic registration system was developed that can measure 3 dimensional position and orientation of multi-range fiducials automatically using a camera, laser range finder and motion bases connected to a computer. Result of the experimental evaluation shows that the measurement takes about 50 seconds per marker and RMSE (Root Mean Square Error) of the position and orientation measurement are 3.5 mm and 1.2 degrees respectively. (author)
[Development of a Software for Automatically Generated Contours in Eclipse TPS].
Xie, Zhao; Hu, Jinyou; Zou, Lian; Zhang, Weisha; Zou, Yuxin; Luo, Kelin; Liu, Xiangxiang; Yu, Luxin
2015-03-01
The automatic generation of planning targets and auxiliary contours have achieved in Eclipse TPS 11.0. The scripting language autohotkey was used to develop a software for automatically generated contours in Eclipse TPS. This software is named Contour Auto Margin (CAM), which is composed of operational functions of contours, script generated visualization and script file operations. RESULTS Ten cases in different cancers have separately selected, in Eclipse TPS 11.0 scripts generated by the software could not only automatically generate contours but also do contour post-processing. For different cancers, there was no difference between automatically generated contours and manually created contours. The CAM is a user-friendly and powerful software, and can automatically generated contours fast in Eclipse TPS 11.0. With the help of CAM, it greatly save plan preparation time and improve working efficiency of radiation therapy physicists.
ATIPS: Automatic Travel Itinerary Planning System for Domestic Areas
2016-01-01
Leisure travel has become a topic of great interest to Taiwanese residents in recent years. Most residents expect to be able to relax on a vacation during the holidays; however, the complicated procedure of travel itinerary planning is often discouraging and leads them to abandon the idea of traveling. In this paper, we design an automatic travel itinerary planning system for the domestic area (ATIPS) using an algorithm to automatically plan a domestic travel itinerary based on user intentions that allows users to minimize the process of trip planning. Simply by entering the travel time, the departure point, and the destination location, the system can automatically generate a travel itinerary. According to the results of the experiments, 70% of users were satisfied with the result of our system, and 82% of users were satisfied with the automatic user preference learning mechanism of ATIPS. Our algorithm also provides a framework for substituting modules or weights and offers a new method for travel planning. PMID:26839529
An automatic evaluation system for NTA film neutron dosimeters
Müller, R
1999-01-01
At CERN, neutron personal monitoring for over 4000 collaborators is performed with Kodak NTA films, which have been shown to be the most suitable neutron dosimeter in the radiation environment around high-energy accelerators. To overcome the lengthy and strenuous manual scanning process with an optical microscope, an automatic analysis system has been developed. We report on the successful automatic scanning of NTA films irradiated with sup 2 sup 3 sup 8 Pu-Be source neutrons, which results in densely ionised recoil tracks, as well as on the extension of the method to higher energy neutrons causing sparse and fragmentary tracks. The application of the method in routine personal monitoring is discussed. $9 overcome the lengthy and strenuous manual scanning process with an optical microscope, an automatic analysis system has been developed. We report on the successful automatic scanning of NTA films irradiated with /sup 238/Pu-Be source $9 discussed. (10 refs).
ATIPS: Automatic Travel Itinerary Planning System for Domestic Areas
Directory of Open Access Journals (Sweden)
Hsien-Tsung Chang
2016-01-01
Full Text Available Leisure travel has become a topic of great interest to Taiwanese residents in recent years. Most residents expect to be able to relax on a vacation during the holidays; however, the complicated procedure of travel itinerary planning is often discouraging and leads them to abandon the idea of traveling. In this paper, we design an automatic travel itinerary planning system for the domestic area (ATIPS using an algorithm to automatically plan a domestic travel itinerary based on user intentions that allows users to minimize the process of trip planning. Simply by entering the travel time, the departure point, and the destination location, the system can automatically generate a travel itinerary. According to the results of the experiments, 70% of users were satisfied with the result of our system, and 82% of users were satisfied with the automatic user preference learning mechanism of ATIPS. Our algorithm also provides a framework for substituting modules or weights and offers a new method for travel planning.
ATIPS: Automatic Travel Itinerary Planning System for Domestic Areas.
Chang, Hsien-Tsung; Chang, Yi-Ming; Tsai, Meng-Tze
2016-01-01
Leisure travel has become a topic of great interest to Taiwanese residents in recent years. Most residents expect to be able to relax on a vacation during the holidays; however, the complicated procedure of travel itinerary planning is often discouraging and leads them to abandon the idea of traveling. In this paper, we design an automatic travel itinerary planning system for the domestic area (ATIPS) using an algorithm to automatically plan a domestic travel itinerary based on user intentions that allows users to minimize the process of trip planning. Simply by entering the travel time, the departure point, and the destination location, the system can automatically generate a travel itinerary. According to the results of the experiments, 70% of users were satisfied with the result of our system, and 82% of users were satisfied with the automatic user preference learning mechanism of ATIPS. Our algorithm also provides a framework for substituting modules or weights and offers a new method for travel planning.
Automatic evaluation of body-related words among young women: an experimental study
Directory of Open Access Journals (Sweden)
Cranney Jacquelyn
2010-06-01
Full Text Available Abstract Background Previous research has demonstrated that exposure to images depicting the thin female ideal has negative effects on some females' levels of body dissatisfaction. Much of this research, however, has utilised relatively long stimulus exposure times; thereby focusing on effortful and conscious processing of body-related stimuli. Relatively little is known about the nature of females' affective responses to the textual components of body-related stimuli, especially when these stimuli are only briefly encountered. The primary aim of the current research was to determine whether young women automatically evaluate body-related words and whether these responses are associated with body image concerns, including self-reported levels of appearance schematicity, thin internalisation, body dissatisfaction, and dietary restraint. Methods An affective priming task was used to investigate whether females automatically evaluate body-related words, and whether this is associated with self-reported body image concerns. In a within-participants experimental design, the valence congruence of the prime and target pairs was manipulated. Participants selected body words as primes in Experiment 1 (N = 27, while normatively selected body words were primes in Experiment 2 (N = 50. Each prime was presented briefly, followed by a target word which participants judged as "good" or "bad". The dependent variable was response latency to the target. Results Automatic evaluation was evident: responding to congruent pairs was faster than responding to incongruent pairs. Body image concerns were unrelated to automaticity. Conclusions The findings suggest that brief encounters with body words are likely to prompt automatic evaluation in all young women, and that this process proceeds unintentionally and efficiently, without conscious guidance.
Automatic Control of Veno-Venous Extracorporeal Lung Assist.
Kopp, Ruedger; Bensberg, Ralf; Stollenwerk, Andre; Arens, Jutta; Grottke, Oliver; Walter, Marian; Rossaint, Rolf
2016-10-01
Veno-venous extracorporeal lung assist (ECLA) can provide sufficient gas exchange even in most severe cases of acute respiratory distress syndrome. Commercially available systems are manually controlled, although an automatically controlled ECLA could allow individualized and continuous adaption to clinical requirements. Therefore, we developed a demonstrator with an integrated control algorithm to keep continuously measured peripheral oxygen saturation and partial pressure of carbon dioxide constant by automatically adjusting extracorporeal blood and gas flow. The "SmartECLA" system was tested in six animal experiments with increasing pulmonary hypoventilation and hypoxic inspiratory gas mixture to simulate progressive acute respiratory failure. During a cumulative evaluation time of 32 h for all experiments, automatic ECLA control resulted in a peripheral oxygen saturation ≥90% for 98% of the time with the lowest value of 82% for 15 s. Partial pressure of venous carbon dioxide was between 40 and 49 mm Hg for 97% of the time with no value 49 mm Hg. With decreasing inspiratory oxygen concentration, extracorporeal oxygen uptake increased from 68 ± 25 to 154 ± 34 mL/min (P < 0.05), and reducing respiratory rate resulted in increasing extracorporeal carbon dioxide elimination from 71 ± 37 to 92 ± 37 mL/min (P < 0.05). The "SmartECLA" demonstrator allowed reliable automatic control of the extracorporeal circuit. Proof of concept could be demonstrated for this novel automatically controlled veno-venous ECLA circuit. Copyright © 2015 International Center for Artificial Organs and Transplantation and Wiley Periodicals, Inc.
Automatic Control of the Concrete Mixture Homogeneity in Cycling Mixers
Anatoly Fedorovich, Tikhonov; Drozdov, Anatoly
2018-03-01
The article describes the factors affecting the concrete mixture quality related to the moisture content of aggregates, since the effectiveness of the concrete mixture production is largely determined by the availability of quality management tools at all stages of the technological process. It is established that the unaccounted moisture of aggregates adversely affects the concrete mixture homogeneity and, accordingly, the strength of building structures. A new control method and the automatic control system of the concrete mixture homogeneity in the technological process of mixing components have been proposed, since the tasks of providing a concrete mixture are performed by the automatic control system of processing kneading-and-mixing machinery with operational automatic control of homogeneity. Theoretical underpinnings of the control of the mixture homogeneity are presented, which are related to a change in the frequency of vibrodynamic vibrations of the mixer body. The structure of the technical means of the automatic control system for regulating the supply of water is determined depending on the change in the concrete mixture homogeneity during the continuous mixing of components. The following technical means for establishing automatic control have been chosen: vibro-acoustic sensors, remote terminal units, electropneumatic control actuators, etc. To identify the quality indicator of automatic control, the system offers a structure flowchart with transfer functions that determine the ACS operation in transient dynamic mode.
Individual differences in automatic emotion regulation affect the asymmetry of the LPP component.
Directory of Open Access Journals (Sweden)
Jing Zhang
Full Text Available The main goal of this study was to investigate how automatic emotion regulation altered the hemispheric asymmetry of ERPs elicited by emotion processing. We examined the effect of individual differences in automatic emotion regulation on the late positive potential (LPP when participants were viewing blocks of positive high arousal, positive low arousal, negative high arousal and negative low arousal pictures from International affect picture system (IAPS. Two participant groups were categorized by the Emotion Regulation-Implicit Association Test which has been used in previous research to identify two groups of participants with automatic emotion control and with automatic emotion express. The main finding was that automatic emotion express group showed a right dominance of the LPP component at posterior electrodes, especially in high arousal conditions. But no right dominance of the LPP component was observed for automatic emotion control group. We also found the group with automatic emotion control showed no differences in the right posterior LPP amplitude between high- and low-arousal emotion conditions, while the participants with automatic emotion express showed larger LPP amplitude in the right posterior in high-arousal conditions compared to low-arousal conditions. This result suggested that AER (Automatic emotion regulation modulated the hemispheric asymmetry of LPP on posterior electrodes and supported the right hemisphere hypothesis.
Individual differences in automatic emotion regulation affect the asymmetry of the LPP component.
Zhang, Jing; Zhou, Renlai
2014-01-01
The main goal of this study was to investigate how automatic emotion regulation altered the hemispheric asymmetry of ERPs elicited by emotion processing. We examined the effect of individual differences in automatic emotion regulation on the late positive potential (LPP) when participants were viewing blocks of positive high arousal, positive low arousal, negative high arousal and negative low arousal pictures from International affect picture system (IAPS). Two participant groups were categorized by the Emotion Regulation-Implicit Association Test which has been used in previous research to identify two groups of participants with automatic emotion control and with automatic emotion express. The main finding was that automatic emotion express group showed a right dominance of the LPP component at posterior electrodes, especially in high arousal conditions. But no right dominance of the LPP component was observed for automatic emotion control group. We also found the group with automatic emotion control showed no differences in the right posterior LPP amplitude between high- and low-arousal emotion conditions, while the participants with automatic emotion express showed larger LPP amplitude in the right posterior in high-arousal conditions compared to low-arousal conditions. This result suggested that AER (Automatic emotion regulation) modulated the hemispheric asymmetry of LPP on posterior electrodes and supported the right hemisphere hypothesis.
24 CFR 982.455 - Automatic termination of HAP contract.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Automatic termination of HAP contract. 982.455 Section 982.455 Housing and Urban Development Regulations Relating to Housing and Urban... Payments Contract and Owner Responsibility § 982.455 Automatic termination of HAP contract. The HAP...
Automatic incrementalization of Prolog based static analyses
DEFF Research Database (Denmark)
Eichberg, Michael; Kahl, Matthias; Saha, Diptikalyan
2007-01-01
Modem development environments integrate various static analyses into the build process. Analyses that analyze the whole project whenever the project changes are impractical in this context. We present an approach to automatic incrementalization of analyses that are specified as tabled logic...... programs and evaluated using incremental tabled evaluation, a technique for efficiently updating memo tables in response to changes in facts and rules. The approach has been implemented and integrated into the Eclipse IDE. Our measurements show that this technique is effective for automatically...
Forsman, Isabelle
2017-01-01
In this paper a method to automatically generate transition distances for LOD, improving image stability and performance is presented. Three different methods were tested all measuring the change between two level of details using the spatial frequency. The methods were implemented as an optional pre-processing step in order to determine the transition distances from multiple view directions. During run-time both view direction based selection and the furthest distance for each direction was ...
Automatically producing tailored web materials for public administration
Colineau, Nathalie; Paris, Cécile; Vander Linden, Keith
2013-06-01
Public administration organizations commonly produce citizen-focused, informational materials describing public programs and the conditions under which citizens or citizen groups are eligible for these programs. The organizations write these materials for generic audiences because of the excessive human resource costs that would be required to produce personalized materials for everyone. Unfortunately, generic materials tend to be longer and harder to understand than materials tailored for particular citizens. Our work explores the feasibility and effectiveness of automatically producing tailored materials. We have developed an adaptive hypermedia application system that automatically produces tailored informational materials and have evaluated it in a series of studies. The studies demonstrate that: (1) subjects prefer tailored materials over generic materials, even if the tailoring requires answering a set of demographic questions first; (2) tailored materials are more effective at supporting subjects in their task of learning about public programs; and (3) the time required to specify the demographic information on which the tailoring is based does not significantly slow down the subjects in their information seeking task.
Evaluation of automatic image quality assessment in chest CT - A human cadaver study.
Franck, Caro; De Crop, An; De Roo, Bieke; Smeets, Peter; Vergauwen, Merel; Dewaele, Tom; Van Borsel, Mathias; Achten, Eric; Van Hoof, Tom; Bacher, Klaus
2017-04-01
The evaluation of clinical image quality (IQ) is important to optimize CT protocols and to keep patient doses as low as reasonably achievable. Considering the significant amount of effort needed for human observer studies, automatic IQ tools are a promising alternative. The purpose of this study was to evaluate automatic IQ assessment in chest CT using Thiel embalmed cadavers. Chest CT's of Thiel embalmed cadavers were acquired at different exposures. Clinical IQ was determined by performing a visual grading analysis. Physical-technical IQ (noise, contrast-to-noise and contrast-detail) was assessed in a Catphan phantom. Soft and sharp reconstructions were made with filtered back projection and two strengths of iterative reconstruction. In addition to the classical IQ metrics, an automatic algorithm was used to calculate image quality scores (IQs). To be able to compare datasets reconstructed with different kernels, the IQs values were normalized. Good correlations were found between IQs and the measured physical-technical image quality: noise (ρ=-1.00), contrast-to-noise (ρ=1.00) and contrast-detail (ρ=0.96). The correlation coefficients between IQs and the observed clinical image quality of soft and sharp reconstructions were 0.88 and 0.93, respectively. The automatic scoring algorithm is a promising tool for the evaluation of thoracic CT scans in daily clinical practice. It allows monitoring of the image quality of a chest protocol over time, without human intervention. Different reconstruction kernels can be compared after normalization of the IQs. Copyright © 2017 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.
Automation of chromosomes analysis. Automatic system for image processing
International Nuclear Information System (INIS)
Le Go, R.; Cosnac, B. de; Spiwack, A.
1975-01-01
The A.S.T.I. is an automatic system relating to the fast conversational processing of all kinds of images (cells, chromosomes) converted to a numerical data set (120000 points, 16 grey levels stored in a MOS memory) through a fast D.O. analyzer. The system performs automatically the isolation of any individual image, the area and weighted area of which are computed. These results are directly displayed on the command panel and can be transferred to a mini-computer for further computations. A bright spot allows parts of an image to be picked out and the results to be displayed. This study is particularly directed towards automatic karyo-typing [fr
Studies on the calibration of mammography automatic exposure mode with computed radiology
International Nuclear Information System (INIS)
Zhu Hongzhou; Shao Guoliang; Shi Lei; Liu Qing
2010-01-01
Objective: To realize the optimization of image quality and radiation dose by correcting mammography automatic exposure, according to automatic exposure controlled mode of mammography film-screen system. Methods: The film-screen system (28 kV) was applied to perform automatic exposure of plexiglass (40 mm) and get the standard dose of exposure, the exposure mode of CR base on LgM=2.0 was rectified, which was divided into 10 steps. Mammary glands pattern (Fluke NA18-220) were examined with CR (26, 28, and 30 kV) by the automatic exposure mode corrected. The exposure values (mAs) were recorded. CR image was diagnosed and evaluated in double blind way by 4 radiologists according to American Collage of Radiology (ACR) standard. Results: Based on the standard of CR automatic exposure with the dose higher than the traditional exposure of film-screen system, the calibration of mammography automatic exposure was accomplished. The test results of the calibrated mode was better than the scoring system of ACR. Conclusions: Comparative study showed improvement in acquiring high-quality image and reduction of radiation dose. The corrected mammography automatic exposure mode might be a better method for clinical use. (authors)
2013 International Conference on Mechatronics and Automatic Control Systems
2014-01-01
This book examines mechatronics and automatic control systems. The book covers important emerging topics in signal processing, control theory, sensors, mechanic manufacturing systems and automation. The book presents papers from the 2013 International Conference on Mechatronics and Automatic Control Systems held in Hangzhou, China on August 10-11, 2013. .
Automatic coding method of the ACR Code
International Nuclear Information System (INIS)
Park, Kwi Ae; Ihm, Jong Sool; Ahn, Woo Hyun; Baik, Seung Kook; Choi, Han Yong; Kim, Bong Gi
1993-01-01
The authors developed a computer program for automatic coding of ACR(American College of Radiology) code. The automatic coding of the ACR code is essential for computerization of the data in the department of radiology. This program was written in foxbase language and has been used for automatic coding of diagnosis in the Department of Radiology, Wallace Memorial Baptist since May 1992. The ACR dictionary files consisted of 11 files, one for the organ code and the others for the pathology code. The organ code was obtained by typing organ name or code number itself among the upper and lower level codes of the selected one that were simultaneous displayed on the screen. According to the first number of the selected organ code, the corresponding pathology code file was chosen automatically. By the similar fashion of organ code selection, the proper pathologic dode was obtained. An example of obtained ACR code is '131.3661'. This procedure was reproducible regardless of the number of fields of data. Because this program was written in 'User's Defined Function' from, decoding of the stored ACR code was achieved by this same program and incorporation of this program into program in to another data processing was possible. This program had merits of simple operation, accurate and detail coding, and easy adjustment for another program. Therefore, this program can be used for automation of routine work in the department of radiology
Research on automatic correction of electronic beam path for distributed control
International Nuclear Information System (INIS)
Guo Xin; Su Haijun; Li Deming; Wang Shengli; Guo Honglei
2014-01-01
Background: Dynamitron, an electron irradiation accelerator of high-voltage, is used as a radiation source for industrial and agricultural production. The control system is an important component of dynamitron. Purpose: The aim is to improve the control system to meet the performance requirements of dynamitron for the stability. Methods: A distributed control system for the 1.5-MeV dynamitron is proposed to gain better performance. On this basis, an electron beam trajectory automatic correction method based on Cerebellar Model Articulation Controller and Proportional-Integral Derivative (CMAC-PID) controller is designed to improve the function of electron beam extraction system. Results: The distributed control system can meet the control requirements of the accelerator. The stability of the CMAC PID controller is better than that of conventional PID controller for the electron beam trajectory automatic correction system, and hence the CMAC-PID controller can provide better protection of dynamitron when electron beam deflection occurs. Conclusion: The distributed control system and the electron beam trajectory automatic correction method system can effectively improve the performance and reduce the failure probability of the accelerator, thereby enhancing the efficiency of the accelerator. (authors)
Manzke, Robert; Meyer, Carsten; Ecabert, Olivier; Peters, Jochen; Noordhoek, Niels J; Thiagalingam, Aravinda; Reddy, Vivek Y; Chan, Raymond C; Weese, Jürgen
2010-02-01
Since the introduction of 3-D rotational X-ray imaging, protocols for 3-D rotational coronary artery imaging have become widely available in routine clinical practice. Intra-procedural cardiac imaging in a computed tomography (CT)-like fashion has been particularly compelling due to the reduction of clinical overhead and ability to characterize anatomy at the time of intervention. We previously introduced a clinically feasible approach for imaging the left atrium and pulmonary veins (LAPVs) with short contrast bolus injections and scan times of approximately 4 -10 s. The resulting data have sufficient image quality for intra-procedural use during electro-anatomic mapping (EAM) and interventional guidance in atrial fibrillation (AF) ablation procedures. In this paper, we present a novel technique to intra-procedural surface generation which integrates fully-automated segmentation of the LAPVs for guidance in AF ablation interventions. Contrast-enhanced rotational X-ray angiography (3-D RA) acquisitions in combination with filtered-back-projection-based reconstruction allows for volumetric interrogation of LAPV anatomy in near-real-time. An automatic model-based segmentation algorithm allows for fast and accurate LAPV mesh generation despite the challenges posed by image quality; relative to pre-procedural cardiac CT/MR, 3-D RA images suffer from more artifacts and reduced signal-to-noise. We validate our integrated method by comparing 1) automatic and manual segmentations of intra-procedural 3-D RA data, 2) automatic segmentations of intra-procedural 3-D RA and pre-procedural CT/MR data, and 3) intra-procedural EAM point cloud data with automatic segmentations of 3-D RA and CT/MR data. Our validation results for automatically segmented intra-procedural 3-D RA data show average segmentation errors of 1) approximately 1.3 mm compared with manual 3-D RA segmentations 2) approximately 2.3 mm compared with automatic segmentation of pre-procedural CT/MR data and 3
Radio-controlled automatic gas meter-reading system; Releve automatique de compteur par radio
Energy Technology Data Exchange (ETDEWEB)
Yasui, M. [Osaka Gas Co., Ltd (Japan); Ishikawa, K.; Fujiwara, J. [Tokyo Gas Co., Ltd. (Japan); Ichihashi, T. [Toho Gas Co., Ltd. (Japan)
2000-07-01
In Japan, an automatic gas meter-reading system is in operation, also incorporating the functions of monitoring for abnormalities in gas use and remote-controlled emergency gas supply shutoff. This system has been realized by linking microcomputer-controlled gas meters(It's called 'Intelligent gas mater') equipped with automatic shutoff mechanism to the gas utility company operation center via communication lines. While the present system uses cable communication lines, we of Tokyo Gas Co., Ltd., Osaka Gas Co., Ltd. and Toho Gas Co., Ltd., have jointly developed a new system based on radio communication. This paper introduces this new system. While radio-controlled meter-reading systems are used in many countries around the world solely for automatic meter reading, our recently developed system is also capable of monitoring for abnormalities in gas use and remote-controlled emergency gas supply shutoff, thanks to its almost real-time two-way communication function. The new system can serve for a period of ten years without recharging. It is also characterized by its applicability as different systems according to purposes: 1) conventional automatic meter-reading system (terminal network control unit or T-NCU), 2) large-scale radio-controlled meter-reading system, and 3) portable terminal-type radio-controlled meter-reading system. (authors)
On the Relationship Between Automatic Attitudes and Self-Reported Sexual Assault in Men
Widman, Laura; Olson, Michael
2013-01-01
Research and theory suggest rape supportive attitudes are important predictors of sexual assault; yet, to date, rape supportive attitudes have been assessed exclusively through self-report measures that are methodologically and theoretically limited. To address these limitations, the objectives of the current project were to: (1) develop a novel implicit rape attitude assessment that captures automatic attitudes about rape and does not rely on self-reports, and (2) examine the association between automatic rape attitudes and sexual assault perpetration. We predicted that automatic rape attitudes would be a significant unique predictor of sexual assault even when self-reported rape attitudes (i.e., rape myth acceptance and hostility toward women) were controlled. We tested the generalizability of this prediction in two independent samples: a sample of undergraduate college men (n = 75, M age = 19.3 years) and a sample of men from the community (n = 50, M age = 35.9 years). We found the novel implicit rape attitude assessment was significantly associated with the frequency of sexual assault perpetration in both samples and contributed unique variance in explaining sexual assault beyond rape myth acceptance and hostility toward women. We discuss the ways in which future research on automatic rape attitudes may significantly advance measurement and theory aimed at understanding and preventing sexual assault. PMID:22618119
Automatic dam concrete placing system; Dam concrete dasetsu sagyo no jidoka system
Energy Technology Data Exchange (ETDEWEB)
Yoneda, Y; Hori, Y; Nakayama, T; Yoshihara, K; Hironaka, T [Okumura Corp., Osaka (Japan)
1994-11-15
An automatic concrete placing system was developed for concrete dam construction. This system consists of the following five subsystems: a wireless data transmission system, an automatic dam concrete mixing system, a consistency determination system, an automatic dam concrete loading and transporting system, and a remote concrete bucket opening and closing system. The system includes the following features: mixing amount by mixing ratio and mixing intervals can be instructed from a concrete placing site by using a wireless handy terminal; concrete is mixed automatically in a batcher plant; a transfer car is started, and concrete is charged into a bucket automatically; the mixed concrete is determined of its properties automatically; labor cost can be reduced, the work efficiency improved, and the safety enhanced; and the system introduction has resulted in unattended operation from the aggregate draw-out to a bunker line, manpower saving of five persons, and reduction in cycle time by 10%. 11 figs., 2 tabs.
Does automatic transmission improve driving behavior in older drivers?
Selander, Helena; Bolin, Ingrid; Falkmer, Torbjörn
2012-01-01
Most older drivers continue to drive as they age. To maintain safe and independent transport, mobility is important for all individuals, but especially for older drivers. The objective of this study was to investigate whether automatic transmission, compared with manual transmission, may improve the driving behavior of older drivers. In total, 31 older drivers (mean age 75.2 years) and 32 younger drivers - used as a control group (mean age 39.2 years) - were assessed twice on the same fixed route; once in a car with manual transmission and once in a car with automatic transmission. The cars were otherwise identical. The driving behavior was assessed with the Ryd On-Road Assessment driving protocol. Time to completion of left turns (right-hand side driving) and the impact of a distraction task were measured. The older group had more driving errors than the younger group, in both the manual and the automatic transmission car. However, and contrary to the younger drivers, automatic transmission improved the older participants' driving behavior as demonstrated by safer speed adjustment in urban areas, greater maneuvering skills, safer lane position and driving in accordance with the speed regulations. Switching to automatic transmission may be recommended for older drivers as a means to maintain safe driving and thereby the quality of their transport mobility. Copyright © 2011 S. Karger AG, Basel.
Energy Technology Data Exchange (ETDEWEB)
Buerke, Boris; Puesken, Michael; Heindel, Walter; Wessling, Johannes (Dept. of Clinical Radiology, Univ. of Muenster (Germany)), email: buerkeb@uni-muenster.de; Gerss, Joachim (Dept. of Medical Informatics and Biomathematics, Univ. of Muenster (Germany)); Weckesser, Matthias (Dept. of Nuclear Medicine, Univ. of Muenster (Germany))
2011-06-15
Background Volumetry of lymph nodes potentially better reflect asymmetric size alterations independently of lymph node orientation in comparison to metric parameters (e.g. long-axis diameter). Purpose To distinguish between benign and malignant lymph nodes by comparing 2D and semi-automatic 3D measurements in MSCT. Material and Methods FDG-18 PET-CT was performed in 33 patients prior to therapy for malignant melanoma at stage III/IV. One hundred and eighty-six cervico-axillary, abdominal and inguinal lymph nodes were evaluated independently by two radiologists, both manually and with the use of semi-automatic segmentation software. Long axis (LAD), short axis (SAD), maximal 3D diameter, volume and elongation were obtained. PET-CT, PET-CT follow-up and/or histology served as a combined reference standard. Statistics encompassed intra-class correlation coefficients and ROC curves. Results Compared to manual assessment, semi-automatic inter-observer variability was found to be lower, e.g. at 2.4% (95% CI 0.05-4.8) for LAD. The standard of reference revealed metastases in 90 (48%) of 186 lymph nodes. Semi-automatic prediction of lymph node metastases revealed highest areas under the ROC curves for volume (reader 1 0.77, 95%CI 0.64-0.90; reader 2 0.76, 95%CI 0.59-0.86) and SAD (reader 1 0.76, 95%CI 0.64-0.88; reader 2 0.75, 95%CI 0.62-0.89). The findings for LAD (reader 1 0.73, 95%CI 0.60-0.86; reader 2 0.71, 95%CI 0.71, 95%CI 0.57-0.85) and maximal 3D diameter (reader 1 0.70, 95%CI 0.53-0.86; reader 2 0.76, 95%CI 0.50-0.80) were found substantially lower and for elongation (reader 1 0.65, 95%CI 0.50-0.79; reader 2 0.66, 95%CI 0.52-0.81) significantly lower (p < 0.05). Conclusion Semi-automatic analysis of lymph nodes in malignant melanoma is supported by high segmentation quality and reproducibility. As compared to established SAD, semi-automatic lymph node volumetry does not have an additive role for categorizing lymph nodes as normal or metastatic in malignant
[An automatic system controlled by microcontroller for carotid sinus perfusion].
Yi, X L; Wang, M Y; Fan, Z Z; He, R R
2001-08-01
To establish a new method for controlling automatically the carotid perfusion pressure. A cheap practical automatic perfusion unit based on AT89C2051 micro controller was designed. The unit, LDB-M perfusion pump and the carotid sinus of an animal constituted an automatic perfusion system. This system was able to provide ramp and stepwise updown perfusion pattern and has been used in the research of baroreflex. It can insure the precision and reproducibility of perfusion pressure curve, and improve the technical level in corresponding medical field.
Experiences in automatic keywording of particle physics literature
Montejo Ráez, Arturo
2001-01-01
Attributing keywords can assist in the classification and retrieval of documents in the particle physics literature. As information services face a future with less available manpower and more and more documents being written, the possibility of keyword attribution being assisted by automatic classification software is explored. A project being carried out at CERN (the European Laboratory for Particle Physics) for the development and integration of automatic keywording is described.