WorldWideScience

Sample records for alloy-l-605

  1. MRI-compatible Nb–60Ta–2Zr alloy used for vascular stents: Haemocompatibility and its correlation with protein adsorption

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiu-Mei [School of Stomatology, China Medical University, 117 Nanjing North Street, Shenyang 110002 (China); Li, Hui-Zhe; Wang, Shao-Ping [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Huang, Hsun-Miao; Huang, Her-Hsiung [Biomaterials and Electrochemistry Lab, Department of Dentistry, National Yang-Ming University, Taipei City 112, Taiwan (China); Ai, Hong-Jun, E-mail: aih0620@yahoo.com.cn [School of Stomatology, China Medical University, 117 Nanjing North Street, Shenyang 110002 (China); Xu, Jian, E-mail: jianxu@imr.ac.cn [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China)

    2014-09-01

    Nb–60Ta–2Zr is a newly developed MRI-compatible alloy used for vascular stents. In this work, its haemocompatibility was investigated, including platelet adhesion (lactate dehydrogenase activity), platelet activation (P-selectin expression), coagulation and haemolysis. For comparison, parallel assessments for these factors were performed for the niobium, tantalum, 316L stainless steel (316L SS) and L605 Co–Cr alloy (L605). In addition, albumin and fibrinogen were selected to examine the correlation of protein adsorption with platelet adhesion and metal surface properties. The propensity for platelet adhesion and activation on the Nb–60Ta–2Zr alloy was at nearly the same level as that for Nb and Ta but was slightly less than those of 316L SS and L605. The mitigated platelet adhesion and activation of the Nb–60Ta–2Zr alloy is associated with its decreased adsorption of fibrinogen. The Nb–60Ta–2Zr alloy has a longer clotting time and exhibits significantly superior thromboresistance than 316L SS and L605. Moreover, the haemolysis rate of the Nb–60Ta–2Zr alloy satisfies the bio-safety requirement of the ISO 10993–4 standard. The favourable haemocompatiblity of the Nb–60Ta–2Zr alloy provides evidence of its good biocompatibility and of its suitability as a candidate stent material. - Highlights: • The Nb–60Ta–2Zr alloy is less hydrophobic than the 316L SS and L605 alloy. • The Nb–60Ta–2Zr has slightly weak propensity for platelet adhesion and activation. • The Nb–60Ta–2Zr alloy results in a longer clotting time. • Haemolysis of Nb–60Ta–2Zr is slightly lower than that of 316L SS and L605. • The Nb–60Ta–2Zr alloy is a promising MRI-compatible stent material.

  2. In vitro study of stimulation effect on endothelialization by a copper bearing cobalt alloy.

    Science.gov (United States)

    Jin, Shujing; Qi, Xun; Wang, Tongmin; Ren, Ling; Yang, Ke; Zhong, Hongshan

    2018-02-01

    Endothelialization is an important process after stenting in coronary artery. Recovery of the injured site timely can reduce the neointima formation and platelet absorbance, leading to a lower risk of in-stent restenosis. Copper is known to be critical in vascular construction. Thus a combination of copper with stent materials is a meaningful attempt. A copper bearing L605-Cu cobalt alloy was prepared and its effect on human umbilical vein endothelial cells (HUVECs) was evaluated in vitro in this study. It was found that HUVECs attached and stretched better on the surface of L605-Cu compared with L605, and the apoptosis of cells was decreased simultaneously. The migration and tube formation of HUVECs were also enhanced by the extract of L605-Cu. Furthermore, L605-Cu increased the mRNA expression of VEGF in HUVECs significantly. However it had no effect on the secretion of NO or mRNA expression of eNOS. The result of blood clotting test indicated that L605-Cu had better blood compatibility. These results above have demonstrated that the L605-Cu alloy is promising to be a new stent material with function of accelerating endothelialization. © 2017 Wiley Periodicals, Inc. J Biomed Mater Res Part A: 106A: 561-569, 2018. © 2017 Wiley Periodicals, Inc.

  3. Modeling and optimization of process variables of wire-cut electric discharge machining of super alloy Udimet-L605

    Directory of Open Access Journals (Sweden)

    Somvir Singh Nain

    2017-02-01

    Full Text Available This paper presents the behavior of Udimet-L605 after wire electric discharge machining and evaluating the WEDM process using sophisticated machine learning approaches. The experimental work is depicted on the basis of Taguchi orthogonal L27 array, considering six input variables and three interactions. Three models such as support vector machine algorithms based on PUK kernel, non-linear regression and multi-linear regression have been proposed to examine the variance between experimental and predicted outcome and preferred the preeminent model based on its evaluation parameters performance and graph analysis. The grey relational analysis is the relevant approach to obtain the best grouping of input variables for maximum material removal rate and minimum surface roughness. Based on statistical analysis, it has been concluded that pulse-on time, interaction between pulse-on time x pulse-off time, spark-gap voltage and wire tension are the momentous variable for surface roughness while the pulse-on time, spark-gap voltage and pulse-off time are the momentous variables for material removal rate. The micro structural and compositional changes on the surface of work material were examined by means of SEM and EDX analysis. The thickness of the white layer and the recast layer formation increases with increases in the pulse-on time duration.

  4. Stress corrosion cracking of several high strength ferrous and nickel alloys

    Science.gov (United States)

    Nelson, E. E.

    1971-01-01

    The stress corrosion cracking resistance of several high strength ferrous and nickel base alloys has been determined in a sodium chloride solution. Results indicate that under these test conditions Multiphase MP35N, Unitemp L605, Inconel 718, Carpenter 20Cb and 20Cb-3 are highly resistant to stress corrosion cracking. AISI 410 and 431 stainless steels, 18 Ni maraging steel (250 grade) and AISI 4130 steel are susceptible to stress corrosion cracking under some conditions.

  5. Electronic structures of the L-cysteine film on dental alloys

    International Nuclear Information System (INIS)

    Ogawa, K.; Tsujibayashi, T.; Takahashi, K.; Azuma, J.; Kakimoto, K.; Kamada, M.

    2011-01-01

    Research highlights: → The electronic structures of dental alloys and L-cysteine film were studied by PES. → The density of states in the dental alloy originates from Au and Cu as constituents. → The Cu-3d states contribute dominantly to the occupied states near the Fermi level. → The electronic structure of L-cysteine thin film is different from the thick film. → The bonding between Cu-3d and S-3sp states are formed at the interface. - Abstract: Metal-organic interfaces have been attracting continuous attention in many fields including basic biosciences. The surface of dental alloys could be one of such interfaces since they are used in a circumstance full of organic compounds such as proteins and bacteria. In this work, electronic structures of Au-dominant dental alloys, which have Ag and Cu besides Au, and those of L-cysteine on the dental alloys have been studied by photoelectron spectroscopy with synchrotron radiation. It was found that the density of states in the dental alloy originate from gold and copper as constituents, and the Cu-3d states contribute dominantly to the occupied states near the Fermi level. It was also found that the electronic structure of the L-cysteine thin film on the dental alloy is different from that of the L-cysteine thick film. The result indicates the formation of the orbital bonding between Cu-3d and S-3sp states in the thin film on the dental alloy.

  6. Electronic structures of the L-cysteine film on dental alloys

    Energy Technology Data Exchange (ETDEWEB)

    Ogawa, K., E-mail: e7141@cc.saga-u.ac.jp [Synchrotron Light Application Center, Saga University, Saga 840-8502 (Japan); Tsujibayashi, T. [Department of Physics, Osaka Dental University, Osaka 573-1121 (Japan); Takahashi, K.; Azuma, J. [Synchrotron Light Application Center, Saga University, Saga 840-8502 (Japan); Kakimoto, K. [Department of Geriatric Dentistry, Osaka Dental University, Osaka 573-1121 (Japan); Kamada, M. [Synchrotron Light Application Center, Saga University, Saga 840-8502 (Japan)

    2011-04-15

    Research highlights: {yields} The electronic structures of dental alloys and L-cysteine film were studied by PES. {yields} The density of states in the dental alloy originates from Au and Cu as constituents. {yields} The Cu-3d states contribute dominantly to the occupied states near the Fermi level. {yields} The electronic structure of L-cysteine thin film is different from the thick film. {yields} The bonding between Cu-3d and S-3sp states are formed at the interface. - Abstract: Metal-organic interfaces have been attracting continuous attention in many fields including basic biosciences. The surface of dental alloys could be one of such interfaces since they are used in a circumstance full of organic compounds such as proteins and bacteria. In this work, electronic structures of Au-dominant dental alloys, which have Ag and Cu besides Au, and those of L-cysteine on the dental alloys have been studied by photoelectron spectroscopy with synchrotron radiation. It was found that the density of states in the dental alloy originate from gold and copper as constituents, and the Cu-3d states contribute dominantly to the occupied states near the Fermi level. It was also found that the electronic structure of the L-cysteine thin film on the dental alloy is different from that of the L-cysteine thick film. The result indicates the formation of the orbital bonding between Cu-3d and S-3sp states in the thin film on the dental alloy.

  7. Changes In Mechanical Properties Of Heat Resisting Alloy For A Satellite Propulsion System After A Nitriding Process

    Science.gov (United States)

    Kagawa, Hideshi; Fujii, Go; Kajiwara, Kenichi; Kuroda, Daisuke; Suzuki, Takuya; Yamabe-Mitarai, Yoko; Murakami, Hideyuki; Ono, Yoshinori

    2012-07-01

    Haynes25 (L-605) is a common heat resistant alloy used in mono-propellant structures and screen materials for catalyst beds. The lifetime requirements for thrusters have expanded dramatically after studies conducted in the 1970s on mono-propellant materials used to extend the service life. The material design had long remained unchanged, and the L-605 was still used as thruster material due to its good heritage. However, some important incidents involving degradation were found during the test-unit break-up inspection following the thruster life tests. The Japanese research team focused on the L-605 degradations found on the catalyst bed screen mesh used for mono-propellant thruster and analysed the surface of the wire material and the cross- section of the wire screen mesh used in the life tests. The investigation showed that the degradation was caused by nitriding L-605 component elements. The team suggested that the brittle fracture was attributable to tungsten (W) carbides, which formed primarily in the grain boundaries, and chromium (Cr) nitride, which formed mainly in the parts in contact with the hot firing gas. The team also suggested the installation of a platinum coating on the material surface as a countermeasure L-605 nitric degradation. Inconel 625 is now selected as a mono-propellant structure material due to its marginal raw material characters and cost. The team believes that Inconel 625 does not form W carbides since it contains no tungsten component, but does contain Cr and Fe, which form nitrides easily. Therefore, the team agreed that for the Inconel 625, there was a need to evaluate changes in the microstructure and mechanical properties following exposure to hot nitrogen gases. This paper will describe these changes of Inconel 625.

  8. 48 CFR 605.502 - Authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 605.502 Section 605.502 Federal Acquisition Regulations System DEPARTMENT OF STATE COMPETITION AND ACQUISITION PLANNING PUBLICIZING CONTRACT ACTIONS Paid Advertisements 605.502 Authority. (a) For paid advertisements in...

  9. 44 CFR 17.605 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 17.605 Section 17.605 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY GENERAL GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) § 17.605 Definitions...

  10. 24 CFR 200.605 - Authority.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Authority. 200.605 Section 200.605... GENERAL INTRODUCTION TO FHA PROGRAMS Affirmative Fair Housing Marketing Regulations § 200.605 Authority. The regulations in this subpart are issued pursuant to the authority to issue regulations granted to...

  11. 45 CFR 605.45 - Housing.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Housing. 605.45 Section 605.45 Public Welfare... § 605.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide comparable, convenient, and accessible housing to handicapped students at...

  12. 34 CFR 84.605 - Award.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Award. 84.605 Section 84.605 Education Office of the Secretary, Department of Education GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 84.605 Award. Award means an award of financial assistance by the Department of Education or...

  13. 45 CFR 605.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... OF HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 605.1 Purpose. The purpose of this part is to effectuate section 504 of the Rehabilitation Act of 1973... 45 Public Welfare 3 2010-10-01 2010-10-01 false Purpose. 605.1 Section 605.1 Public Welfare...

  14. 38 CFR 60.5 - Travel.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Travel. 60.5 Section 60.5... TEMPORARY LODGING § 60.5 Travel. As a condition for receiving temporary lodging under this part, a veteran must be required to travel either 50 or more miles, or at least two hours from his or her home to the...

  15. 10 CFR 605.18 - National security.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false National security. 605.18 Section 605.18 Energy DEPARTMENT... PROGRAM § 605.18 National security. Activities under ER's Financial Assistance Program shall not involve classified information (i.e., Restricted Data, formerly Restricted Data, National Security Information...

  16. 41 CFR 105-74.605 - Award.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Award. 105-74.605 Section 105-74.605 Public Contracts and Property Management Federal Property Management Regulations System...-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 105-74.605 Award. Award...

  17. 45 CFR 605.21 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Discrimination prohibited. 605.21 Section 605.21... Accessibility § 605.21 Discrimination prohibited. No qualified handicapped person shall, because a recipient's... from participation in, or otherwise be subjected to discrimination under any program or activity to...

  18. 45 CFR 605.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Discrimination prohibited. 605.4 Section 605.4... Provisions § 605.4 Discrimination prohibited. (a) General. No qualified handicapped person shall, on the... subjected to discrimination under any program or activity which receives Federal financial assistance. (b...

  19. 14 CFR 29.605 - Fabrication methods.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fabrication methods. 29.605 Section 29.605... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction General § 29.605 Fabrication methods. (a) The methods of fabrication used must produce consistently sound structures. If a fabrication process...

  20. 45 CFR 605.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Discrimination prohibited. 605.11 Section 605.11... Employment Practices § 605.11 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  1. 14 CFR 27.605 - Fabrication methods.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fabrication methods. 27.605 Section 27.605... STANDARDS: NORMAL CATEGORY ROTORCRAFT Design and Construction General § 27.605 Fabrication methods. (a) The methods of fabrication used must produce consistently sound structures. If a fabrication process (such as...

  2. 14 CFR 25.605 - Fabrication methods.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fabrication methods. 25.605 Section 25.605... STANDARDS: TRANSPORT CATEGORY AIRPLANES Design and Construction General § 25.605 Fabrication methods. (a) The methods of fabrication used must produce a consistently sound structure. If a fabrication process...

  3. 45 CFR 605.39 - Private education.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Private education. 605.39 Section 605.39 Public..., Elementary, and Secondary Education § 605.39 Private education. (a) A recipient that provides private elementary or secondary education may not, on the basis of handicap, exclude a qualified handicapped person...

  4. 45 CFR 605.22 - Existing facilities.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Existing facilities. 605.22 Section 605.22 Public... Accessibility § 605.22 Existing facilities. (a) Accessibility. A recipient shall operate each program or... existing facilities or every part of a facility accessible to and usable by qualified handicapped persons...

  5. 10 CFR 605.13 - Cost sharing.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Cost sharing. 605.13 Section 605.13 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS THE OFFICE OF ENERGY RESEARCH FINANCIAL ASSISTANCE PROGRAM § 605.13 Cost sharing. Cost sharing is not required nor will it be considered as a criterion in the...

  6. 14 CFR 121.605 - Airplane equipment.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane equipment. 121.605 Section 121.605..., FLAG, AND SUPPLEMENTAL OPERATIONS Dispatching and Flight Release Rules § 121.605 Airplane equipment. No person may dispatch or release an airplane unless it is airworthy and is equipped as prescribed in § 121...

  7. 45 CFR 605.23 - New construction.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false New construction. 605.23 Section 605.23 Public... Accessibility § 605.23 New construction. (a) Design and construction. Each facility or part of a facility... persons, if the construction was commenced after the effective date of this part. (b) Alteration. Each...

  8. 46 CFR 154.605 - Toughness test.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Toughness test. 154.605 Section 154.605 Shipping COAST....605 Toughness test. (a) Each toughness test under §§ 154.610 through 154.625 must meet Subpart 54.05 of this chapter. (b) If subsize test specimens are used for the Charpy V-notch toughness test, the...

  9. 46 CFR 169.605 - General.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false General. 169.605 Section 169.605 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Machinery and Electrical... engine cooling water temperature, exhaust cooling water temperature and engine lubricating oil pressure...

  10. 49 CFR 605.11 - Exemptions.

    Science.gov (United States)

    2010-10-01

    ...) That private school bus operators in the urban area are unable to provide adequate transportation, at a... 49 Transportation 7 2010-10-01 2010-10-01 false Exemptions. 605.11 Section 605.11 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF...

  11. 12 CFR 308.605 - Application for reinstatement.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Application for reinstatement. 308.605 Section 308.605 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE RULES... Services § 308.605 Application for reinstatement. (a) Form of petition. Unless otherwise ordered by the...

  12. 10 CFR 605.16 - Indirect cost limitations.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Indirect cost limitations. 605.16 Section 605.16 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS THE OFFICE OF ENERGY RESEARCH FINANCIAL ASSISTANCE PROGRAM § 605.16 Indirect cost limitations. Awards issued under this part for conferences and scientific...

  13. 49 CFR 178.605 - Hydrostatic pressure test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrostatic pressure test. 178.605 Section 178.605... Testing of Non-bulk Packagings and Packages § 178.605 Hydrostatic pressure test. (a) General. The hydrostatic pressure test must be conducted for the qualification of all metal, plastic, and composite...

  14. 40 CFR 80.605 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false [Reserved] 80.605 Section 80.605 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA...

  15. 12 CFR 411.605 - Inspector General report.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Inspector General report. 411.605 Section 411.605 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Agency Reports § 411.605 Inspector General report. (a) The Inspector General, or other official as specified in...

  16. 24 CFR 1003.605 - Environment.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Environment. 1003.605 Section 1003... § 1003.605 Environment. (a) In order to assure that the policies of the National Environmental Policy Act... grantee shall comply with the Environment Review Procedures for Entities Assuming HUD Environmental...

  17. 25 CFR 162.605 - Negotiation of leases.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Negotiation of leases. 162.605 Section 162.605 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER LEASES AND PERMITS Non-Agricultural Leases § 162.605 Negotiation of leases. (a) Leases of individually owned land or tribal land may be negotiated by those owners or their...

  18. Dicty_cDB: SHL605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL605 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) SHL605F 632 - - - - - - Show SHL605 Library SH (Link to library) Clone ID SHL605 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...VDLIRGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQK LTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICT...KRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL RPAFPKLREKLDDPE

  19. 22 CFR 513.605 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Definitions. 513.605 Section 513.605 Foreign... does not include workers not on the payroll of the grantee (e.g., volunteers, even if used to meet a... instead of money, or other assistance in the form of loans, loan guarantees, interest subsidies, insurance...

  20. Effect on strength of ternary alloying additions in L12 intermetallics

    International Nuclear Information System (INIS)

    Wu Yuanpang.

    1991-01-01

    The thermodynamic properties of {111} antiphase boundaries (APBs) as well as the site preference of ternary additions in an A 3 B intermetallic with L1 2 structure are studied, using a thermodynamic model. A survey of the results from a variety of ternary alloying additions to Ni 3 Al has shown that there is a conflict in the actual role which solid solution strengthening plays in the athermal increment of yield strength. For instance, a good quantitative agreement with linear concentration law is observed only in alloys with stoichiometric compositions but not in the general case of non-stoichiometric alloys. In the light of the possibility that micro-segregation could explain the experimental discrepancy, the author extends the binary solid solution strengthening theory to the ternary system in an L1 2 structure for the four real systems of Ni-Al-Si, Ni-Al-Ti, Ni-Al-Hf, and Ni-Al-V. It is found that ternary site preference plays an important role in the ternary solid solution strengthening theory with L1 2 structure. Good quantitative agreement was found between the calculated and experimentally measured strength for both stoichiometric and nonstoichiometric alloys

  1. 45 CFR 605.38 - Preschool and adult education.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Preschool and adult education. 605.38 Section 605... Preschool, Elementary, and Secondary Education § 605.38 Preschool and adult education. A recipient to which this subpart applies that provides preschool education or day care or adult education may not, on the...

  2. 24 CFR 891.605 - Replacement reserve.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Replacement reserve. 891.605... 8 Assistance § 891.605 Replacement reserve. (a) Establishment of reserve. The Borrower shall establish and maintain a replacement reserve to aid in funding extraordinary maintenance, and repair and...

  3. 45 CFR 605.53 - Drug and alcohol addicts.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Drug and alcohol addicts. 605.53 Section 605.53..., Welfare, and Social Services § 605.53 Drug and alcohol addicts. A recipient to which this subpart applies... against a drug or alcohol abuser or alcoholic who is suffering from a medical condition, because of the...

  4. Experimental and theoretical investigation on corrosion inhibition of AA5052 aluminium alloy by L-cysteine in alkaline solution

    International Nuclear Information System (INIS)

    Wang, Dapeng; Gao, Lixin; Zhang, Daquan; Yang, Dong; Wang, Hongxia; Lin, Tong

    2016-01-01

    The corrosion inhibition of L-cysteine on AA5052 aluminium alloy in 4 mol/L NaOH solution was investigated by hydrogen gas evolution experiment, polarisation curve, galvanostatic discharge, electrochemical impedance spectroscopy measurements and quantum chemical calculations. The adsorption of L-cysteine on aluminium alloy surface obeyed the amended Langmuir's adsorption isotherm. The polarisation curves indicated that L-cysteine acted as a cathodic inhibitor to inhibit cathodic reaction. The inhibition mechanism was dominated by the geometric covering effect. The galvanostatic discharge shows that the additives restrain the hydrogen evolution and increase the anodic utilization rate. Quantum chemical calculations indicated that L-cysteine molecules mainly interacted with on the carboxyl groups on the aluminium alloy surface. A strong hybridization occurred between the s-orbital and p-orbital of reactive sites in the L-cysteine molecule and the sp-orbital of Aluminium. - Highlights: • L-cysteine was used as corrosion inhibitor for Al alloy in alkaline solution. • Adsorption of L-cysteine on Al alloy surface obeyed the amended Langmuir's isotherm. • L-cysteine molecules interacted with the carboxyl groups on the Al alloy surface. • A strong orbital hybridization occurred between the reactive sites in L-cysteine and Al.

  5. 48 CFR 32.605 - Final decisions.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS CONTRACT FINANCING Contract Debts 32.605 Final decisions. (a) The contracting officer shall issue a final decision as required by 33.211 if— (1) The contracting officer and the contractor are unable... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Final decisions. 32.605...

  6. Electronic structure of the L-cysteine films on dental alloys studied by ultraviolet photoelectron spectroscopy

    International Nuclear Information System (INIS)

    Ogawa, K; Takahashi, K; Azuma, J; Kamada, M; Tsujibayashi, T; Ichimiya, M

    2013-01-01

    The valence electronic structures of the dental alloys, type 1, type 3, K14, and MC12 and their interaction with L-cysteine have been studied by ultraviolet photoelectron spectroscopy with synchrotron radiation. It was found that the electronic structures of the type-1 and type-3 dental alloys are similar to that of polycrystalline Au, while that of the K14 dental alloy is much affected by Cu. The electronic states of the MC12 dental alloy originate dominantly from Cu 3d states and Pd 4d states around the top of the valence bands, while the 4∼7-eV electronic structure of MC12 originates from the Ag 4d states. The peak shift and the change in shape due to alloying are observed in all the dental alloys. For the L-cysteine thin films, new peak or structure observed around 2 eV on all the dental alloys is suggested to be due to the bonding of S 3sp orbitals with the dental alloy surfaces. The Cu-S bond as well as the Au-S and Au-O bonds may cause the change in the electronic structure of the L-cysteine on type 1, type 3 and K14. For MC12, the interaction with L-cysteine may be dominantly due to the Pd-S, Cu-S, and Ag-O bonds, while the contribution of the Ag-S bond is small.

  7. Influence of MAO Treatment on the Galvanic Corrosion Between Aluminum Alloy and 316L Steel

    Science.gov (United States)

    Yang, Yuanhang; Gu, Yanhong; Zhang, Lei; Jiao, Xiangdong; Che, Juntie

    2017-12-01

    To slow down the galvanic corrosion of aluminum alloy and 316L stainless steel in subsea water, a micro-arc oxidation (MAO) coating was prepared on the surface of the Al alloy, and no treatment was performed on the surface of the 316L. The surface morphology of MAO-coated Al alloy was evaluated using a scanning electron microscope (SEM) before and after corrosion. A micro-hardness tester was used to measure the micro-hardness. Corrosion behaviors were evaluated by open-circuit potential (OCP), potentiodynamic polarization (PDP) and electrode impedance spectroscopy (EIS) tests in a 3.5 g/L NaCl solution. The results of PDP testing show that the corrosion potential of the MAO-coated galvanic pair was more positive than that of the uncoated galvanic pair and that the corrosion current density was smaller than that of the uncoated galvanic pair. EIS results show that the impedance of the galvanic pair increased after MAO coating. SEM images show that the corrosion damage of the uncoated Al alloy was more severe than that of the MAO-coated one, and the post-corrosion images of the surface of the 316L connected with MAO-coated Al alloy were more compact than those of the 316L connected with uncoated Al alloy. A physical model was developed to discuss the influence of MAO treatment on the galvanic corrosion process and corrosion mechanism.

  8. Experimental and theoretical investigation on corrosion inhibition of AA5052 aluminium alloy by L-cysteine in alkaline solution

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Dapeng; Gao, Lixin [School of Environmental and Chemical Engineering, Shanghai University of Electric Power, Shanghai 200090 (China); Zhang, Daquan, E-mail: zhangdaquan@shiep.edu.cn [School of Environmental and Chemical Engineering, Shanghai University of Electric Power, Shanghai 200090 (China); Yang, Dong [School of Environmental and Chemical Engineering, Shanghai University of Electric Power, Shanghai 200090 (China); Wang, Hongxia; Lin, Tong [Institute for Frontier Materials, Deakin University, Geelong, VIC 3216 (Australia)

    2016-02-01

    The corrosion inhibition of L-cysteine on AA5052 aluminium alloy in 4 mol/L NaOH solution was investigated by hydrogen gas evolution experiment, polarisation curve, galvanostatic discharge, electrochemical impedance spectroscopy measurements and quantum chemical calculations. The adsorption of L-cysteine on aluminium alloy surface obeyed the amended Langmuir's adsorption isotherm. The polarisation curves indicated that L-cysteine acted as a cathodic inhibitor to inhibit cathodic reaction. The inhibition mechanism was dominated by the geometric covering effect. The galvanostatic discharge shows that the additives restrain the hydrogen evolution and increase the anodic utilization rate. Quantum chemical calculations indicated that L-cysteine molecules mainly interacted with on the carboxyl groups on the aluminium alloy surface. A strong hybridization occurred between the s-orbital and p-orbital of reactive sites in the L-cysteine molecule and the sp-orbital of Aluminium. - Highlights: • L-cysteine was used as corrosion inhibitor for Al alloy in alkaline solution. • Adsorption of L-cysteine on Al alloy surface obeyed the amended Langmuir's isotherm. • L-cysteine molecules interacted with the carboxyl groups on the Al alloy surface. • A strong orbital hybridization occurred between the reactive sites in L-cysteine and Al.

  9. L-J phase in a Cu2.2Mn0.8Al alloy

    Science.gov (United States)

    Jeng, S. C.; Liu, T. F.

    1995-06-01

    A new type of precipitate (designated L-J phase) with two variants was observed within the (DO3 + L21) matrix in a Cu2.2Mn0.8Al alloy. Transmission electron microscopy examinations indicated that the L-J phase has an orthorhombic structure with lattice parameters a = 0.413 nm, b = 0.254 nm and c = 0.728 nm. The orientation relationship between the L-J phase and the matrix is (100)L-J//(011) m , (010)L-J//(111) m and (001)L-J//(211) m . The rotation axis and rotation angle between two variants of the L-J phase are [021] and 90 deg. The L-J phase has never been observed in various Cu-Al, Cu-Mn, and Cu-Al-Mn alloy systems before.

  10. 14 CFR 23.605 - Fabrication methods.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fabrication methods. 23.605 Section 23.605... Fabrication methods. (a) The methods of fabrication used must produce consistently sound structures. If a... fabrication method must be substantiated by a test program. [Doc. No. 4080, 29 FR 17955, Dec. 18, 1964; 30 FR...

  11. 29 CFR 780.605 - Employment in agriculture.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Employment in agriculture. 780.605 Section 780.605 Labor... POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS EXEMPTIONS APPLICABLE TO AGRICULTURE... Agriculture and Livestock Auction Operations Under the Section 13(b)(13) Exemption Requirements for Exemption...

  12. Characterization of dissimilar welding: carbon steel E309L-E308L-ERNiCr3-ENiCrFe3 alloy 600

    International Nuclear Information System (INIS)

    Mucino G, O.

    2015-01-01

    Most BWR type reactors have internal support components, which need to be attached to the inner surface by welding. Specifically, in these joints two materials interact, such as stainless steel and nickel base alloys. Nickel base alloys such as alloy 82 (ERNiCr3) and alloy 182 (ENiCrFe-3) are used for the joining of both dissimilar materials. For joints made with both nickel base alloys, the alloy 182 is prone to stress corrosion cracking (SCC); so it is essential to carry out studies related to this contribution material. In the nuclear industry any study related to this alloy is of importance because experience is gained in its behavior when is part of a system of an operation reactor. This work presents the characterization of the weld deposit of a stainless steel coating (with electrodes E309L and E308L) on a carbon steel plate type A36 and the joining with an Inconel 600 plate, simulating the joining of the internal coating of vessel and the heel of the support leg of the envelope of a BWR reactor. In this work, the mechanical and micro-structural characterization of the alloy deposit 182 was performed. (Author)

  13. Photoelectron spectroscopic study on the electronic structures of the dental gold alloys and their interaction with L-cysteine

    International Nuclear Information System (INIS)

    Ogawa, Koji; Takahashi, Kazutoshi; Azuma, Junpei; Kamada, Masao; Tsujibayashi, Toru; Ichimiya, Masayoshi; Fujimoto, Hitoshi; Sumimoto, Michinori

    2011-01-01

    The valence electronic structures of the dental gold alloys, type 1, type 3, and K14, and their interaction with L-cysteine have been studied by ultraviolet photoelectron spectroscopy with synchrotron radiation. It was found that the electronic structures of the type-1 and type-3 dental alloys are similar to that of polycrystalline Au, while that of the K14 dental alloy is much affected by Cu. The peak shift and the change in shape due to alloying are observed in all the dental alloys. It is suggested that the new peak observed around 2 eV for the L-cysteine thin films on all the dental alloys may be due to the bonding of S 3sp orbitals with the dental alloy surfaces, and the Cu-S bond, as well as the Au-S and Au-O bonds, may cause the change in the electronic structure of the L-cysteine on the alloys.

  14. 48 CFR 25.605 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 25.605 Section 25.605 Federal Acquisition Regulations System FEDERAL... American Act-Construction Materials 25.605 Evaluating offers of foreign construction material. (a) If the... evaluation factors to the offer incorporating the use of such foreign construction material as follows: (1...

  15. 14 CFR 60.5 - Quality management system.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Quality management system. 60.5 Section 60... requirement of this chapter unless the sponsor has established and follows a quality management system (QMS...) AIRMEN FLIGHT SIMULATION TRAINING DEVICE INITIAL AND CONTINUING QUALIFICATION AND USE § 60.5 Quality...

  16. L10 ordered structures in Al-Cu-(Mg) alloys at the early stages of elevated temperature aging

    Energy Technology Data Exchange (ETDEWEB)

    Fuzhong, X.; Mingpu, W.

    2016-07-01

    This study concerns the precipitation structures of Al-3Cu and Al-3Cu-1.78Mg (wt. %) alloys at the early stages of elevated temperature aging. The Al-3Cu and Al-3Cu-1.78 Mg alloys were solution treated at 540 °C and 500 °C for 2 h, respectively, and then aged at 190 °C for 2 min. The precipitation structures in aged Al-3Cu-(1.78Mg) alloys were characterized by Transmission Electron Microscopy (TEM) and High Resolution Transmission Electron Microscopy (HTREM). 001 zone axis Selected area electron diffraction patterns indicate that L10 ordered structures are formed in the two aged alloys. HRTEM experiments reveal the partial dislocations on the interfaces of L10 ordered structures. From comparing experimental results with that in the literature, it is concluded that the L10 ordered structures in aged Al-3Cu alloy consist of Al and Cu atoms, and they are comprised by Al, Cu and Mg atoms together in the aged Al-3Cu-1.78Mg alloy. On the basis of precipitate growing thermodynamics, it is thought the L10 ordered structures act as nuclei for GP zones in Al-Cu-(Mg) alloys during aging. (Author)

  17. L10 ordered structures in Al-Cu-(Mg) alloys at the early stages of elevated temperature aging

    International Nuclear Information System (INIS)

    Fuzhong, X.; Mingpu, W.

    2016-01-01

    This study concerns the precipitation structures of Al-3Cu and Al-3Cu-1.78Mg (wt. %) alloys at the early stages of elevated temperature aging. The Al-3Cu and Al-3Cu-1.78 Mg alloys were solution treated at 540 °C and 500 °C for 2 h, respectively, and then aged at 190 °C for 2 min. The precipitation structures in aged Al-3Cu-(1.78Mg) alloys were characterized by Transmission Electron Microscopy (TEM) and High Resolution Transmission Electron Microscopy (HTREM). 001 zone axis Selected area electron diffraction patterns indicate that L10 ordered structures are formed in the two aged alloys. HRTEM experiments reveal the partial dislocations on the interfaces of L10 ordered structures. From comparing experimental results with that in the literature, it is concluded that the L10 ordered structures in aged Al-3Cu alloy consist of Al and Cu atoms, and they are comprised by Al, Cu and Mg atoms together in the aged Al-3Cu-1.78Mg alloy. On the basis of precipitate growing thermodynamics, it is thought the L10 ordered structures act as nuclei for GP zones in Al-Cu-(Mg) alloys during aging. (Author)

  18. 5 CFR 841.605 - Interest included in the unexpended balance.

    Science.gov (United States)

    2010-01-01

    ... balance. 841.605 Section 841.605 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL... Interest § 841.605 Interest included in the unexpended balance. (a) Interest on each Individual Retirement Record is computed separately. (b) For determining the amount of interest in the unexpended balance when...

  19. First-principles study of L10 Ti-Al and V-Al alloys

    International Nuclear Information System (INIS)

    Chubb, S.R.; Papaconstantopoulos, D.A.; Klein, B.M.

    1988-01-01

    As a first step towards understanding the reduced embrittlement of L1 0 Ti-Al alloys which accompanies the introduction of small concentrations of V, we have determined from first principles, using full-potential linearized--augmented-plane-wave calculations, the equilibrium values of the structural parameters and the associated electronic structure for the stoichiometric (L1 0 ) Ti-Al (tetragonal) compound. Our calculated values of c/a and a are in good agreement with experiment. Using the same method of calculation, we have also studied the electronic structure associated with the (hypothetical) L1 0 V-Al alloy that would form when V is substituted for Ti. We find that (1) the electronic structures of these V-Al alloys are relatively insensitive to variations of c/a and a; (2) near the Ti-Al equilibrium geometry, the electronic structures of the V-Al and Ti-Al alloys are very similar; and (3) that a rigid-band model involving substitution of V for Ti can be used to gain a qualitative understanding of the reduction in c/a which accompanies the introduction of small concentrations of V. We relate the reduction in c/a to important changes in the bonding that accompany the occupation of bands immediately above the Fermi level of the stoichiometric Ti-Al compound

  20. 48 CFR 436.605 - Government cost estimate for architect-engineer work.

    Science.gov (United States)

    2010-10-01

    ... for architect-engineer work. 436.605 Section 436.605 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Service 436.605 Government cost estimate for architect-engineer work. The contracting...

  1. 48 CFR 1336.605 - Government cost estimate for architect-engineer work.

    Science.gov (United States)

    2010-10-01

    ... for architect-engineer work. 1336.605 Section 1336.605 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 1336.605 Government cost estimate for architect-engineer work. After award, the...

  2. Size-confined fixed-composition and composition-dependent engineered band gap alloying induces different internal structures in L-cysteine-capped alloyed quaternary CdZnTeS quantum dots

    Science.gov (United States)

    Adegoke, Oluwasesan; Park, Enoch Y.

    2016-06-01

    The development of alloyed quantum dot (QD) nanocrystals with attractive optical properties for a wide array of chemical and biological applications is a growing research field. In this work, size-tunable engineered band gap composition-dependent alloying and fixed-composition alloying were employed to fabricate new L-cysteine-capped alloyed quaternary CdZnTeS QDs exhibiting different internal structures. Lattice parameters simulated based on powder X-ray diffraction (PXRD) revealed the internal structure of the composition-dependent alloyed CdxZnyTeS QDs to have a gradient nature, whereas the fixed-composition alloyed QDs exhibited a homogenous internal structure. Transmission electron microscopy (TEM) and dynamic light scattering (DLS) analysis confirmed the size-confined nature and monodispersity of the alloyed nanocrystals. The zeta potential values were within the accepted range of colloidal stability. Circular dichroism (CD) analysis showed that the surface-capped L-cysteine ligand induced electronic and conformational chiroptical changes in the alloyed nanocrystals. The photoluminescence (PL) quantum yield (QY) values of the gradient alloyed QDs were 27-61%, whereas for the homogenous alloyed QDs, the PL QY values were spectacularly high (72-93%). Our work demonstrates that engineered fixed alloying produces homogenous QD nanocrystals with higher PL QY than composition-dependent alloying.

  3. 48 CFR 736.605 - Government cost estimate for architect-engineer work.

    Science.gov (United States)

    2010-10-01

    ... for architect-engineer work. 736.605 Section 736.605 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Architect-Engineer Services 736.605 Government cost estimate for architect-engineer work. See 736.602-3(c)(5). ...

  4. 45 CFR 605.33 - Free appropriate public education.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Free appropriate public education. 605.33 Section... Preschool, Elementary, and Secondary Education § 605.33 Free appropriate public education. (a) General. A recipient that operates a public elementary or secondary education program shall provide a free appropriate...

  5. Phase transformation and hardness of SS 316 L steel cast alloy after heat treatment at high temperature

    International Nuclear Information System (INIS)

    Hidayat, S.; Prayitno, D. H.

    2000-01-01

    Heat treatment Study of SS 316 L cast alloy at high temperature was conducted. The alloy of SS 316 L was melted by arc melting furnace in argon atmosphere. Heat treatment of SS 316 L casting alloy was carried out in tube furnace at 1400 o C for period of 1/2, 1, and 2 hours. The optical microscopic characterization showed that SS 316 L cast has got dendritic micro structure with ferrite as the primary phase. After the heat treatment, the ferrite phase underwent gradual decrease followed by an increase of the austenite phase. The heat treatment process also resulted in the formation of the new grain boundary. The hardness examination revealed that for longer period of the heat treatment, the hardness of SS 316 L increased. (author)

  6. 42 CFR 50.605 - Management of conflicting interests.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Management of conflicting interests. 50.605 Section... PHS Funding Is Sought § 50.605 Management of conflicting interests. (a) The designated official(s) must: Review all financial disclosures; and determine whether a conflict of interest exists and, if so...

  7. 10 CFR 835.605 - Labeling items and containers.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Labeling items and containers. 835.605 Section 835.605... items and containers. Except as provided at § 835.606, each item or container of radioactive material... information to permit individuals handling, using, or working in the vicinity of the items or containers to...

  8. Wear and Corrosion Properties of 316L-SiC Composite Coating Deposited by Cold Spray on Magnesium Alloy

    Science.gov (United States)

    Chen, Jie; Ma, Bing; Liu, Guang; Song, Hui; Wu, Jinming; Cui, Lang; Zheng, Ziyun

    2017-08-01

    In order to improve the wear and corrosion resistance of commonly used magnesium alloys, 316L stainless steel coating and 316L-SiC composite coating have been deposited directly on commercial AZ80 magnesium alloy using cold spraying technology (CS). The microstructure, hardness and bonding strength of as-sprayed coatings were studied. Their tribological properties sliding against Si3N4 and GCr15 steel under unlubricated conditions were evaluated by a ball-on-disk tribometer. Corrosion behaviors of coated samples were also evaluated and compared to that of uncoated magnesium alloy substrate in 3.5 wt.% NaCl solution by electrochemical measurements. Scanning electron microscopy was used to characterize the corresponding wear tracks and corroded surfaces to determine wear and corrosion mechanisms. The results showed that the as-sprayed coatings possessed higher microhardness and more excellent wear resistance than magnesium alloy substrate. Meanwhile, 316L and 316L-SiC coating also reduced the corrosion current density of magnesium alloy and the galvanic corrosion of the substrates was not observed after 200-h neutral salt spray exposure, which demonstrated that corrosion resistance of a magnesium alloy substrate could be greatly improved by cold-sprayed stainless steel-based coatings.

  9. L1{sub 0} phase formation in ternary FePdNi alloys

    Energy Technology Data Exchange (ETDEWEB)

    Montes-Arango, A.M. [Department of Mechanical and Industrial Engineering, Northeastern University, Boston, MA 02115 (United States); Bordeaux, N.C. [Department of Chemical Engineering, Northeastern University, Boston, MA 02115 (United States); Liu, J.; Barmak, K. [Department of Applied Physics and Applied Mathematics, Columbia University, New York, NY 10027 (United States); Lewis, L.H., E-mail: lhlewis@neu.edu [Department of Mechanical and Industrial Engineering, Northeastern University, Boston, MA 02115 (United States); Department of Chemical Engineering, Northeastern University, Boston, MA 02115 (United States)

    2015-11-05

    Metallurgical routes to highly metastable phases are required to access new materials with new functionalities. To this end, the stability of the tetragonal chemically ordered L1{sub 0} phase in the ternary Fe–Pd–Ni system is quantified to provide enabling information concerning synthesis of L1{sub 0}-type FeNi, a highly attractive yet highly elusive advanced permanent magnet candidate. Fe{sub 50}Pd{sub 50−x}Ni{sub x} (x = 0–7 at%) samples were arc-melted and annealed at 773 K (500 °C) for 100 h to induce formation of the chemically ordered L1{sub 0} phase. Coupled calorimetry, structural and magnetic investigations allow determination of an isothermal section of the ternary Fe–Pd–Ni phase diagram featuring a single phase L1{sub 0} region near the FePd boundary for x < 6 at%. It is demonstrated that increased Ni content in Fe{sub 50}Pd{sub 50−x}Ni{sub x} alloys systematically decreases the order-disorder transition temperature, resulting in a lower thermodynamic driving force for the ordering phase transformation. The Fe{sub 50}Pd{sub 50−x}Ni{sub x} L1{sub 0} → fcc disordering transformation is determined to occur via a two-step process, with compositionally-dependent enthalpies and transition temperatures. These results highlight the need to investigate ternary alloys with higher Ni content to determine the stability range of the L1{sub 0} phase near the FeNi boundary, thereby facilitating kinetic access to the important L1{sub 0} FeNi ferromagnetic phase. - Highlights: • Chemical ordering in FePdNi enhances intrinsic and extrinsic magnetic properties. • 773 K annealed FePdNi alloys studied show a stable L1{sub 0} phase for Ni ≤ 5.2 at%. • Chemical disordering in FePdNi occurs by a previously unreported two-step process. • Ni additions to FePd dramatically decrease the chemical order-disorder temperature. • The chemical-ordering transformation kinetics are greatly affected by Ni content.

  10. 45 CFR 60.5 - When information must be reported.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false When information must be reported. 60.5 Section 60.5 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION NATIONAL PRACTITIONER DATA BANK FOR ADVERSE INFORMATION ON PHYSICIANS AND OTHER HEALTH CARE PRACTITIONERS Reporting of...

  11. Measurement of carbon activity in sodium by Fe-Mn 20% alloy, and by strainless austenitic steel 304L and 316L

    International Nuclear Information System (INIS)

    Oberlin, C.; Saint Paul, P.; Baque, P.; Champeix, L.

    1980-01-01

    Precise knowledge of carbon activity in sodium used as coolant in fast breeder reactors, is essential for continuous survey of carburization-decarburization processes. Carbon activity can be periodically surveyed by measuring the carbon concentration or by hot trap like metal alloy strip placed in sodium loop. In fact, in equilibrium, activity of carbon in sodium is equal to the activity in metal alloy. Thus if the relation between concentration of carbon and it activity in the alloy is known, it is possible to estimate the activity of carbon in sodium. Materials to be used should have high solubility in carbon at the needed temperature. They should quickly attain equilibrium with sodium and they should not contain impurities that can affect the results. Materials chosen according to these criteria were Fe-Mn 20%, stainless austenitic steel AISI 304L and 316L

  12. Cyclic creep-rupture behavior of three high-temperature alloys.

    Science.gov (United States)

    Halford, G. R.

    1972-01-01

    Study of some important characteristics of the cyclic creep-rupture curves for the titanium alloy 6Al-2Sn-4Zr-2Mo at 900 and 1100 F (755 and 865 K), the cobalt-base alloy L-605 at 1180 F (910 K), and for two hardness levels of 316 stainless steel at 1300 F (980 K). The cyclic creep-rupture curve relates tensile stress and tensile time-to-rupture for strain-limited cyclic loading and has been found to be independent of the total strain range and the level of compressive stress employed in the cyclic creep-rupture tests. The cyclic creep-rupture curve was always found to be above and to the right of the conventional (constant load) monotonic creep-rupture curve by factors ranging from 2 to 10 in time-to-rupture. This factor tends to be greatest when the creep ductility is large. Cyclic creep acceleration was observed in every cyclic creep-rupture test conducted. The phenomenon was most pronounced at the highest stress levels and when the tensile and compressive stresses were completely reversed. In general, creep rates were found to be lower in compression than in tension for equal true stresses. The differences, however, were strongly material-dependent.

  13. Effect of filler metals and heat treatment on mechanical properties of welded joints of the VT20L and VT6L titanium cast alloys

    International Nuclear Information System (INIS)

    Abramova, V.N.; Polyakov, D.A.; Vas'kin, Yu.V.; Kulikov, F.R.; Prostov, I.A.; Yasinskij, K.K.

    1979-01-01

    Developed is a technology of welding and heat treatment of the VT20L and VT6L alloys, providing the mechanical properties of welds on the base metal level. It is found, that for residual stress relieving it is quite enough to anneal the alloys at 650 deg C. Welding of the investigated alloys up to 20 mm thick using SPT-2 additional wire provides the welded joint strength on a level of 0.8 σsub(u) of base metal. Usage of additional wire of base metal provides equal strength of welds and base metal

  14. 20 CFR 628.605 - Eligibility.

    Science.gov (United States)

    2010-04-01

    ... THE JOB TRAINING PARTNERSHIP ACT The Adult Program § 628.605 Eligibility. (a) Age and economic disadvantage. Except as provided in paragraph (b) of this section, an individual shall be eligible to...

  15. Aging Optimization of Aluminum-Lithium Alloy L277 for Application to Cryotank Structures

    Science.gov (United States)

    Sova, B. J.; Sankaran, K. K.; Babel, H.; Farahmand, B.; Cho, A.

    2003-01-01

    Compared with aluminum alloys such as 2219, which is widely used in space vehicle for cryogenic tanks and unpressurized structures, aluminum-lithium alloys possess attractive combinations of lower density and higher modulus along with comparable mechanical properties and improved damage tolerance. These characteristics have resulted in the successful use of the aluminum-lithium alloy 2195 for the Space Shuttle External Tank, and the consideration of newer U.S. aluminum-lithium alloys such as L277 and C458 for future space vehicles. A design of experiments aging study was conducted for plate and a limited study on extrusions. To achieve the T8 temper, Alloy L277 is typically aged at 290 F for 40 hours. In the study for plate, a two-step aging treatment was developed through a design of experiments study and the one step aging used as a control. Based on the earlier NASA studies on 2195, the first step aging temperature was varied between 220 F and 260 F. The second step aging temperatures was varied between 290 F and 310 F, which is in the range of the single-step aging temperature. For extrusions, two, single-step, and one two-step aging condition were evaluated. The results of the design of experiments used for the T8 temper as well as a smaller set of experiments for the T6 temper for plate and the results for extrusions will be presented.

  16. 48 CFR 605.403 - Requests from members of Congress.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Requests from members of Congress. 605.403 Section 605.403 Federal Acquisition Regulations System DEPARTMENT OF STATE COMPETITION... members of Congress. The Procurement Executive is the agency head for the purposes of FAR 5.403. [59 FR...

  17. Microstructure and Properties of Spark Plasma Sintered Al-Zn-Mg-Cu Alloy

    Czech Academy of Sciences Publication Activity Database

    Becker, H.; Dopita, M.; Stráská, J.; Málek, P.; Vilémová, Monika; Rafaja, D.

    2015-01-01

    Roč. 128, č. 4 (2015), s. 602-605 ISSN 0587-4246. [International Symposium on Physics of Materials (ISPMA) /13./. Prague, 31.08.2014-04.09.2014] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : mechanical properties * alloying elements Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.525, year: 2015

  18. 10 CFR 605.5 - The Office of Energy Research Financial Assistance Program.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false The Office of Energy Research Financial Assistance Program. 605.5 Section 605.5 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS THE OFFICE OF ENERGY RESEARCH FINANCIAL ASSISTANCE PROGRAM § 605.5 The Office of Energy Research Financial Assistance Program. (a) DOE may issue, under the Office o...

  19. Improving the corrosion wear resistance of AISI 316L stainless steel by particulate reinforced Ni matrix composite alloying layer

    Science.gov (United States)

    Xu, Jiang; Zhuo, Chengzhi; Tao, Jie; Jiang, Shuyun; Liu, Linlin

    2009-01-01

    In order to overcome the problem of corrosion wear of AISI 316L stainless steel (SS), two kinds of composite alloying layers were prepared by a duplex treatment, consisting of Ni/nano-SiC and Ni/nano-SiO2 predeposited by brush plating, respectively, and subsequent surface alloying with Ni-Cr-Mo-Cu by a double glow process. The microstructure of the two kinds of nanoparticle reinforced Ni-based composite alloying layers was investigated by means of SEM and TEM. The electrochemical corrosion behaviour of composite alloying layers compared with the Ni-based alloying layer and 316L SS under different conditions was characterized by potentiodynamic polarization test and electrochemical impedance spectroscopy. Results showed that under alloying temperature (1000 °C) conditions, amorphous nano-SiO2 particles still retained the amorphous structure, whereas nano-SiC particles were decomposed and Ni, Cr reacted with SiC to form Cr6.5Ni2.5Si and Cr23C6. In static acidic solution, the corrosion resistance of the composite alloying layer with the brush plating Ni/nano-SiO2 particles interlayer is lower than that of the Ni-based alloying layer. However, the corrosion resistance of the composite alloying layer with the brush plating Ni/nano-SiO2 particles interlayer is prominently superior to that of the Ni-based alloying layer under acidic flow medium condition and acidic slurry flow condition. The corrosion resistance of the composite alloying layer with the brush plating Ni/nano-SiC particles interlayer is evidently lower than that of the Ni-based alloying layer, but higher than that of 316L SS under all test conditions. The results show that the highly dispersive nano-SiO2 particles are helpful in improving the corrosion wear resistance of the Ni-based alloying layer, whereas carbides and silicide phase are deleterious to that of the Ni-based alloying layer due to the fact that the preferential removal of the matrix around the precipitated phase takes place by the chemical

  20. 31 CFR 19.605 - How does suspension differ from debarment?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false How does suspension differ from debarment? 19.605 Section 19.605 Money and Finance: Treasury Office of the Secretary of the Treasury GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) General Principles Relating to Suspension and Debarment...

  1. Tensile and Creep-Rupture Evaluation of a New Heat of Haynes Alloy 25

    International Nuclear Information System (INIS)

    Shingledecker, J.P.; Glanton, D.B.; Martin, R.L.; Sparks, B.L.; Swindeman, R.W.

    2007-01-01

    From 1999 to 2006, a program was undertaken within the Materials Science and Technology Division, formerly the Metals and Ceramics Division, of Oak Ridge National Laboratory to characterize the tensile and creep-rupture properties of a newly produced heat of Haynes alloy 25 (L-605). Tensile properties from room temperature to 1100 C were evaluated for base material and welded joints aged up to 12,000 hours at 675 C. Creep and creep-rupture tests were conducted on base metal and cross-weldments from 650 to 950 C. Pressurized tubular creep tests were conducted to evaluate multiaxial creep-rupture response of the material. Over 800,000 hours of creep test data were generated during the test program with the longest rupture tests extending beyond 38,000 hours, and the longest creep-rate experiments exceeding 40,000 hours

  2. 29 CFR 541.605 - Fee basis.

    Science.gov (United States)

    2010-07-01

    ... DELIMITING THE EXEMPTIONS FOR EXECUTIVE, ADMINISTRATIVE, PROFESSIONAL, COMPUTER AND OUTSIDE SALES EMPLOYEES Salary Requirements § 541.605 Fee basis. (a) Administrative and professional employees may be paid on a...

  3. Failure Analysis Handbook

    Science.gov (United States)

    1989-08-18

    extent of the fatigue is showin by brackets. 409 FMH 100242 MAG: 10OX FAM 0023 MA bT 41013 PAM 99372 NAG: 50X FIGURE 8-111: overall photograph of the...Relieved X S~~Ta. anW=~ Alloy 90Ta-lOW Smte Relieved X Co- Cobalt Alloy L 605 125 ksi nux Cu-2% lit IsO 17 ksi x 733 8) T. E. Tallian, G. H. Baile, H

  4. 45 CFR 605.52 - Health, welfare, and other social services.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Health, welfare, and other social services. 605.52... ASSISTANCE Health, Welfare, and Social Services § 605.52 Health, welfare, and other social services. (a) General. In providing health, welfare, or other social services or benefits, a recipient may not, on the...

  5. L10 ordered structures in Al-Cu-(Mg alloys at the early stages of elevated temperature aging

    Directory of Open Access Journals (Sweden)

    Fuzhong, Xia

    2016-09-01

    Full Text Available This study concerns the precipitation structures of Al-3Cu and Al-3Cu-1.78Mg (wt. % alloys at the early stages of elevated temperature aging. The Al-3Cu and Al-3Cu-1.78 Mg alloys were solution treated at 540 °C and 500 °C for 2 h, respectively, and then aged at 190 °C for 2 min. The precipitation structures in aged Al-3Cu-(1.78Mg alloys were characterized by Transmission Electron Microscopy (TEM and High Resolution Transmission Electron Microscopy (HTREM. 001 zone axis Selected area electron diffraction patterns indicate that L10 ordered structures are formed in the two aged alloys. HRTEM experiments reveal the partial dislocations on the interfaces of L10 ordered structures. From comparing experimental results with that in the literature, it is concluded that the L10 ordered structures in aged Al-3Cu alloy consist of Al and Cu atoms, and they are comprised by Al, Cu and Mg atoms together in the aged Al-3Cu-1.78Mg alloy. On the basis of precipitate growing thermodynamics, it is thought the L10 ordered structures act as nuclei for GP zones in Al-Cu-(Mg alloys during aging.En este trabajo se estudian las estructuras de precipitación en Al-3Cu y Al-3Cu-1,78Mg (% en peso en los estados iniciales de envejecimiento a temperatura elevada. Las aleaciones Al-3Cu y Al-3Cu-1.78 Mg fueron sometidas a un tratamiento térmico de solución de 2 h a 540 °C y 500 °C, respectivamente, y posteriormente envejecidas 2 min a 190 °C. Las estructuras de precipitación en Al-3Cu-(1.78Mg envejecido fueron caracterizadas por microscopía electrónica de transmisión (TEM y por microscopía electrónica de transmisión de alta resolución (HTREM. Los diagramas de difracción de electrones de área seleccionada indican que se forman estructuras ordenadas L10 en las dos aleaciones envejecidas. Experimentos de HRTEM revelan la presencia de dislocaciones parciales en las intercaras de las estructuras L10 ordenadas. Comparando estos resultados experimentales con la

  6. 7 CFR 3021.605 - Award.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 3021.605 Award. Award means an award of financial assistance by the Department of Agriculture or other Federal...

  7. 5 CFR 330.605 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... Employees § 330.605 Eligibility. (a) To be eligible for the special selection priority, an individual must... selection priority when there are no eligible surplus and displaced agency employees within the local...) Eligibility for special selection priority begins on the date the agency issues the employee a reduction in...

  8. Influence of pH on the chemical and structural properties of the oxide films formed on 316L stainless steel, alloy 600 and alloy 690 in high temperature aqueous environments

    International Nuclear Information System (INIS)

    Dupin, M.; Gosser, P.; Walls, M.G.; Rondot, B.; Pastol, J.L.

    2002-01-01

    The oxide films formed on 316L stainless steel, alloy 600 and alloy 690 at 320 deg C in high temperature aqueous environments of different pH have been examined by glow discharge optical spectroscopy, scanning electron microscopy, atomic force microscopy and capacitance measurements. The analytical study reveals that the films formed at pH 5 are mainly composed of chromium oxides. When the pH increases the chromium concentration decreases and those of the other two elements (Ni and Fe) tend to increase. The films formed at pH 5 on 316L stainless steel and alloy 600 are thick and powder-like. The film formed at the same pH on alloy 690 is thin and is composed of a compact protective inner layer and a less-compact outer layer formed by crystals of mixed iron-nickel-chromium oxides. The morphological appearance of the thick films and that of the thin films is very different. However, equivalent morphologies can be observed for the relatively thin duplex films formed at pH 8 and pH 9.5 on the 316L stainless steel and nickel-base alloys. The evolution of the chemical composition of the films is accompanied by important changes from the point of view of their semi-conductivity. (authors)

  9. Anodic behavior of alloy 22 in bicarbonate containing media: Effect of alloying

    International Nuclear Information System (INIS)

    Zadorozne, N S; Giordano, C M; Rebak, R B; Ares, A E; Carranza, R M

    2012-01-01

    Alloy 22 is one of the candidates for the manufacture of high level nuclear waste containers. These containers provide services in natural environments characterized by multi-ionic solutions.It is estimated they could suffer three types of deterioration: general corrosion, localized corrosion (specifically crevice corrosion) and stress corrosion cracking (SCC). It has been confirmed that the presence of bicarbonate and chloride ions is necessary to produce cracking, . It has also been determined that the susceptibility to SCC could be related to the occurrence of an anodic peak in the polarization curves in these media at potentials below transpassivity. The aim of this work is to study the effect of alloying elements on the anodic behavior of Alloy 22 in media containing bicarbonate and chloride ions at different concentrations and temperatures. Polarization curves were made on alloy 22 (Ni-22% Cr-13% Mo), Ni-Mo (Ni-28, 5% Mo) and Ni-Cr (Ni-20% Cr) in the following solutions: 1 mol/L NaCl at 90 o C, and 1.148 mol/L NaHCO 3 ; 1.148 mol/L NaHCO 3 + 1 mol/L NaCl; 1.148 mol/L NaHCO 3 + 0.1 mol/L NaCl, at 90 o C, 75 o C, 60 o C and 25 o C. It was found that alloy 22 has a anodic current density peak at potentials below transpassivity, only in the presence of bicarbonate ions. Curves performed in 1 mol/L NaCl did not show any anodic peak, in any of the tested alloys. The curves made on alloys Ni-Mo and Ni-Cr in the presence of bicarbonate ions, allowed to determine that Cr, is responsible for the appearance of the anodic peak in alloy 22. The curves of alloy Ni-Mo showed no anodic peak in the studied conditions. The potential at which the anodic peak appears in alloy 22 and Ni-Cr alloy, increases with decreasing temperature. The anodic peak was also affected by solution composition. When chloride ion is added to bicarbonate solutions, the anodic peak is shifted to higher potential and current densities, depending on the concentration of added chloride ions (author)

  10. 25 CFR 11.605 - Dissolution.

    Science.gov (United States)

    2010-04-01

    ... Domestic Relations § 11.605 Dissolution. (a) The Court of Indian Offenses shall enter a decree of... supported by evidence that (i) the parties have lived separate and apart for a period of more than 180 days..., or provided for child custody, the support of any child entitled to support, the maintenance of...

  11. Corrosion of high Ni-Cr alloys and Type 304L stainless steel in HNO3-HF

    International Nuclear Information System (INIS)

    Ondrejcin, R.S.; McLaughlin, B.D.

    1980-04-01

    Nineteen alloys were evaluated as possible materials of construction for steam heating coils, the dissolver vessel, and the off-gas system of proposed facilities to process thorium and uranium fuels. Commercially available alloys were found that are satisfactory for all applications. With thorium fuel, which requires HNO 3 -HF for dissolution, the best alloy for service at 130 0 C when complexing agents for fluoride are used is Inconel 690; with no complexing agents at 130 0 C, Inconel 671 is best. At 95 0 C, six other alloys tested would be adequate: Haynes 25, Ferralium, Inconel 625, Type 304L stainless steel, Incoloy 825, and Haynes 20 (in order of decreasing preference); based on composition, six untested alloys would also be adequate. The ions most effective in reducing fluoride corrosion were the complexing agents Zr 4+ and Th 4+ ; Al 3+ was less effective. With uranium fuel, modestly priced Type 304L stainless steel is adequate. Corrosion will be most severe in HNO 3 -HF used occasionally for flushing and in solutions of HNO 3 and corrosion products (ferric and dichromate ions). HF corrosion can be minimized by complexing the fluoride ion and by passivation of the steel with strong nitric acid. Corrosion caused by corrosion products can be minimized by operating at lower temperatures

  12. 45 CFR 605.44 - Academic adjustments.

    Science.gov (United States)

    2010-10-01

    ... impairments, and other similar services and actions. Recipients need not provide attendents, individually... Postsecondary Education § 605.44 Academic adjustments. (a) Academic requirements. A recipient to which this..., against a qualified handicapped applicant or student. Academic requirements that the recipient can...

  13. Characterization of dissimilar welding: carbon steel E309L-E308L-ERNiCr3-ENiCrFe3 alloy 600; Caracterizacion de la soldadura disimilar: acero al carbono E309L-E308L-ERNiCr3-ENiCrFe3 aleacion 600

    Energy Technology Data Exchange (ETDEWEB)

    Mucino G, O.

    2015-07-01

    Most BWR type reactors have internal support components, which need to be attached to the inner surface by welding. Specifically, in these joints two materials interact, such as stainless steel and nickel base alloys. Nickel base alloys such as alloy 82 (ERNiCr3) and alloy 182 (ENiCrFe-3) are used for the joining of both dissimilar materials. For joints made with both nickel base alloys, the alloy 182 is prone to stress corrosion cracking (SCC); so it is essential to carry out studies related to this contribution material. In the nuclear industry any study related to this alloy is of importance because experience is gained in its behavior when is part of a system of an operation reactor. This work presents the characterization of the weld deposit of a stainless steel coating (with electrodes E309L and E308L) on a carbon steel plate type A36 and the joining with an Inconel 600 plate, simulating the joining of the internal coating of vessel and the heel of the support leg of the envelope of a BWR reactor. In this work, the mechanical and micro-structural characterization of the alloy deposit 182 was performed. (Author)

  14. 5 CFR 534.605 - Conversion.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY UNDER OTHER SYSTEMS Pay for Administrative Appeals Judge Positions § 534.605 Conversion. On the first day of the first pay period beginning... appeals judge to the lowest rate of basic pay provided by § 534.603(a) of this subpart that equals or...

  15. 24 CFR 232.605 - Contract requirements.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Form of Contract § 232.605 Contract requirements. (a) The contract between the...

  16. 45 CFR 605.5 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 605.5 Assurances required. (a) Assurances. Recipients of Federal financial assistance to which... purpose for which Federal financial assistance is extended or for another purpose involving the provision...

  17. 32 CFR 37.605 - What is the general policy on participants' financial, property, and purchasing systems?

    Science.gov (United States)

    2010-07-01

    ...' financial, property, and purchasing systems? 37.605 Section 37.605 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems § 37.605 What is the...

  18. Structural and magnetic characterization of Fe2CrSi Heusler alloy nanoparticles as spin injectors and spin based sensors

    Science.gov (United States)

    Saravanan, G.; Asvini, V.; Kalaiezhily, R. K.; Parveen, I. Mubeena; Ravichandran, K.

    2018-05-01

    Half-metallic ferromagnetic [HMF] nanoparticles are of considerable interest in spintronics applications due to their potential use as a highly spin polarized current source. HMF exhibits a semiconductor in one spin band at the Fermi level Ef and at the other spin band they poses strong metallic nature which shows 100 % spin polarization at Ef. Fe based full Heusler alloys are primary interest due to high Curie temperature. Fe2CrSi Heusler alloys are synthesized using metallic powders of Fe, Cr and Si by mechanical alloying method. X-Ray diffractions studies were performed to analyze the structural details of Fe2CrSi nanoparticles with High resolution scanning electron microscope (HRSEM) studies for the morphological details of nanoparticles and magnetic properties were studied using Vibrating sample magnetometer (VSM). XRD Data analysis conforms the Heusler alloy phase showing the existence of L21 structure. Magnetic properties are measured for synthesized samples exhibiting a soft magnetic property possessing low coercivity (HC = 60.5 Oe) and saturation magnetic moment of Fe2CrSi is 3.16 µB, which is significantly higher than the ideal value of 2 µB from the Slater-Pauling rule due to room temperature measurement. The change in magnetic properties are half-metallic nature of Fe2CrSi is due to the shift of the Fermi level with respect to the gap were can be used as spin sensors and spin injectors in magnetic random access memories and other spin dependent devices.

  19. 48 CFR 17.605 - Award, renewal, and extension.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Management and Operating Contracts 17.605... prospective contractor's technical and managerial capacity are sufficient, that organizational conflicts of...

  20. 45 CFR 605.34 - Educational setting.

    Science.gov (United States)

    2010-10-01

    ... needs of the handicapped person. A recipient shall place a handicapped person in the regular educational environment operated by the recipient unless it is demonstrated by the recipient that the education of the..., Elementary, and Secondary Education § 605.34 Educational setting. (a) Academic setting. A recipient to which...

  1. Diffusivities and atomic mobilities in disordered fcc and ordered L12 Ni–Al–W alloys

    International Nuclear Information System (INIS)

    Chen, Chong; Zhang, Lijun; Xin, Jinghua; Wang, Yaru; Du, Yong; Luo, Fenghua; Zhang, Zhongjian; Xu, Tao; Long, Jianzhan

    2015-01-01

    Highlights: • The atomic mobilities for fcc Al–W, fcc Ni–W, fcc Ni–Al–W and L1 2 Ni–Al–W alloys were critically assessed. • The impurity diffusivity of W in fcc-Al was obtained via first-principles calculations. • The calculated results agree well with the diffusivities available in the literature. • Two fcc/L1 2 -type diffusion couples were prepared and the concentration-distance profiles were measured. • The model-predicted concentration profiles agree well with the experimental data in the literature and in the present work. - Abstract: Based on various experimentally measured diffusivities available in the literature together with the reported thermodynamic parameters, the atomic mobilities for disordered fcc and ordered L1 2 Ni–Al–W alloys were assessed on the basis of a recently developed phenomenological model incorporated in the DICTRA software. In order to provide the missing impurity diffusion coefficients of W in fcc-Al, first-principles calculations were utilized in the present work. Comprehensive comparisons between the calculated and experimental diffusion coefficients show that all the experimental data can be well reproduced by the atomic mobilities obtained in the present work. In order to further verify the reliability of the presently obtained atomic mobilities, two fcc/L1 2 -type diffusion couples (i.e., Ni–5 at.% Al–5 at.% W/Ni–20 at.% Al–4 at.% W and Ni/Ni–22 at.% Al–2 at.% W) were prepared and the concentration-distance profiles after annealing at 1323 K for 86.4 ks were measured. The excellent agreement between the model-predicted concentration-distance profiles and the experimental data indicates that the presently obtained atomic mobilities in fcc/L1 2 Ni–Al–W alloys are reliable

  2. 40 CFR 300.605 - State trustees.

    Science.gov (United States)

    2010-07-01

    ... PLANNING, AND COMMUNITY RIGHT-TO-KNOW PROGRAMS NATIONAL OIL AND HAZARDOUS SUBSTANCES POLLUTION CONTINGENCY PLAN Trustees for Natural Resources § 300.605 State trustees. State trustees shall act on behalf of the... subpart G of this part, the definition of the term state does not include Indian tribes. The governor of a...

  3. Laser surface alloying of aluminium-transition metal alloys

    Directory of Open Access Journals (Sweden)

    Almeida, A.

    1998-04-01

    Full Text Available Laser surface alloying has been used as a tool to produce hard and corrosion resistant Al-transition metal (TM alloys. Cr and Mo are particularly interesting alloying elements to produce stable highstrength alloys because they present low diffusion coefficients and solid solubility in Al. To produce Al-TM surface alloys a two-step laser process was developed: firstly, the material is alloyed using low scanning speed and secondly, the microstructure is modified by a refinement step. This process was used in the production of Al-Cr, Al-Mo and Al-Nb surface alloys by alloying Cr, Mo or Nb powder into an Al and 7175 Al alloy substrate using a CO2 laser. This paper presents a review of the work that has been developed at Instituto Superior Tecnico on laser alloying of Al-TM alloys, over the last years.

    En el presente trabajo se estudia la aleación superficial mediante láser de aluminio con metales de transición. El cromo y el molibdeno son particularmente interesantes porque producen aleaciones de alta resistencia y por el bajo coeficiente de difusión y solución sólida en aluminio. Para producir estas aleaciones se ha seguido un procedimiento desarrollado en dos partes. En primer lugar, el material se alea usando una baja velocidad de procesado y en segundo lugar la estructura se modifica mediante un refinamiento posterior. Este procedimiento se ha empleado en la producción de aleaciones Al-Cr, Al-Mo y Al-Nb mediante aleación con láser de CO2 de polvos de Cr, Mo o Nb en aluminio y la aleación 7175. Este trabajo es una revisión del desarrollado en el Instituto Superior Técnico de Lisboa en los últimos años.

  4. 20 CFR 30.605 - What rights does the United States have upon payment of compensation under EEOICPA?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false What rights does the United States have upon payment of compensation under EEOICPA? 30.605 Section 30.605 Employees' Benefits OFFICE OF WORKERS... OF 2000, AS AMENDED Special Provisions Third Party Liability § 30.605 What rights does the United...

  5. 31 CFR 592.605 - Administrative collection; referral to United States Department of Justice.

    Science.gov (United States)

    2010-07-01

    ... to United States Department of Justice. 592.605 Section 592.605 Money and Finance: Treasury... United States Department of Justice. In the event that the respondent does not pay the penalty imposed... Department of Justice for appropriate action to recover the penalty in a civil suit in a federal district...

  6. 5 CFR 2634.605 - Review of reports.

    Science.gov (United States)

    2010-01-01

    ....605 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS EXECUTIVE BRANCH FINANCIAL... reviewing official may request an intermediate review by the filer's supervisor. In the case of a filer who is detailed to another agency for more than 60 days during the reporting period, the reviewing...

  7. 12 CFR 605.501 - Information Security Officer.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Information Security Officer. 605.501 Section... Information Security Officer. (a) The Information Security Officer of the Farm Credit Administration shall be responsible for implementation and oversight of the information security program and procedures adopted by the...

  8. 7 CFR 58.605 - Meaning of words.

    Science.gov (United States)

    2010-01-01

    ... for Plants Manufacturing, Processing and Packaging Frozen Desserts § 58.605 Meaning of words. For the... shall have the following meaning as applied to frozen desserts meeting FDA requirements and briefly... after freezing become a frozen dessert. [40 FR 47911, Oct. 10, 1975. Redesignated at 42 FR 32514, June...

  9. 76 FR 71937 - Proposed Information Collection; Comment Request; Direct Investment Surveys: BE-605, Quarterly...

    Science.gov (United States)

    2011-11-21

    ... Request; Direct Investment Surveys: BE-605, Quarterly Survey of Foreign Direct Investment in the United... Foreign Direct Investment in the United States--Transactions of U.S. Affiliate with Foreign Parent (BE-605... years from similar data reported in the BE- 12, Benchmark Survey of Foreign Direct Investment in the...

  10. 10 CFR 605.20 - Dissemination of results.

    Science.gov (United States)

    2010-01-01

    ..., the reports resulting from awards. (b) DOE may waive progress reporting requirements set forth in § 605.19, if the recipient submits to DOE a copy of its own report which is published or accepted for publication in a recognized scientific or technical journal and which satisfies the information requirements...

  11. Impact toughness of laser alloyed aluminium AA1200 alloys

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2013-08-01

    Full Text Available ),. 559-563. [2] T. Tomida, K. Nakata, S. Saji, T. Kubo, T, Formation of metal matrix composite layer on aluminium alloy with TiC-Cu powder by laser surface alloying process; Surface and Coatings Technology; vol. 142-144, 2001, 585-589. [3] L. A. B...

  12. Electrochemical Impedance Spectroscopy Of Metal Alloys

    Science.gov (United States)

    Macdowell, L. G.; Calle, L. M.

    1993-01-01

    Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.

  13. 7 CFR 1717.605 - Design standards, plans and specifications, construction standards, and RUS accepted materials.

    Science.gov (United States)

    2010-01-01

    ..., construction standards, and RUS accepted materials. 1717.605 Section 1717.605 Agriculture Regulations of the... standards, plans and specifications, construction standards, and RUS accepted materials. All borrowers... system design, construction standards, and the use of RUS accepted materials. Borrowers must comply with...

  14. 45 CFR 605.42 - Admissions and recruitment.

    Science.gov (United States)

    2010-10-01

    ... success in the education program or activity in question and (ii) alternate tests or criteria that have a... correct the effects of past discrimination pursuant to § 605.6(a) or when a recipient is taking voluntary... recipient may base prediction equations on first year grades, but shall conduct periodic validity studies...

  15. 48 CFR 315.605 - Content of unsolicited proposals.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Unsolicited Proposals 315.605 Content of... prepared under Government supervision; (b) The methods and approaches stated in the proposal were developed... Title (This certification shall be signed by a responsible management official of the proposing...

  16. Embrittlement of nickel-, cobalt-, and iron-base superalloys by exposure to hydrogen

    Science.gov (United States)

    Gray, H. R.

    1975-01-01

    Five nickel-base alloys (Inconel 718, Udimet 700, Rene 41, Hastelloy X, and TD-NiCr), one cobalt-base alloy (L-605), and an iron-base alloy (A-286) were exposed in hydrogen at 0.1 MN/sq m (15 psi) at several temperatures in the range from 430 to 980 C for as long as 1000 hours. These alloys were embrittled to varying degrees by such exposures in hydrogen. Embrittlement was found to be: (1) sensitive to strain rate, (2) reversible, (3) caused by large concentrations of absorbed hydrogen, and (4) not associated with any detectable microstructural changes in the alloys. These observations are consistent with a mechanism of internal reversible hydrogen embrittlement.

  17. 78 FR 11140 - BE-605: Quarterly Survey of Foreign Direct Investment in the United States-Transactions of U.S...

    Science.gov (United States)

    2013-02-15

    ... BE-605: Quarterly Survey of Foreign Direct Investment in the United States--Transactions of U.S... conducting the mandatory survey titled BE-605, Quarterly Survey of Foreign Direct Investment in the United... quarterly Form BE-605 is required from each U.S. business enterprise in which a foreign entity has a direct...

  18. L2₁ and XA Ordering Competition in Hafnium-Based Full-Heusler Alloys Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb).

    Science.gov (United States)

    Wang, Xiaotian; Cheng, Zhenxiang; Wang, Wenhong

    2017-10-20

    For theoretical designing of full-Heusler based spintroinc materials, people have long believed in the so-called Site Preference Rule (SPR). Very recently, according to the SPR, there are several studies on XA-type Hafnium-based Heusler alloys X₂YZ, i.e., Hf₂VAl, Hf₂CoZ (Z = Ga, In) and Hf₂CrZ (Z = Al, Ga, In). In this work, a series of Hf₂-based Heusler alloys, Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb), were selected as targets to study the site preferences of their atoms by first-principle calculations. It has been found that all of them are likely to exhibit the L2₁-type structure instead of the XA one. Furthermore, we reveal that the high values of spin-polarization of XA-type Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb) alloys have dropped dramatically when they form the L2₁-type structure. Also, we prove that the electronic, magnetic, and physics nature of these alloys are quite different, depending on the L2₁-type or XA-type structures.

  19. Stem loop sequences specific to transposable element IS605 are found linked to lipoprotein genes in Borrelia plasmids.

    Directory of Open Access Journals (Sweden)

    Nicholas Delihas

    Full Text Available BACKGROUND: Plasmids of Borrelia species are dynamic structures that contain a large number of repetitive genes, gene fragments, and gene fusions. In addition, the transposable element IS605/200 family, as well as degenerate forms of this IS element, are prevalent. In Helicobacter pylori, flanking regions of the IS605 transposase gene contain sequences that fold into identical small stem loops. These function in transposition at the single-stranded DNA level. METHODOLOGY/PRINCIPAL FINDINGS: In work reported here, bioinformatics techniques were used to scan Borrelia plasmid genomes for IS605 transposable element specific stem loop sequences. Two variant stem loop motifs are found in the left and right flanking regions of the transposase gene. Both motifs appear to have dispersed in plasmid genomes and are found "free-standing" and phylogenetically conserved without the associated IS605 transposase gene or the adjacent flanking sequence. Importantly, IS605 specific stem loop sequences are also found at the 3' ends of lipoprotein genes (PFam12 and PFam60, however the left and right sequences appear to develop their own evolutionary patterns. The lipoprotein gene-linked left stem loop sequences maintain the IS605 stem loop motif in orthologs but only at the RNA level. These show mutations whereby variants fold into phylogenetically conserved RNA-type stem loops that contain the wobble non-Watson-Crick G-U base-pairing. The right flanking sequence is associated with the family lipoprotein-1 genes. A comparison of homologs shows that the IS605 stem loop motif rapidly dissipates, but a more elaborate secondary structure appears to develop in its place. CONCLUSIONS/SIGNIFICANCE: Stem loop sequences specific to the transposable element IS605 are present in plasmid regions devoid of a transposase gene and significantly, are found linked to lipoprotein genes in Borrelia plasmids. These sequences are evolutionarily conserved and/or structurally developed in

  20. 21 CFR 111.605 - What requirements apply to the records that you make and keep?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What requirements apply to the records that you make and keep? 111.605 Section 111.605 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN...

  1. Compatibility of 316L stainless steel with the liquid alloy Pb17Li

    International Nuclear Information System (INIS)

    Broc, M.; Fauvet, P.; Flament, T.; Terlain, A.; Sannier, J.

    1988-01-01

    The behavior of 316L austenitic stainless steel in liquid eutectic lead alloy is investigated. The 316L is a possible structural material for fusion reactors. The obtained results are summarized and compared with other experimental data. The mechanisms which control the corrosion process are discussed. The investigation shows that whatever, the hydraulic flow, the corrosion of 316L stainless steel exposed to Pb17Li is characterized by the formation of a porous ferritic layer. The corrosion kinetics is mainly dependent on temperature, hydraulic flow and metallurgical state of the steel. At 400 0 C in turbulent flow, the corrosion rate at steady state of 316L solution annealed is estimated to 27 microns/year to which a depth of 25 microns has to be added to take into account the initial transient period. From overall available results, dissolution and solid state transformation in case of turbulent flow and diffusion in liquid phase for laminar flow, may be suggested

  2. 41 CFR 105-60.605 - Procedure in the event of a demand for production or disclosure.

    Science.gov (United States)

    2010-07-01

    .... (2) Production of material. When information other than oral testimony is sought by a demand, the... of a demand for production or disclosure. 105-60.605 Section 105-60.605 Public Contracts and Property... MATERIALS 60.6-Production or Disclosure by Present or Former General Services Administration Employees in...

  3. An X-ray absorption near-edge structure (XANES) study of the Sn L_3 edge in zirconium alloy oxide films formed during autoclave corrosion

    International Nuclear Information System (INIS)

    Hulme, Helen; Baxter, Felicity; Babu, R. Prasath; Denecke, Melissa A.; Gass, Mhairi; Steuwer, Axel; Norén, Katarina; Carlson, Stefan; Preuss, Michael

    2016-01-01

    Highlights: • Characterisation of tin speciation in zirconium alloy metal and oxide films using Sn L_3-XANES. • Chemical environment of tin in Zircaloy-4 and ZIRLO™ oxide films shown to be similar. • Tin in the oxide films is present in both the di- and tetravalent states and oxidises progressively with oxide-layer growth. - Abstract: Application of Sn L_3-XANES to study the oxidation state of alloying additions of tin (1–1.2 wt%) in <2 μm oxide layers formed on nuclear grade zirconium alloy has been demonstrated. Data obtained for metallic and corroded ZIRLO™ (1 wt% Sn) and Zircaloy-4 (1.2 wt% Sn) indicate tin has a similar chemical speciation in both metal alloys but this differs in the oxidised surface layers. By recording XANES at various incident angles to vary the photon penetration depth and amount of the oxide layer probed in the measurement, the authors found evidence that the oxidation of tin progresses with increasing oxide thickness.

  4. A thermodynamic investigation of liquid gold-antimony alloys

    International Nuclear Information System (INIS)

    Hayer, E.; Castanet, R.

    1995-01-01

    The enthalpies of mixing of liquid Au-Sb alloys were determined between 906 and 1028 K giving Δ mix H o m = x Sb x Au (-11.234-1.1078x Sb + 5.713x Sb 2 ) kJ mol -1 . The minimum was found at x Sb = 0.45 with Δ mix H o m = -2.62 ± 0.2 kJ mol -1 contrary to published measurements on liquid Au-Sb alloys. The limiting partial molar enthalpy of Au in Sb at 935 K was measured to Δ mix h o m (Au, liq, in ∞Sb, liq) = -6.05 ± 0.4 kJ mol -1 . The enthalpy of formation of the solid compound AuSb 2 determined at 298 K by solution calorimetry in liquid Sb, Δ f H o m (AuSb 2 ) = -5.40 ± 0.6 kJ mol -1 , is found in fair agreement with literature data. DTA measurements were performed on the Au-rich part of the liquidus and a new liquidus curve is suggested between Au and the eutectic concentration. The eutectic point was found at 630.37 ± 0.25 K and x Sb 0.350. (orig.)

  5. The failure behavior of duplex 316 L steel-TA6V titanium alloy spherical pressure vessels

    International Nuclear Information System (INIS)

    Miannay, D.

    1980-05-01

    The purpose of this paper is to compare the experimental residual stresses of spherical vessels made of TA6V alloy which exhibits plasticity before failure in toughness testing and cracked with several configurations, with stresses estimated according to the afore mentioned theories. An internal austenitic 316 L steel is used to prevent 'leak before break' [fr

  6. [Corrosion property and oxide film of dental casting alloys before and after porcelain firing].

    Science.gov (United States)

    Ma, Qian; Wu, Feng-ming

    2011-03-01

    To evaluate the types and compositions of oxide films formed during porcelain-fused-to-metal (PFM) firing on three kinds of dental casting alloys, and to investigate the corrosion property of these alloys in Dulbecco's modification of Eagle's medium (DMEM) cell culture fluid, before and after PFM firing. Specimens of three dental casting alloys (Ni-Cr, Co-Cr and Ni-Ti) before and after PFM firing were prepared, and were immersed in DMEM cell culture fluid. After 30 days, the type and concentration of released metal ions were measured using inductively coupled plasma atomic emission spectroscopy (ICP-AES). X-ray photoelectron spectroscopy (XPS) and scanning electron microscope (SEM) were used for analysis of oxide film on the alloys. One way-ANOVA was adopted in data analysis. The total amount of metal ions released from the three dental alloys was found to be highest in Ni-Cr alloy [(2.829 ± 0.694) mg/L], followed by Co-Cr [(2.120 ± 0.418) mg/L] and Ni-Ti alloy [(1.211 ± 0.101) mg/L]. The amount of Ni ions released from Ni-Cr alloys [(1.531 ± 0.392) mg/L] was higher than that from Ni-Ti alloys [(0.830 ± 0.052) mg/L]. The amount of Cr, Mo ions released from Co-Cr alloy [Cr: (0.048 ± 0.011) mg/L, Mo: (1.562 ± 0.333) mg/L] was higher than that from Ni-Cr alloy [Cr: (0.034 ± 0.002) mg/L, Mo: (1.264 ± 0.302) mg/L] and Ni-Ti alloy [Cr: (0.013 ± 0.006) mg/L, Mo: (0.151 ± 0.026) mg/L] (P < 0.05). After PFM firing, the total amount of metal irons released from the three dental alloys decreased [Ni-Cr: (0.861 ± 0.054) mg/L, Co-Cr: (0.695 ± 0.327) mg/L, Ni-Ti: (0.892 ± 0.115) mg/L] (P < 0.05). In addition, XPS showed increase of Cr(2)O(3) and Mo-Ni oxide on the surface of all the alloys after PFM firing. The amount of ions released from Ni-Cr alloy was the highest among the three dental casting alloys, this means Ni-Cr alloy is prone to corrode. The PFM firing process changed the alloys' surface composition. Increased Ni, Cr and Mo were found in oxide film, and

  7. 13 CFR 127.605 - What are the procedures for appealing an EDWOSB or WOSB status protest decision?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the procedures for appealing an EDWOSB or WOSB status protest decision? 127.605 Section 127.605 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION WOMEN-OWNED SMALL BUSINESS FEDERAL CONTRACT ASSISTANCE PROCEDURES Protests...

  8. 49 CFR 605.17 - Certification in lieu of notice.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION SCHOOL BUS OPERATIONS School Bus Agreements § 605.17 Certification in lieu of notice. If there are no private school bus operators operating in the applicant's urban.... This certification shall be accompanied by a statement that the applicant has published, in a newspaper...

  9. Contribution towards the study of {beta}{yields}{alpha} transformation in uranium and its alloys (1962); Contribution a l'etude de la transformation {beta}{yields}{alpha} dans l'uranium et ses alliages (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-05-15

    The kinetics of the transformation of uranium alloys containing 0.5 - 0.75 - 1.0 - 1.5 and 3 atoms per cent have been studied. The influence of heat treatment before decomposition has been discussed. The study of the transformation characteristics such as kinetics, residual phases, phenomena connected with the coherence between phases, reversibility below the equilibrium temperature, shows the following mechanisms exhibited during the decomposition of the {beta} phase on lowering the temperature: 1 ) eutectoid, 2) bainitic, 3) martensitic. The study of the TTT diagrams of alloys containing decreasing percentages of chromium indicates that the unalloyed uranium transforms without maintaining the coherence above 600 deg. C, where as at lower temperatures the transformation is mainly martensitic. The various alloying elements can be characterised by their influence on the three TTT curves corresponding to the three possible transformation mechanisms. The ability of the uranium alloys to alpha grain refining during isothermal decomposition or ambient temperature quenching is directly connected with the characteristics of the TTT diagrams and especially to the mode of bainitic transformation. (author) [French] II a ete etudie la cinetique de transformation des alliages uranium-chrome de teneur 0,5 - 0,75 - 1 - 1,5 - et 3 atomes pour cent. L'influence des traitements thermiques precedant la decomposition a ete discutee. L'etude des caracteristiques de la transformation: cinetique, phases residuelles, phenomenes lies a la coherence entre phases, reversibilite au-dessous de la temperature d'equilibre, permet de conclure que la decomposition met en jeu successivement les trois mecanismes eutectoide, bainitique et martensitique quand la temperature baisse. L'etude de l'evolution des diagrammes TTT quand la teneur en Cr decroit indique que dans l'uranium non allie la transformation se fait sans maintien de la coherence au-dessus de 600 deg. C; a plus basse temperature la

  10. Spin-orbit driven phenomena in the isoelectronic L 10 -Fe(Pd,Pt) alloys from first principles

    Science.gov (United States)

    Kudrnovský, J.; Drchal, V.; Turek, I.

    2017-12-01

    The anomalous Hall effect (AHE) and the Gilbert damping (GD) are studied theoretically for the partially ordered L 10 -Fe(Pd,Pt) alloys. The varying alloy order and the spin-orbit coupling, which are due to the change in the Pd/Pt composition, allow for a chemical tuning of both phenomena which play an important role in the spintronic applications. The impact of the antisite disorder on the residual resistivity, AHE, and GD is studied from first principles using recently developed methods employing the Kubo-Bastin approach and the nonlocal torque operator method. The most interesting result is a different behavior of samples with low and high chemical orders. Good agreement between calculated and measured concentration trends is obtained for all quantities studied, while the absolute GD values are underestimated.

  11. Amorphous phase formation in the Cu_3_6Zr_5_9A_l_5 and Cu_4_8Zr_4_3A_l_9 ternary alloys studied by molecular dynamics

    International Nuclear Information System (INIS)

    Aliaga, L.C.R.; Schimidt, C.S.; Lima, L.V.; Domingues, G.M.B.; Bastos, I.N.

    2016-01-01

    Amorphous alloys presents better mechanical and physical properties than its crystalline counterparts. However, there is a scarce understanding on structure - properties relationship in this class of materials. This paper presents the results of the molecular dynamics application to obtain an atomistic description of melting, solidification and the glass forming ability in the ternary Cu_3_6Zr_5_9A_l_5 and Cu_4_8Zr_4_3A_l_9 alloys. In the study we used the EAM potential and different cooling rates, β = 0.1, 1 and 100 K/ps to form the amorphous phase in a system consisting of 32,000 atoms by using the free code LAMMPS. The solidus and liquidus temperatures, on a heating rate of the 5 K/ps, were obtained. Also, on the cooling down step, it was observed that the glass transition temperature (T_g) decreases as cooling rate increases. The structural evolution was analyzed through the radial distribution functions and Voronoi polyhedra. Furthermore, it was determined the evolution of viscosity upper T_g, as well as the fragility (m) parameter for each amorphous alloy. The thermal parameters of the simulation obtained are compared with those of the experiments. (author)

  12. Computational micromechanics of bioabsorbable magnesium stents.

    Science.gov (United States)

    Grogan, J A; Leen, S B; McHugh, P E

    2014-06-01

    Magnesium alloys are a promising candidate material for an emerging generation of absorbable metal stents. Due to its hexagonal-close-packed lattice structure and tendency to undergo twinning, the deformation behaviour of magnesium is quite different to that of conventional stent materials, such as stainless steel 316L and cobalt chromium L605. In particular, magnesium exhibits asymmetric plastic behaviour (i.e. different yield behaviours in tension and compression) and has lower ductility than these conventional alloys. In the on-going development of absorbable metal stents it is important to assess how the unique behaviour of magnesium affects device performance. The mechanical behaviour of magnesium stent struts is investigated in this study using computational micromechanics, based on finite element analysis and crystal plasticity theory. The plastic deformation in tension and bending of textured and non-textured magnesium stent struts with different numbers of grains through the strut dimension is investigated. It is predicted that, unlike 316L and L605, the failure risk and load bearing capacity of magnesium stent struts during expansion is not strongly affected by the number of grains across the strut dimensions; however texturing, which may be introduced and controlled in the manufacturing process, is predicted to have a significant influence on these measures of strut performance. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Solidification paths of multicomponent monotectic aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Mirkovic, Djordje; Groebner, Joachim [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Street 42, D-38678 Clausthal-Zellerfeld (Germany); Schmid-Fetzer, Rainer [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Street 42, D-38678 Clausthal-Zellerfeld (Germany)], E-mail: schmid-fetzer@tu-clausthal.de

    2008-10-15

    Solidification paths of three ternary monotectic alloy systems, Al-Bi-Zn, Al-Sn-Cu and Al-Bi-Cu, are studied using thermodynamic calculations, both for the pertinent phase diagrams and also for specific details concerning the solidification of selected alloy compositions. The coupled composition variation in two different liquids is quantitatively given. Various ternary monotectic four-phase reactions are encountered during solidification, as opposed to the simple binary monotectic, L' {yields} L'' + solid. These intricacies are reflected in the solidification microstructures, as demonstrated for these three aluminum alloy systems, selected in view of their distinctive features. This examination of solidification paths and microstructure formation may be relevant for advanced solidification processing of multicomponent monotectic alloys.

  14. Intergranular corrosion in unserviced austenitic stainless steel pipes made of alloy 904L; Kornzerfall in nicht betriebsbeanspruchten rostfreien austenitischen Rohren aus Alloy 904L

    Energy Technology Data Exchange (ETDEWEB)

    Neidel, Andreas; Cagliyan, Erhan; Fischer, Boromir; Giller, Madeleine; Riesenbeck, Susanne [Siemens AG, Energy Sector, Berlin (Germany). Gasturbinenwerk Berlin

    2017-09-01

    Seamless tubes of the highly corrosion resistant austenitic steel 1.4539, X1NiCrMoCu25-20-5 (Alloy 904L) were observed to exhibit signs of inter-crystalline damage to a depth of several layers of grains and in particular on their internal surface. The material had been stored and had not been put into service. A number of hypotheses had been discussed to explain the predominant cause of the damage. Using optical light and scanning electron microscopy investigation techniques, clear evidence was obtained indicating it to be inter-crystalline corrosion due to the sensitisation of the grain boundaries. The most probable cause of this was determined to be the presence of residual deposits from the rolling process, which due to poor cleaning, had not been completely removed prior to the final solution annealing treatment. This explaining why predominantly the internal surface of the tubes was affected.

  15. Comparison of Corrosion Behavior of Low-Alloy Steel Containing Copper and Antimony with 409L Stainless Steel for a Flue Gas Desulfurization System

    Energy Technology Data Exchange (ETDEWEB)

    Park, Sun-Ah; Shin, Su-Bin; Kim, Jung-Gu [Sungkyunkwan University, Suwon (Korea, Republic of)

    2016-07-15

    The corrosion behavior of low alloy steel containing Cu, Sb and 409L stainless steel was investigated for application in the low-temperature section of a flue gas desulfurization (FGD) system. The electrochemical properties were evaluated by potentiodynamic polarization testing and electrochemical impedance spectroscopy (EIS) in 16.9 vol% H{sub 2}SO{sub 4} + 0.35 vol% HCl at 60 ℃. The inclusions in these steels ere identified by electron probe microanalyzer (EPMA). The corrosion products of the steels were analyzed using scanning electron microscope (SEM) with energy dispersive spectroscopy (EDS) and transmission electron microscopy (TEM). The corrosion rate of the low alloy steel containing Cu, Sb was about 100 times lower than that of 409L stainless steel. For stainless steel without passivation, active corrosion behavior was shown. In contrast, in the low alloy steel, the Cu, Sb compounds accumulated on the surface improved the corrosion resistance by suppressing the anodic dissolution reaction.

  16. Removable partial denture alloys processed by laser-sintering technique.

    Science.gov (United States)

    Alageel, Omar; Abdallah, Mohamed-Nur; Alsheghri, Ammar; Song, Jun; Caron, Eric; Tamimi, Faleh

    2018-04-01

    Removable partial dentures (RPDs) are traditionally made using a casting technique. New additive manufacturing processes based on laser sintering has been developed for quick fabrication of RPDs metal frameworks at low cost. The objective of this study was to characterize the mechanical, physical, and biocompatibility properties of RPD cobalt-chromium (Co-Cr) alloys produced by two laser-sintering systems and compare them to those prepared using traditional casting methods. The laser-sintered Co-Cr alloys were processed by the selective laser-sintering method (SLS) and the direct metal laser-sintering (DMLS) method using the Phenix system (L-1) and EOS system (L-2), respectively. L-1 and L-2 techniques were 8 and 3.5 times more precise than the casting (CC) technique (p laser-sintered and cast alloys were biocompatible. In conclusion, laser-sintered alloys are more precise and present better mechanical and fatigue properties than cast alloys for RPDs. © 2017 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 106B: 1174-1185, 2018. © 2017 Wiley Periodicals, Inc.

  17. Application of mechanical alloying to synthesis of intermetallic phases based alloys

    International Nuclear Information System (INIS)

    Dymek, S.

    2001-01-01

    Mechanical alloying is the process of synthesis of powder materials during milling in high energetic mills, usually ball mills. The central event in mechanical alloying is the ball-powder-ball collision. Powder particles are trapped between the colliding balls during milling and undergo deformation and/or fracture. Fractured parts are cold welded. The continued fracture and cold welding results in a uniform size and chemical composition of powder particles. The main applications of mechanical alloying are: processing of ODS alloys, syntheses of intermetallic phases, synthesis of nonequilibrium structures (amorphous alloys, extended solid solutions, nanocrystalline, quasi crystals) and magnetic materials. The present paper deals with application of mechanical alloying to synthesis Ni A l base intermetallic phases as well as phases from the Nb-Al binary system. The alloy were processed from elemental powders. The course of milling was monitored by scanning electron microscopy and X-ray diffraction. After milling, the collected powders were sieved by 45 μm grid and hot pressed (Nb alloys and NiAl) or hot extruded (NiAl). The resulting material was fully dense and exhibited fine grain (< 1 μm) and uniform distribution of oxide dispersoid. The consolidated material was compression and creep tested. The mechanical properties of mechanically alloys were superior to properties of their cast counterparts both in the room and elevated temperatures. Higher strength of mechanically alloyed materials results from their fine grains and from the presence of dispersoid. At elevated temperatures, the Nb-Al alloys have higher compression strength than NiAl-based alloys processed at the same conditions. The minimum creep rates of mechanically alloyed Nb alloys are an order of magnitude lower than analogously processed NiAl-base alloys. (author)

  18. In-reactor creep rupture behavior of the D9 alloys

    International Nuclear Information System (INIS)

    Puigh, R.J.; Hamilton, M.L.

    1986-06-01

    The uncertainties in the in-reactor stress rupture data have been significantly reduced with the acquisition of the Materials Open Test Assembly (MOTA) for testing of materials in the Fast Flux Test Facility (FFTF). The temperature uncertainty associated with irradiation in this vehicle is +- 5 0 C. Moreover, through the use of tag gases and an on-line cover gas monitoring system, on-line detection of specimen ruptures is possible during irradiation, thereby significantly reducing the uncertainty associated with the rupture times. Titanium additions, increases in nickel content and decreases in chromium content, which were made to improve the swelling response of 316 SS, resulted in an alloy class referred to as ''D9''. In-reactor stress rupture data from the MOTA experiment have been reported on two conditions of the D9-type alloys for exposure times corresponding to 2,400 hours at irradiation temperatures of 575, 605, 670, and 750 0 C. For these conditions the in-reactor rupture times were similar to those observed in thermal control tests. This report will describe both the in-reactor stress rupture behavior and the thermal control data for 20% cold work (CW) 316 SS and for 10 and 20% CW D9-type alloy over a similar temperature range for in-reactor exposure times corresponding to 13170 hr. and peak fast fluences corresponding to 17 x 10 22 n/cm 2 (E > 0.1 MeV)

  19. Some of the properties of plutonium and the aluminium-plutonium alloy; Quelques proprietes du plutonium et de l'alliage aluminium-plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Abramson, R; Boucher, R; Fabre, R; Monti, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1959-07-01

    1- Study of the physical properties of plutonium. 1) Study of the allotropy of plutonium. a) Thermal analysis: the apparatus used and the measurement technique are briefly described. The transition point temperatures and the corresponding heats of transformation have been determined. Finally, the results of the particular study of certain transition points are given. b) Dilatometry. The dilatometric analysis of the phase changes of plutonium has been carried out by means of the Chevenard dilatometer with photographic recording. The testing conditions (heating and cooling speeds, isotherm plateaux) have been varied in order to determine accurately the characteristics of each transition, particularly the {delta} {yields} {gamma} transition on cooling. 2) Micrography of plutonium. For the accurate preparation of metallographic samples the electrolytic polishing must be rapid, which implies a mechanical polishing of excellent quality. Information is given on new attacking reagents which show the structure of the metal very clearly. 2- Study of aluminium-plutonium alloys. Comparative study of Al-Pu and Al-U alloys rich in aluminium. a) Thermal analysis. The liquids and fusion temperatures of the eutectic Al-XAl{sub 4}, have been accurately determined. From the measurement of the heats of fusion the exact composition of the eutectic alloy has been determined. b) Thermal treatments. The eutectic coalescence kinetics have been studied by a micrographic method and by following the evolution of hardness. The results obtained show that the phenomenon is more rapid in Al-Pu alloys than in Al-U alloys. c) Micrographic study of the transition XAl{sub 3} {yields} XAl{sub 4}. The peritectic reaction XAl{sub 3} + liq. {yields} XAl{sub 4} has been suppressed by quenching. The transformation of the XAl{sub 3} phase to the solid phase has been studied as well as the effect of small additions of silicon on the kinetics of this reaction. (author) [French] 1- Etude des proprietes

  20. Contribution towards the study of {beta}{yields}{alpha} transformation in uranium and its alloys (1962); Contribution a l'etude de la transformation {beta}{yields}{alpha} dans l'uranium et ses alliages (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, H. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-05-15

    The kinetics of the transformation of uranium alloys containing 0.5 - 0.75 - 1.0 - 1.5 and 3 atoms per cent have been studied. The influence of heat treatment before decomposition has been discussed. The study of the transformation characteristics such as kinetics, residual phases, phenomena connected with the coherence between phases, reversibility below the equilibrium temperature, shows the following mechanisms exhibited during the decomposition of the {beta} phase on lowering the temperature: 1 ) eutectoid, 2) bainitic, 3) martensitic. The study of the TTT diagrams of alloys containing decreasing percentages of chromium indicates that the unalloyed uranium transforms without maintaining the coherence above 600 deg. C, where as at lower temperatures the transformation is mainly martensitic. The various alloying elements can be characterised by their influence on the three TTT curves corresponding to the three possible transformation mechanisms. The ability of the uranium alloys to alpha grain refining during isothermal decomposition or ambient temperature quenching is directly connected with the characteristics of the TTT diagrams and especially to the mode of bainitic transformation. (author) [French] II a ete etudie la cinetique de transformation des alliages uranium-chrome de teneur 0,5 - 0,75 - 1 - 1,5 - et 3 atomes pour cent. L'influence des traitements thermiques precedant la decomposition a ete discutee. L'etude des caracteristiques de la transformation: cinetique, phases residuelles, phenomenes lies a la coherence entre phases, reversibilite au-dessous de la temperature d'equilibre, permet de conclure que la decomposition met en jeu successivement les trois mecanismes eutectoide, bainitique et martensitique quand la temperature baisse. L'etude de l'evolution des diagrammes TTT quand la teneur en Cr decroit indique que dans l'uranium non allie la transformation se fait sans maintien de la coherence au-dessus de 600 deg. C; a

  1. Anodic electrochemical treatment of amorphous alloys

    International Nuclear Information System (INIS)

    Isaev, N.I.; Yakovlev, V.B.; Osipov, Eh.K.; Isaev, A.V.; Trofimova, E.A.; Vasil'ev, V.Yu.

    1983-01-01

    The aim of the investigation is to reveal peculiarities of the process of anodic oxidation and properties of anode oxide films, formed on the surface of amorphous alloys. Amorphous alloys on the base of rectifying metals of Zr-Ni, Zr-Cu-Ni, Zr-Al-Ni, Zr-Cu-Sn, Zr-Al, Zr-Mo systems are studied. Electrolytes which do not dissolve or weakly dissolve oxide film, such as boric acid electrolyte (40-45 g/l H 3 BO 3 and 18 cm 3 /l of the 25% aqueous NH 4 OH solution) and 20% H 2 SO 4 solution, are used for oxidation. Results of investigations, carried out on amorphous alloys, contaning noticeable quantities of non-rectifying components - Cu, Ni, Sn, Fe, Mo etc - have shown that non-rectifying components harden a process of anodic oxidation and decrease the current efficiency. Amorphous alloys, containing only rectifying components are oxidated in anodic way, the regularities of film growth being similar to those obtained for crystalline materials

  2. Structure of the oxide film on Ti–6Ta alloy after immersion test in 8 mol/L boiling nitric acid medium

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Dizi, E-mail: diziguo@126.com; Yang, Yingli; Wu, Jinping; Zhao, Bin; Zhao, Hengzhang; Su, Hangbiao; Lu, Yafeng

    2013-08-15

    Highlights: •Structure of the oxide film on Ti–6Ta alloy is studied by depth profile XPS. •TiO{sub 2} and Ta{sub 2}O{sub 5} are found in the top layer of the oxide film. •High valence oxide evolutes form Ti{sub 2}O{sub 3} and TaO. •Shielding effect of Ta{sub 2}O{sub 5} leads to the enhanced corrosion resistance of Ti–Ta alloy. -- Abstract: By using X-ray photoelectron spectroscopy (XPS), X-ray diffractometer (XRD) and scanning electron microscopy (SEM), we investigate the corrosion behavior and the structure of the oxide film of Ti–6Ta alloy that is subjected to the immersion corrosion test in 8 mol/L boiling nitric acid for 432 h. Based on the phase constitution indentified by depth profile XPS, the oxide film could be divided into three sub-layers along its thickness direction: the chemical stable TiO{sub 2} and Ta{sub 2}O{sub 5} are present in layer I; the sub-oxide Ti{sub 2}O{sub 3} and TaO are present in the layer II and layer III, and the high valence oxide evolutes from their sub-oxide gradually. Owing to the shielding effect of Ta{sub 2}O{sub 5}, the corrosion rate of the Ti–6Ta alloy decreases from 0.051 mm/y to 0.014 mm/y with increasing immersion time, showing an excellent corrosion resistance in 8 mol/L boiling nitric acid.

  3. Salt Fog Testing Iron-Based Amorphous Alloys

    International Nuclear Information System (INIS)

    Rebak, Raul B.; Aprigliano, Louis F.; Day, S. Daniel; Farmer, Joseph C.

    2007-01-01

    Iron-based amorphous alloys are hard and highly corrosion resistant, which make them desirable for salt water and other applications. These alloys can be produced as powder and can be deposited as coatings on any surface that needs to be protected from the environment. It was of interest to examine the behavior of these amorphous alloys in the standard salt-fog testing ASTM B 117. Three different amorphous coating compositions were deposited on 316L SS coupons and exposed for many cycles of the salt fog test. Other common engineering alloys such as 1018 carbon steel, 316L SS and Hastelloy C-22 were also tested together with the amorphous coatings. Results show that amorphous coatings are resistant to rusting in salt fog. Partial devitrification may be responsible for isolated rust spots in one of the coatings. (authors)

  4. The complex structure of liquid Cu{sub 6}Sn{sub 5} alloy

    Energy Technology Data Exchange (ETDEWEB)

    Qin Jingyu; Gu Tingkun; Bian Xiufang [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Southern Campus, Jinan 250061 (China); Liu Hui [Shandong High Performance Computing Center, Shandong University, Southern Campus, Jinan 250061 (China)

    2009-04-15

    By applying ab initio molecular dynamics simulation to liquid Cu{sub 6}Sn{sub 5} alloy, the hetero-coordination tendency is discovered by Bathia-Thornton partial correlation functions and a chemical short-range parameter. However the local structural environment of Sn in l-Cu{sub 6}Sn{sub 5} alloy resembles that of liquid Sn by Voronoi analysis. A new feature, i.e. a subpeak in between the first and second peaks, is discovered by the present method which implies that topologically disordered {beta}-Sn-type structural units may exist in l-Cu{sub 6}Sn{sub 5} alloy. The local density states of electrons show that both Cu-Sn and Sn-Sn bonding exist in l-Cu{sub 6}Sn{sub 5} alloy. This work suggests that chemical short-range order between unlike atoms and self-coordination between Sn atoms coexists in l-Cu{sub 6}Sn{sub 5} alloy.

  5. 48 CFR 22.605 - Rulings and interpretations of the Act.

    Science.gov (United States)

    2010-10-01

    ... Contracts Act 22.605 Rulings and interpretations of the Act. (a) As authorized by the Act, the Secretary of... less is subsequently modified to exceed $15,000, the contract becomes subject to the Act for work... modified by mutual agreement to $15,000 or less, the contract is not subject to the Act for work performed...

  6. Spin-flip transition of L10-type MnPt alloy single crystal studied by neutron scattering

    International Nuclear Information System (INIS)

    Hama, Hiroaki; Motomura, Ryo; Shinozaki, Tatsuya; Tsunoda, Yorihiko

    2007-01-01

    Magnetic structure, tetragonality, and the spin-flip transition for an L1 0 -type MnPt ordered alloy were studied by neutron scattering using a single-crystal specimen. Tetragonality of the lattice showed strong correlation with the spin-flip transition. Although the spin-flip transition looks like a gradual change of the easy axis in the temperature range between 580 and 770 K, two modes of magnon-gap peaks with different energies were observed in this transition temperature range. Thus, the crystal consists of two regions with different anisotropy energies and the volume fractions of these regions with different spin directions change gradually with temperature. The tetragonality and spin-flip transition are discussed using the hard-sphere model for atomic radii of Pt and Mn. The Invar effect of Mn atoms is proposed using high- and low-spin transitions of Mn moments in analogy with the two-γ model of Fe moments in FeNi Invar alloy

  7. Electrodeposition of bismuth alloys by the controlled potential method

    International Nuclear Information System (INIS)

    Lopez Alvarez, F.A.

    1993-01-01

    We worked with the electrodeposition of three bismuth alloys, the composition of the first electrolyte was: 0.3 g/l. Bi; 20 g/l. Ni; and the conditions were pH = 5.2 - 5.6; T = 25 Centigrade degrees; current density 0.3 A / dm 2 - 6.6 A / dm 2 . Following alloy was between Bi - Pb, composition of the electrolyte was 3.18 g/l. Bi (metallic); 31.81 g/l. Pb (Pb(NO 3 ) 2 ) pH : 1; T = 20 Centigrade degrees; current density 10.20 A/dm 2 . The third electrolyte was Bi-Cu, its composition was: 20.89 g/l. Bi; (metallic) 63.54 g/l Cu (Cu(NO 3 ) 2 ) pH : 1.5 - 1.8; T = 25-30 Centigrade degrees; current density 1-2 A/dm 2 . The best results were obtained with the third electrolyte. The purpose of this work was to experiment with different parameters like temperature, pH and the electrolyte concentration to obtain a bismuth alloy. (Author)

  8. Discontinuous structural phase transition of liquid metal and alloys (2)

    International Nuclear Information System (INIS)

    Wang, Li; Liu, Jiantong

    2004-01-01

    The diameter (d f ) of diffusion fluid cluster before and after phase transition has been calculated in terms of the paper ''Discontinuous structural phase transition of liquid metal and alloy (1)'' Physics Letters. A 326 (2004) 429-435, to verify quantitatively the discontinuity of structural phase transition; the phenomena of thermal contraction and thermal expansion during the phase transition, together with the evolution model of discontinuous structural phase transition are also discussed in this Letter to explore further the nature of structural transition; In addition, based on the viscosity experimental result mentioned in paper [Y. Waseda, The Structure of Non-Crystalline Materials--Liquids and Amorphous Solids, McGraw-Hill, New York, 1980], we present an approach to draw an embryo of the liquid-liquid (L-L) phase diagram for binary alloys above liquidus in the paper, expecting to guide metallurgy process so as to improve the properties of alloys. The idea that controls amorphous structure and its properties by means of the L-L phase diagram for alloys and by the rapid cooling technique to form the amorphous alloy has been brought forward in the end

  9. The electroplated Pd–Co alloy film on 316 L stainless steel and the corrosion resistance in boiling acetic acid and formic acid mixture with stirring

    Energy Technology Data Exchange (ETDEWEB)

    Li, Sirui; Zuo, Yu, E-mail: zuoy@mail.buct.edu.cn; Tang, Yuming; Zhao, Xuhui

    2014-12-01

    Highlights: • Pd–Co alloy films were deposited on 316 L stainless steel by electroplating. • The Pd–Co films show fine grain size, low porosity and obviously high hardness. • In strong acids with Br{sup −} and stirring, Pd–Co films show good corrosion resistance. • The high hardness of Pd–Co film retards the development of micro-pores in the film. - Abstract: Pd–Co alloy films were deposited on 316 L stainless steel by electroplating. Scanning electronic microscopy, X-ray photoelectron spectroscopy, X-ray diffraction, weight loss test and polarization test were used to determine the properties of the Pd–Co alloy films. The Pd–Co films show fine grain size, low porosity and obviously high micro-hardness. The Co content in the film can be controlled in a large range from 21.9 at.% to 57.42 at.%. Pd is rich on the Pd–Co film surface, which is benefit to increase the corrosion resistance. In boiling 90% acetic acid plus 10% formic acid mixture with 0.005 M Br{sup −} under stirring, the Pd–Co plated stainless steel samples exhibit evidently better corrosion resistance in contrast to Pd plated samples. The good corrosion resistance of the Pd–Co alloy film is explained by the better compactness, the lower porosity, and the obviously higher micro-hardness of the alloy films, which increases the resistance to erosion and retards the development of micro-pores in the film.

  10. Fracture toughness evaluation of select advanced replacement alloys for LWR core internals

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Lizhen [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Chen, Xiang [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-08-01

    Life extension of the existing nuclear reactors imposes irradiation of high fluences to structural materials, resulting in significant challenges to the traditional reactor materials such as type 304 and 316 stainless steels. Advanced alloys with superior radiation resistance will increase safety margins, design flexibility, and economics for not only the life extension of the existing fleet but also new builds with advanced reactor designs. The Electric Power Research Institute (EPRI) teamed up with Department of Energy (DOE) to initiate the Advanced Radiation Resistant Materials (ARRM) program, aiming to develop and test degradation resistant alloys from current commercial alloy specifications by 2021 to a new advanced alloy with superior degradation resistance in light water reactor (LWR)-relevant environments by 2024. Fracture toughness is one of the key engineering properties required for core internal materials. Together with other properties, which are being examined such as high-temperature steam oxidation resistance, radiation hardening, and irradiation-assisted stress corrosion cracking resistance, the alloys will be down-selected for neutron irradiation study and comprehensive post-irradiation examinations. According to the candidate alloys selected under the ARRM program, ductile fracture toughness of eight alloys was evaluated at room temperature and the LWR-relevant temperatures. The tested alloys include two ferritic alloys (Grade 92 and an oxide-dispersion-strengthened alloy 14YWT), two austenitic stainless steels (316L and 310), four Ni-base superalloys (718A, 725, 690, and X750). Alloy 316L and X750 are included as reference alloys for low- and high-strength alloys, respectively. Compact tension specimens in 0.25T and 0.2T were machined from the alloys in the T-L and R-L orientations according to the product forms of the alloys. This report summarizes the final results of the specimens tested and analyzed per ASTM Standard E1820. Unlike the

  11. Effect of alloying elements on martensitic transformation in the binary NiAl(β) phase alloys

    International Nuclear Information System (INIS)

    Kainuma, R.; Ohtani, H.; Ishida, K.

    1996-01-01

    The characteristics of the B2(β) to L1 0 (β') martensitic transformation in NiAl base alloys containing a small amount of third elements have been investigated by differential scanning calorimetry (DSC), X-ray diffraction (XRD), and transmission electron microscopy (TEM). It is found that in addition to the normal L1 0 (3R) martensite, the 7R martensite is also present in the ternary alloys containing Ti, Mo, Ag, Ta, or Zr. While the addition of third elements X (X: Ti, V, Cr, Mn, Fe, Zr, Nb, Mo, Ta, W, and Si) to the binary Ni 64 Al 36 alloy stabilizes the parent β phase, thereby lowering the M s temperature, addition of third elements such as Co, Cu, or Ag destabilizes the β phase, increasing the M s temperature. The occurrence of the 7R martensite structure is attributed to solid solution hardening arising from the difference in atomic size between Ni and Al and the third elements added. The variation in M s temperature with third element additions is primarily ascribed to the difference in lattice stabilities of the bcc and fcc phases of the alloying elements

  12. Advanced ordered intermetallic alloy deployment

    Energy Technology Data Exchange (ETDEWEB)

    Liu, C.T.; Maziasz, P.J.; Easton, D.S. [Oak Ridge National Lab., TN (United States)

    1997-04-01

    The need for high-strength, high-temperature, and light-weight materials for structural applications has generated a great deal of interest in ordered intermetallic alloys, particularly in {gamma}-based titanium aluminides {gamma}-based TiAl alloys offer an attractive mix of low density ({approximately}4g/cm{sup 3}), good creep resistance, and high-temperature strength and oxidation resistance. For rotating or high-speed components. TiAl also has a high damping coefficient which minimizes vibrations and noise. These alloys generally contain two phases. {alpha}{sub 2} (DO{sub 19} structure) and {gamma} (L 1{sub 0}), at temperatures below 1120{degrees}C, the euticoid temperature. The mechanical properties of TiAl-based alloys are sensitive to both alloy compositions and microstructure. Depending on heat-treatment and thermomechanical processing, microstructures with near equiaxed {gamma}, a duplex structure (a mix of the {gamma} and {alpha}{sub 2} phases) can be developed in TiAl alloys containing 45 to 50 at. % Al. The major concern for structural use of TiAl alloys is their low ductility and poor fracture resistance at ambient temperatures. The purpose of this project is to improve the fracture toughness of TiAl-based alloys by controlling alloy composition, microstructure and thermomechanical treatment. This work is expected to lead to the development of TiAl alloys with significantly improved fracture toughness and tensile ductility for structural use.

  13. 30 CFR 285.605 - What is a Site Assessment Plan (SAP)?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is a Site Assessment Plan (SAP)? 285.605... Assessment Plan (SAP)? (a) A SAP describes the activities (e.g., installation of meteorological towers... project easement, or to test technology devices. (1) Your SAP must describe how you will conduct your...

  14. Collective and tracer diffusion kinetics in the ternary random alloy

    International Nuclear Information System (INIS)

    Belova, I.V.; Murch, G.E.; Allnatt, A.R.

    2002-01-01

    In this study, collective and tracer diffusion kinetics is addressed for the ternary random alloy. A formal solution from the self-consistent theory of Moleko et al (Moleko L K, Allnatt A R and Allnatt E L 1989 Phil. Mag. A 59 141) is derived for collective diffusion and compared with the corresponding solution for the binary random alloy. Tracer diffusion in the ternary alloy is treated from the perspective of a special case of the quaternary random alloy. Results from Monte Carlo calculations for tracer and collective correlation factors (for the bcc ternary random alloy) are found to be in excellent agreement with this self-consistent theory but in only semi-quantitative agreement with the earlier theory of Manning (Manning J R 1971 Phys. Rev. B 4 1111). (author)

  15. 75 FR 7942 - Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and...

    Science.gov (United States)

    2010-02-23

    ... Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and -622R...-222 airplanes, all serial numbers. (2) Airbus Model A300 F4-605R and A300 F4-622R airplanes, all...

  16. Electrodeposition of white copper-tin alloys from alkaline cyanide solutions

    International Nuclear Information System (INIS)

    Purwadaria, H.S.; Zainal Arifin Ahmad

    2007-01-01

    Electrodeposition of white copper-tin alloys (including with mir alloys) has been done onto planar mild steel substrates from alkaline cyanide solutions at 65 degree C. The chemical composition of the coating is influenced by plating bath composition and current density. White mir alloy can be produced from the test solution containing 10 g/l CuCN 2 ,45 g/l Na 2 SnO 3 , 25 g/l NaCN, and 12 g/l NaOH at current density about 5 mA/cm?2. The local compositions of the coating cross section were analyzed using EDX installed in a FESEM operated at an accelerating voltage of 20 kV. The phases formed during co-deposition process were identified using XRD at 25 mA current and 35 kV voltage. (Author)

  17. Preparation of rare earth and other metal alloys containing aluminum and silicon

    International Nuclear Information System (INIS)

    Mitchell, A.; Goldsmith, J.R.; Gray, M.

    1981-01-01

    A method is provided for making alloys of aluminum and silicon with a third metal which may be a rare earth or a member of groups 4b, 5b, or 6b of the periodic table. The flux system CaF 2 -CaO-Al 2 O 3 is used as a solvent to provide a reactive medium for the alloy-forming reactions. Aluminum is supplied as a reducing agent, and silicon is added as a sink for the alloying metal. The resulting alloy may be used in steels. (L.L.)

  18. Effects of chemical composition on the corrosion of dental alloys.

    Science.gov (United States)

    Galo, Rodrigo; Ribeiro, Ricardo Faria; Rodrigues, Renata Cristina Silveira; Rocha, Luís Augusto; de Mattos, Maria da Glória Chiarello

    2012-01-01

    The aim of this study was to determine the effect of the oral environment on the corrosion of dental alloys with different compositions, using electrochemical methods. The corrosion rates were obtained from the current-potential curves and electrochemical impedance spectroscopy (EIS). The effect of artificial saliva on the corrosion of dental alloys was dependent on alloy composition. Dissolution of the ions occurred in all tested dental alloys and the results were strongly dependent on the general alloy composition. Regarding the alloys containing nickel, the Ni-Cr and Ni-Cr-Ti alloys released 0.62 mg/L of Ni on average, while the Co-Cr dental alloy released ions between 0.01 and 0.03 mg/L of Co and Cr, respectively.The open-circuit potential stabilized at a higher level with lower deviation (standard deviation: Ni-Cr-6Ti = 32 mV/SCE and Co-Cr = 54 mV/SCE). The potenciodynamic curves of the dental alloys showed that the Ni-based dental alloy with >70 wt% of Ni had a similar curve and the Co-Cr dental alloy showed a low current density and hence a high resistance to corrosion compared with the Ni-based dental alloys. Some changes in microstructure were observed and this fact influenced the corrosion behavior for the alloys. The lower corrosion resistance also led to greater release of nickel ions to the medium. The quantity of Co ions released from the Co-Cr-Mo alloy was relatively small in the solutions. In addition, the quantity of Cr ions released into the artificial saliva from the Co-Cr alloy was lower than Cr release from the Ni-based dental alloys.

  19. A new type of Ce-Mo based conversion coatings for aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Li Di; Li Guoqiang; Guo Baolan; Peng Mingxia [Coll. of Materials Science and Engineering, Beijing Univ. of Aeronautics and Astronautics, Beijing, BJ (China)

    2002-07-01

    A new type of process for forming Ce-Mo conversion coatings on Al-alloys has been developed. Conversion coatings about 3.6 {mu}m thickness were obtained by immersing Al-alloys for 20 minutes in boiling film forming solutions containing (NH{sub 4}){sub 2}Ce(NO{sub 3}){sub 6} 2.5 g/l, NaKC{sub 4}H{sub 4}O{sub 6}.4H{sub 2}O 2.5 g/l, Na{sub 2}CO{sub 3} 7.5 g/l and Na{sub 2}MoO{sub 4} 5.0 g/l. In the case of LF4 Al-alloy, polarization curves and immersion tests in 5% NaCl indicated that the conversion coatings exhibited more excellent resistance to localized corrosion than the conventional chromate conversion coatings. However, its resistance to localized corrosion was not satisfactory on LC4 Al alloy. Scanning electron microscopy (SEM) and energy dispersion analyzer of X-ray (EDAX) analysis revealed that the conversion coatings having complex surface microstructure on both LC4 and LF6 Al alloys consist mainly of O, Al and other alloying elements in addition to significant Ce and Mo. A mechanism of film formation was proposed to explain the experimental results. (orig.)

  20. Experimental investigation of Ti–6Al–4V titanium alloy and 304L stainless steel friction welded with copper interlayer

    Directory of Open Access Journals (Sweden)

    R. Kumar

    2015-03-01

    Full Text Available The basic principle of friction welding is intermetallic bonding at the stage of super plasticity attained with self-generating heat due to friction and finishing at upset pressure. Now the dissimilar metal joints are especially popular in defense, aerospace, automobile, bio-medical, refinery and nuclear engineerings. In friction welding, some special alloys with dual phase are not joined successfully due to poor bonding strength. The alloy surfaces after bonding also have metallurgical changes in the line of interfacing. The reported research work in this area is scanty. Although the sound weld zone of direct bonding between Ti–6Al–4V and SS304L was obtained though many trials, the joint was not successful. In this paper, the friction welding characteristics between Ti–6Al–4V and SS304L into which pure oxygen free copper (OFC was introduced as interlayer were investigated. Box–Behnken design was used to minimize the number of experiments to be performed. The weld joint was analyzed for its mechanical strength. The highest tensile strength between Ti–6Al–4V and SS304L between which pure copper was used as insert metal was acquired. Micro-structural analysis and elemental analysis were carried out by EDS, and the formation of intermetallic compound at the interface was identified by XRD analysis.

  1. Variations of color with alloying elements in Pd-free Au-Pt-based high noble dental alloys

    International Nuclear Information System (INIS)

    Shiraishi, Takanobu; Takuma, Yasuko; Miura, Eri; Fujita, Takeshi; Hisatsune, Kunihiro

    2007-01-01

    The effects of alloying addition of a small amount of base metals (In, Sn, Fe, Zn) on color variations in Pd-free Au-Pt-based high noble dental alloys were investigated in terms of rectilinear and polar color coordinates. The ternary Au-Pt-X (X = In, Sn, Fe, Zn) and quaternary Au-Pt-In-Y (Y = Sn, Fe, Zn) alloys were prepared from high purity component metals. The amount of alloying base metals, X and Y, were restricted up to 2 at.%. The alloying addition of a small amount of Fe, In, Sn, to a binary Au-10 at.% Pt alloy (referred to as AP10) effectively increased chroma, C *. On the other hand, the addition of Zn to the parent alloy AP10 did not change color coordinates greatly. The increase in chroma in the present Au-Pt-based high noble alloys was attributed to the increase in the slope of spectral reflectance curve at its absorption edge near 515 nm. It was found that the addition of a small amount of Fe to the parent alloy AP10 markedly increased lightness, L *, and the addition of Sn gave a very light tint of red to the parent alloy. Although red-green chromaticity index a * contributed to chroma to some extent, contribution of yellow-blue chromaticity index b * was much greater in determining chroma in this Pd-free Au-Pt-based multi-component alloys. The present results are expected to be valuable in case color is to be taken into account in designing Pd-free Au-Pt-based high noble dental alloys

  2. Variations of color with alloying elements in Pd-free Au-Pt-based high noble dental alloys

    Energy Technology Data Exchange (ETDEWEB)

    Shiraishi, Takanobu [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan)]. E-mail: siraisi@nagasaki-u.ac.jp; Takuma, Yasuko [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan); Miura, Eri [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan); Fujita, Takeshi [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan); Hisatsune, Kunihiro [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan)

    2007-06-15

    The effects of alloying addition of a small amount of base metals (In, Sn, Fe, Zn) on color variations in Pd-free Au-Pt-based high noble dental alloys were investigated in terms of rectilinear and polar color coordinates. The ternary Au-Pt-X (X = In, Sn, Fe, Zn) and quaternary Au-Pt-In-Y (Y = Sn, Fe, Zn) alloys were prepared from high purity component metals. The amount of alloying base metals, X and Y, were restricted up to 2 at.%. The alloying addition of a small amount of Fe, In, Sn, to a binary Au-10 at.% Pt alloy (referred to as AP10) effectively increased chroma, C *. On the other hand, the addition of Zn to the parent alloy AP10 did not change color coordinates greatly. The increase in chroma in the present Au-Pt-based high noble alloys was attributed to the increase in the slope of spectral reflectance curve at its absorption edge near 515 nm. It was found that the addition of a small amount of Fe to the parent alloy AP10 markedly increased lightness, L *, and the addition of Sn gave a very light tint of red to the parent alloy. Although red-green chromaticity index a * contributed to chroma to some extent, contribution of yellow-blue chromaticity index b * was much greater in determining chroma in this Pd-free Au-Pt-based multi-component alloys. The present results are expected to be valuable in case color is to be taken into account in designing Pd-free Au-Pt-based high noble dental alloys.

  3. Prevention of microcracking by REM addition to alloy 690 filler metal in laser clad welds

    International Nuclear Information System (INIS)

    Okauchi, Hironori; Saida, Kazuyoshi; Nishimoto, Kazutoshi

    2011-01-01

    Effect of REM addition to alloy 690 filler metal on microcracking prevention was verified in laser clad welding. Laser clad welding on alloy 132 weld metal or type 316L stainless steel was conducted using the five different filler metals of alloy 690 varying the La content. Ductility-dip crack occurred in laser clad welding when La-free alloy 690 filler metal was applied. Solidification and liquation cracks occurred contrarily in the laser cladding weld metal when the 0.07mass%La containing filler metal was applied. In case of laser clad welding on alloy 132 weld metal and type 316L stainless steel, the ductility-dip cracking susceptibility decreased, and solidification/liquation cracking susceptibilities increased with increasing the La content in the weld metal. The relation among the microcracking susceptibility, the (P+S) and La contents in every weld pass of the laser clad welding was investigated. Ductility-dip cracks occurred in the compositional range (atomic ratio) of La/(P+S) 0.99(on alloy 132 weld metal), >0.90 (on type 316L stainless steel), while any cracks did not occur at La/(P+S) being between 0.21-0.99 (on alloy 132 weld metal) 0.10-0.90 (on type 316L stainless steel). Laser clad welding test on type 316L stainless steel using alloy 690 filler metal containing the optimum La content verified that any microcracks did not occurred in the laser clad welding metal. (author)

  4. A jumping shape memory alloy under heat.

    Science.gov (United States)

    Yang, Shuiyuan; Omori, Toshihiro; Wang, Cuiping; Liu, Yong; Nagasako, Makoto; Ruan, Jingjing; Kainuma, Ryosuke; Ishida, Kiyohito; Liu, Xingjun

    2016-02-16

    Shape memory alloys are typical temperature-sensitive metallic functional materials due to superelasticity and shape recovery characteristics. The conventional shape memory effect involves the formation and deformation of thermally induced martensite and its reverse transformation. The shape recovery process usually takes place over a temperature range, showing relatively low temperature-sensitivity. Here we report novel Cu-Al-Fe-Mn shape memory alloys. Their stress-strain and shape recovery behaviors are clearly different from the conventional shape memory alloys. In this study, although the Cu-12.2Al-4.3Fe-6.6Mn and Cu-12.9Al-3.8Fe-5.6Mn alloys possess predominantly L2(1) parent before deformation, the 2H martensite stress-induced from L2(1) parent could be retained after unloading. Furthermore, their shape recovery response is extremely temperature-sensitive, in which a giant residual strain of about 9% recovers instantly and completely during heating. At the same time, the phenomenon of the jumping of the sample occurs. It is originated from the instantaneous completion of the reverse transformation of the stabilized 2H martensite. This novel Cu-Al-Fe-Mn shape memory alloys have great potentials as new temperature-sensitive functional materials.

  5. Anodic behavior of nickel alloys in media containing bicarbonate ions

    International Nuclear Information System (INIS)

    Zadorozne, N.S; Carranza, R. M.; Giordano, C.M.

    2011-01-01

    Alloy 22 has been designed to resist corrosion in oxidizing and reducing conditions. Thanks to these properties it is considered a possible candidate for the fabrication of containers of high-level radioactive waste. Since the containers provide services in natural environments characterized by multi-ionic solutions, it is estimated they could suffer three types of deterioration: general corrosion, localized corrosion (specifically crevice corrosion) and stress corrosion cracking (SCC). It has been confirmed that the presence of bicarbonate and chloride ions is required in order to produce cracking. It has also been determined that the susceptibility to SCC could be related to the occurrence of an anodic peak in the polarization curves in these media potentials below trans-passivity. The aim of this work is to study the anodic behavior of Alloy 22 in different media containing bicarbonate and chloride ions in various concentrations and temperatures and compare the results with other alloys containing nickel, and relate them to the susceptibility to stress corrosion cracking in a future job. Polarization curves were made on alloy 22 (Ni-Cr-Mo), 600 (Ni- Cr-Fe), 800h (Ni-Fe- Cr) and 201 (Ni commercially pure) in the following environments: 1.148 mol/L NaHCO 3 , 1.148 mol/L NaHCO 3 + 1 mol/L NaCl, 1.148 mol/L NaHCO 3 + 0.1 mol/L NaCl. The tests were performed at the following temperatures: 90°C, 75°C, 60°C and 25°C. It was found that alloy 22 has a current peak in the anodic domain at potentials below trans-passivity between 200 and 300 m VECS, when the test temperature was 90°C. The potential, at which this peak occurred, increased with decreasing temperature. Also there was a variation of the peak with the composition of the solution. When bicarbonate ions were added to a solution containing chloride ions, the peak potential shifted to higher current densities, depending on the concentration of added chloride ions. It was found that diminishing the content of

  6. Laser cladding of nickel base alloy on SS316L for improved wear and corrosion behaviour

    International Nuclear Information System (INIS)

    Awasthi, Reena; Kushwaha, R.P.; Chandra, Kamlesh; Viswanadham, C.S.; Srivastava, D.; Dey, G.K.; Limaye, P.K.

    2013-01-01

    Laser cladding by an Nd:YAG laser was employed to deposit Ni base alloy (Ni-Mo-Cr-Si) on stainless steel-316 L substrate. The resulting defect-free clad with minimum dilution of the substrate was characterized by optical microscopy, scanning electron microscopy, X-ray diffraction and Vickers microhardness test. Dry sliding wear of the cladding and the substrate was evaluated using a ball-on-plate reciprocating wear tester against different counter bodies (WC and 52100 Cr steel). The reciprocating sliding wear resistance of the coating was evaluated as a function of the normal load, keeping the sliding amplitude and sliding speed constant. Wear mechanisms were analyzed by observation of wear track morphology using SEM-EDS. The electrochemical corrosion behavior of clad layer was studied in reducing environment (HCl) to estimate the general corrosion resistance of the laser clad layer in comparison with the substrate SS-316L. The clad layer showed higher wear resistance under reducing condition than that of the substrate material stainless steel 316L. (author)

  7. Ductility of Mo–12Si–8.5B alloys doped with lanthanum oxide by the liquid–liquid doping method

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wenhu [School of Materials Science & Engineering, Xi’an University of Technology, Xi’an 710048 (China); School of Materials Science & Engineering, Shaanxi University of Technology, Hanzhong 723000 (China); Zhang, Guojun, E-mail: zhangguojun@xaut.edu.cn [School of Materials Science & Engineering, Xi’an University of Technology, Xi’an 710048 (China); Wang, Shixiong [School of Materials Science & Engineering, Xi’an University of Technology, Xi’an 710048 (China); Li, Bin; Sun, Jun [State Key Laboratory for Mechanical Behavior of Materials, Xi’an Jiaotong University, Xi’an 710049 (China)

    2015-09-05

    Highlights: • Alloys doping lanthanum oxide by L–L doped method were prepared by hot pressing. • The compression strength of alloys are superior. • The fracture toughness of alloys is improved by L–L doped method. - Abstract: Mo–12Si–8.5B (Mo–Si–B) alloys doped with different mass fractions (0.3 wt%, 0.6 wt%, and 0.9 wt%) of lanthanum oxide (La{sub 2}O{sub 3}) were prepared by liquid–liquid (L–L) doping, mechanical alloying and hot pressing sintering techniques. The observation of the microstructures of the Mo–Si–B alloys reveals that the grain sizes of the alloys were refined with the increase in La{sub 2}O{sub 3} doping. The fracture toughness values of the alloys of over 10 MPa m{sup 1/2} reveal that the addition of La{sub 2}O{sub 3} via the L–L doping method can obviously improve the alloy fracture toughness compared to the alloys doped with La{sub 2}O{sub 3} via the solid–solid (S–S) doping method. In addition, compression tests indicate that the compression strength of the alloys was improved compared to Mo–12Si–8.5B alloys.

  8. [The effect of epigallocatechin gallate (EGCG) on the surface properties of nickel-chromium dental casting alloys after electrochemical corrosion].

    Science.gov (United States)

    Qiao, Guang-yan; Zhang, Li-xia; Wang, Jue; Shen, Qing-ping; Su, Jian-sheng

    2014-08-01

    To investigate the effect of epigallocatechin gallate (EGCG) on the surface properties of nickel-chromium dental alloys after electrochemical corrosion. The surface morphology and surface structure of nickel-chromium dental alloys were examined by stereomicroscope and scanning electron microscopy before and after electrochemical tests in 0 g/L and 1.0 g/L EGCG artificial saliva. The surface element component and chemical states of nickel-chromium dental alloys were analyzed by X-ray photoelectron spectrograph after electrochemical tests in 0 g/L and 1.0 g/L EGCG artificial saliva. More serious corrosion happened on the surface of nickel-chromium alloy in 1.0 g/L EGCG artificial saliva than in 0 g/L EGCG. The diameters of corrosion pits were smaller, and the dendrite structure of the alloy surface was not affected in 0 g/L EGCG. While the diameters of corrosion pits were larger, the dendritic interval of the alloy surface began to merge, and the dendrite structure was fuzzy in 1.0 g/L EGCG. In addition, the O, Ni, Cr, Be, C and Mo elements were detected on the surface of nickel-chromium alloys after sputtered for 120 s in 0 g/L EGCG and 1.0 g/L EGCG artificial saliva after electrochemical corrosion, and the surface oxides were mainly NiO and Cr(2)O(3). Compared with 0 g/L EGCG artificial saliva, the content of O, NiO and Cr(2)O(3) were lower in 1.0 g/L EGCG. The results of surface morphology and the corrosion products both show that the corrosion resistance of nickel-chromium alloys become worse and the oxide content of corrosion products on the surface reduce in 1.0 g/L EGCG artificial saliva.

  9. Spin-orbit driven phenomena in the isoelectronic L1.sub.0./sub.-Fe(Pd,Pt) alloys from first principles

    Czech Academy of Sciences Publication Activity Database

    Kudrnovský, Josef; Drchal, Václav; Turek, Ilja

    2017-01-01

    Roč. 96, č. 21 (2017), s. 1-7, č. článku 214437. ISSN 2469-9950 R&D Projects: GA ČR GA15-13436S Institutional support: RVO:68378271 ; RVO:68081723 Keywords : anomalous Hall effect * Gilbert damping * partial order * first-principles * Fe(Pd,Pt) alloys Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 3.836, year: 2016

  10. Effects of lipopolysaccharides on the corrosion behavior of Ni-Cr and Co-Cr alloys.

    Science.gov (United States)

    Yu, Weiqiang; Qian, Chao; Weng, Weimin; Zhang, Songmei

    2016-08-01

    Lipopolysaccharides (LPS) are constituents of gingival crevicular fluid and may affect the base metal alloys used in metal ceramic crowns. The role of LPS in base metal alloys is currently unknown. The purpose of this in vitro study was to evaluate the effects of gram-negative bacterial LPS on the electrochemical behavior of Ni-Cr and Co-Cr alloys. Alloy specimens were divided into 4 groups according to Escherichia coli LPS concentration (0, 0.15, 15, and 150 μg/mL) in acidic saliva (pH 5). Open circuit potential (OCP) and potentiodynamic polarization behavior were examined using a computer-controlled potentiostat. Metal ions released from the 2 alloys were measured by immersion in LPS-free solution and 150 μg/mL LPS solution and analyzed by inductively coupled plasma atomic emission spectrometry (ICP-AES). Data were evaluated using 1-way ANOVA (α=.05). Compared with control groups, medium LPS concentration (15 μg/mL) accelerated Ni-Cr alloy corrosion (Palloy corrosion (Pcorrosion current density, and polarization resistance parameters. After immersion in high LPS concentrations (150 μg/mL), a slight increase in Ni ion release (P >.05) was observed for the Ni-Cr alloy, while a more significant Co ion release (Palloy. LPS negatively affected the electrochemical behavior of both the Ni-Cr and Co-Cr alloys. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  11. Mechanical properties and microstructure of copper alloys and copper alloy-stainless steel laminates for fusion reactor high heat flux applications

    Science.gov (United States)

    Leedy, Kevin Daniel

    A select group of copper alloys and bonded copper alloy-stainless steel panels are under consideration for heat sink applications in first wall and divertor structures of a planned thermonuclear fusion reactor. Because these materials must retain high strengths and withstand high heat fluxes, their material properties and microstructures must be well understood. Candidate copper alloys include precipitate strengthened CuNiBe and CuCrZr and dispersion strengthened Cu-Alsb2Osb3 (CuAl25). In this study, uniaxial mechanical fatigue tests were conducted on bulk copper alloy materials at temperatures up to 500sp°C in air and vacuum environments. Based on standardized mechanical properties measurement techniques, a series of tests were also implemented to characterize copper alloy-316L stainless steel joints produced by hot isostatic pressing or by explosive bonding. The correlation between mechanical properties and the microstructure of fatigued copper alloys and the interface of copper alloy-stainless steel laminates was examined. Commercial grades of these alloys were used to maintain a degree of standardization in the materials testing. The commercial alloys used were OMG Americas Glidcop CuAl25 and CuAl15; Brush Wellman Hycon 3HP and Trefimetaux CuNiBe; and Kabelmetal Elbrodur and Trefimetaux CuCrZr. CuAl25 and CuNiBe alloys possessed the best combination of fatigue resistance and microstructural stability. The CuAl25 alloy showed only minimal microstructural changes following fatigue while the CuNiBe alloy consistently exhibited the highest fatigue strength. Transmission electron microscopy observations revealed that small matrix grain sizes and high densities of submicron strengthening phases promoted homogeneous slip deformation in the copper alloys. Thus, highly organized fatigue dislocation structure formation, as commonly found in oxygen-free high conductivity Cu, was inhibited. A solid plate of CuAl25 alloy hot isostatically pressed to a 316L stainless steel

  12. Welding Metallurgy of Alloy HR-160

    International Nuclear Information System (INIS)

    DuPont, J.N.; Michael, J.R.; Newbury, B.D.

    1999-01-01

    The solidification behavior and resultant solidification cracking susceptibility of autogenous gas tungsten arc fusion welds in alloy HR-160 was investigated by Varestraint testing, differential thermal analysis, and various microstructural characterization techniques. The alloy exhibited a liquidus temperature of 1387 degC and initiated solidification by a primary L - γ reaction in which Ni, Si, and Ti segregated to the interdendritic liquid and Co segregated to the γ dendrite cores. Chromium exhibited no preference for segregation to the solid or liquid phase during solidification. Solidification terminated at ∼ 1162 degC by a eutectic-type L - [γ+ (Ni,Co) 16 (Ti,Cr) 6 Si 7 ] reaction. The (Ni,Co) 16 (Ti,Cr) 6 Si 7 phase is found to be analogous to the G phase which forms in the Ni-Ti-Si and Co-Ti-Si ternary systems, and similarities are found to exist between the solidification behavior of this commercial multicomponent alloy and the simple Ni-Si and Ni-Ti binary systems. Reasonable agreement is obtained between the calculated and measured volume percent of the [γ +(Ni,Co) l6 (Ti,Cr) 6 Si 7 ] eutectic-typr constituent with the Scheil equation using experimentally determined k values for Si and Ti from electron microprobe data. The alloy exhibited a very high susceptibility to solidification cracking in the Varestraint test. This is attributed to a large solidification temperature range of 225 degC and the presence of 2 to 5 vol% solute rich interdendritic liquid which preferentially wets the grain boundaries and interdendritic regions

  13. Electrical Resistance Alloys and Low-Expansion Alloys

    DEFF Research Database (Denmark)

    Kjer, Torben

    1996-01-01

    The article gives an overview of electrical resistance alloys and alloys with low thermal expansion. The electrical resistance alloys comprise resistance alloys, heating alloys and thermostat alloys. The low expansion alloys comprise alloys with very low expansion coefficients, alloys with very low...... thermoelastic coefficients and age hardenable low expansion alloys....

  14. Development of an efficient grain refiner for Al-7Si alloy

    Energy Technology Data Exchange (ETDEWEB)

    Kori, S.A.; Murty, B.S.; Chakraborty, M. [Indian Inst. of Technol., Kharagpur (India). Dept. of Metall. and Mater. Eng.

    2000-03-15

    The response of Al-7Si alloy towards grain refinement by Al-Ti-B master alloys (with different Ti-B ratios) at different addition levels has been studied in detail. The results indicate that high B-containing master alloys are powerful grain refiners when compared to conventional grain refiners like Al-5Ti-lB master alloys. In the present study, indigenously developed master alloys have been used for the grain refinement of alloys Al-7Si and LM-25. Significant improvements in mechanical properties have been obtained with a combination of grain refiner and Sr as modifier. (orig.)

  15. Soft x-ray emission studies of several aluminum alloys

    International Nuclear Information System (INIS)

    Tsang, K.L.; Zhang, C.H.; Callcott, T.A.; Arakawa, E.T.; Ederer, D.L.; Biancaniello, F.; Curelaru, I.

    1986-01-01

    During the first few months of operation of our soft x-ray spectrometer at the NSLS, we have measured the L emission spectrum for three classes of aluminum alloys: dilute aluminum-magnesium alloys to extend the Al-Mg system to the impurity limit; a 50-50 alloy of aluminum-lithium to characterize the band structure of bulk samples of this potential battery electrolite; and the icosahedral and normal Al-Mn alloys to see if the two phases had measurably different density of states which have been predicted. All spectra shown are produced when core holes generated by energetic electrons or photons are filled by radiative transitions from conduction band states. Dipole selection rules govern the transitions. Thus, K spectra provide a measure of the p-symmetic partial density of states (DOS) near the atom. Similarly, L spectra produced by transitions to p-core holes map the s and d symmetric DOS in the vicinity of the atom with the core hole

  16. Soft x-ray emission studies of several aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Tsang, K.L.; Zhang, C.H.; Callcott, T.A.; Arakawa, E.T.; Ederer, D.L.; Biancaniello, F.; Curelaru, I.

    1986-09-23

    During the first few months of operation of our soft x-ray spectrometer at the NSLS, we have measured the L emission spectrum for three classes of aluminum alloys: dilute aluminum-magnesium alloys to extend the Al-Mg system to the impurity limit; a 50-50 alloy of aluminum-lithium to characterize the band structure of bulk samples of this potential battery electrolite; and the icosahedral and normal Al-Mn alloys to see if the two phases had measurably different density of states which have been predicted. All spectra shown are produced when core holes generated by energetic electrons or photons are filled by radiative transitions from conduction band states. Dipole selection rules govern the transitions. Thus, K spectra provide a measure of the p-symmetic partial density of states (DOS) near the atom. Similarly, L spectra produced by transitions to p-core holes map the s and d symmetric DOS in the vicinity of the atom with the core hole.

  17. Electrochemical Evaluation of Si-Incorporated Diamond-Like Carbon (DLC) Coatings Deposited on STS 316L and Ti Alloy for Biomedical Applications

    International Nuclear Information System (INIS)

    Kim, Jung Gu; Lee, Kwang Ryeol; Kim, Young Sik; Hwang, Woon Suk

    2007-01-01

    DLC coatings have been deposited onto substrate of STS 316L and Ti alloy using r.f. PACVD (plasma-assisted chemical vapor deposition) with a mixture of C 6 H 6 and SiH 4 as the process gases. Corrosion performance of DLC coatings was investigated by electrochemical techniques (potentiodynamic polarization test and electrochemical impedance spectroscopy) and surface analysis (scanning electron microscopy). the electrolyte used in this test was a 0.89% NaCl solution of pH 7.4 at temperature 37 .deg. C. The porosity and protective efficiency of DLC coatings were obtained using potentiodynamic polarization test. Moreover, the delamination area and volume fraction of water uptake of DLC coatings ass a function of immersion time were calculated using electrochemical impedance spectroscopy. This study provides the reliable and quantitative data for assessment of the effect of substrate on corrosion performance of Si-DLC coatings. the results showed that Si-DLC coating on Ti alloy could improve corrosion resistance more than that on STS 316L in the simulated body fluid environment. This could be attributed to the formation of a dense and low-porosity coating, which impedes the penetration of water and ions

  18. Electronic properties of liquid Hg-In alloys : Ab-initio molecular dynamics study

    International Nuclear Information System (INIS)

    Sharma, Nalini; Ahluwalia, P. K.; Thakur, Anil

    2016-01-01

    Ab-initio molecular dynamics simulations are performed to study the structural properties of liquid Hg-In alloys. The interatomic interactions are described by ab-initio pseudopotentials given by Troullier and Martins. Three liquid Hg-In alloys (Hg_1_0In_9_0, Hg_3_0In_7_0_,_. Hg_5_0In_5_0, Hg_7_0In_3_0, and Hg_9_0Pb_1_0) at 299 K are considered. The calculated results for liquid Hg (l-Hg) and lead (l-In) are also drawn. Along with the calculated results of considered five liquid alloys of Hg-In alloy. The results obtained from electronic properties namely total density of state and partial density of states help to find the local arrangement of Hg and In atoms and the presence of liquid state in the considered five alloys.

  19. Integrated Computational Materials Engineering Development of Alternative Cu-Be Alloys

    Science.gov (United States)

    2012-08-01

    metastable FCC state @ Room temp.  Alloying to suppress martensitic transformation  Significant work-hardening associated with the phase... transformation  Existing CoCr alloy rely upon cold- or warm- work to achieve high strength (size dependent!) ● No equivalent to L12- strengthened Ni... strengthened Copper and Cobalt alloy VIM/VAR melting Homogen- ization Hot working >4” dia. Solution treatment Machining Tempering Processing

  20. Relationship of microstructure to fracture topography in orthopedic alloys

    International Nuclear Information System (INIS)

    Gilbertson, L.N.

    1976-01-01

    Two major alloys used for orthopedic implants are 316L stainless steel and a cast cobalt--chromium--molybdenum alloy similar to Haynes Stellite 21. Another alloy that is just being introduced is Ti--6Al--4V. All three of these alloys are used in different conditions with different microstructures. Standard specimens with typical microstructures encountered in orthopedic applications were loaded to fracture in both overload and fatigue modes. Different rates of loading were also used in some cases. The fracture surfaces of these standard samples were analyzed in the Scanning Electron Microscope. An attempt was made to relate the fracture behavior, as evidenced by the fracture typography, to the microstructure of the alloy as revealed by metallography

  1. Trace hydrogen extraction from liquid lithium tin alloy

    International Nuclear Information System (INIS)

    Xie Bo; Hu Rui; Xie Shuxian; Weng Kuiping

    2010-01-01

    In order to finish the design of tritium extraction system (TES) of fusion fission hybrid reactor (FFHR) tritium blanket, involving the dynamic mathematical model of liquid metal in contact with a gaseous atmosphere, approximate mathematical equation of tritium in lithium tin alloy was deduced. Moreover, carrying process used for trace hydrogen extraction from liquid lithium tin alloy was investigated with hydrogen being used to simulate tritium in the study. The study results indicate that carrying process is effective way for hydrogen extraction from liquid lithium tin alloy, and the best flow velocity of carrier gas is about 4 L/min under 1 kg alloy temperatures and carrying numbers are the main influencing factors of hydrogen number. Hydrogen extraction efficiency can reach 85% while the alloy sample is treated 6 times at 823 K. (authors)

  2. Effect of the addition of Al-Ti-C master alloy on the microstructure and microhardness of a cast Al-10Mg alloy

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The microstructure and microhardness of a cast Al-10wt%Mg (henceforth Al-l0Mg) alloy with 0.2wt% addition of Al-5Ti-0.25C master alloy were compared with those of a refiner-free alloy of similar chemical composition.It was found that this level of the master alloy addition not only caused an effective grain refinement, but also caused a significant increase in the microhardness of the Al-10Mg alloy.Microchemical analysis revealed that TiC particles existed in the grain center.The relationship between the holding time and grain size was also studied.It shows that the grain refining efficiency is faded observably with the holding time.This is explained in terms of the instability of TiC particles.

  3. Thermoelastic martensite and shape memory effect in ductile Cu-Al-Mn alloys

    Science.gov (United States)

    Kainuma, R.; Takahashi, S.; Ishida, K.

    1996-08-01

    Ductile shape memory (SM) alloys of the Cu-AI-Mn system have been developed by controlling the degree of order in the β phase. Additions of Mn to the binary Cu-Al alloy stabilize the β phase and widen the single-phase region to lower temperature and lower Al contents. It is shown that Cu-Al-Mn alloys with low Al contents have either the disordered A2 structure or the ordered L21 structure with a lower degree of order and that they exhibit excellent ductility. The disordered A2 phase martensitically transforms to the disordered Al phase with a high density of twins. The martensite phase formed from the ordered L21 phase has the 18R structure. The SM effect accompanies both the A2 → Al and L21 → 18R martensitic transformations. These alloys exhibit 15 pct strain to failure, 60 to 90 pct rolling reduction without cracking, and 80 to 90 pct recovery from bend test in the martensitic condition. Experimental results on the microstructure, crystal structure, mechanical properties, and shape memory behavior in the ductile Cu-AI-Mn alloys are presented and discussed.

  4. The Relation Between Alloy Chemistry and Hot-Cracking

    Science.gov (United States)

    Nunes, A. C., Jr.; Talia, J. E.

    2000-01-01

    Hot cracking is a problem in welding 2195 aluminum-lithium alloy. Weld wire additives seem to reduce the problem. This study proposes a model intended to clarify the way alloying elements affect hot-cracking. The brittle temperature range of an alloy extends wherever the tensile stress required to move the meniscus of the liquid film at the grain/dendrite boundaries is less than the bulks flow stress Sigma(sub B) of the grains: 2gamma/delta alloys outgas.) If the above condition is not met, the grains deform under stress and the liquid film remains in place. Curves of 2gamma/delta and sigma(sub B) vs. temperature in the range just below the melting temperature determine the hot cracking susceptibility of an alloy. Both are zero at onset of solidification. sigma(sub B) rises as the thermal activation of the slip mechanism is reduced. 2gamma/delta rises as the film thickness delta which can be estimated from the Scheil equation, drops. But, given an embrittled alloy, whether the alloy actually cracks is determined by the strain imposed upon it in the embrittled condition. A critical strain is estimated, Epsilon(sub C) on the order of Epsilon(sub C) is approximately delta/l where L = grain size and where the the volume increment due to the strain, concentrated at the liquid film, is on the order of the liquid film volume. In the early 80's an empirical critical strain cracking envelope Epsilon(sub C)(T) was incorporated into a damage criterion to estimate the effect of welding parameters on the formation of microfissures in a superalloy with good results. These concepts, liquid film decoherence vs. grain bulk deformation and critical strain, form the key elements of a quantitative theory of hot-cracking applicable for assessing the effect of alloying elements on hot-cracking during welding.

  5. Anisotropy of the ferromagnetic L10 phase in the Mn-Al-C alloys induced by high-pressure spark plasma sintering

    Science.gov (United States)

    Tyrman, Muriel; Ahmim, Smail; Pasko, Alexandre; Etgens, Victor; Mazaleyrat, Frédéric; Quetel-Weben, Simon; Perrière, Loïc; Guillot, Ivan

    2018-05-01

    The metastable τ-phase of MnAl equi-atomic compound belongs to a family of ferromagnetic alloys with L10 crystal structure. Stabilization of the phase by adding 2 at. % using manganese carbide (Mn23C6) enhances the magnetization in relation with the increase in lattice volume. It is thus a promising candidate for rare-earth-free permanent magnets. Coercivity of Mn-Al-C alloys being still weak, there is an interest to see to which extend sintering/transformation of the ɛ-phase by Spark Plasma Sintering (SPS) can increase the coercivity and the anisotropy. The structural and the magnetic properties were studied for samples sintered at 550 °C under uniaxial pressure of 100, 200, 300 and 400 MPa. Coercivity, remanence and anistotropy appears with the sintering pressure. The high pressure applied while sintering produces preferential orientation of the flake-shaped grains which influences the remanence.

  6. Silicon Alloying On Aluminium Based Alloy Surface

    International Nuclear Information System (INIS)

    Suryanto

    2002-01-01

    Silicon alloying on surface of aluminium based alloy was carried out using electron beam. This is performed in order to enhance tribological properties of the alloy. Silicon is considered most important alloying element in aluminium alloy, particularly for tribological components. Prior to silicon alloying. aluminium substrate were painted with binder and silicon powder and dried in a furnace. Silicon alloying were carried out in a vacuum chamber. The Silicon alloyed materials were assessed using some techniques. The results show that silicon alloying formed a composite metal-non metal system in which silicon particles are dispersed in the alloyed layer. Silicon content in the alloyed layer is about 40% while in other place is only 10.5 %. The hardness of layer changes significantly. The wear properties of the alloying alloys increase. Silicon surface alloying also reduced the coefficient of friction for sliding against a hardened steel counter face, which could otherwise be higher because of the strong adhesion of aluminium to steel. The hardness of the silicon surface alloyed material dropped when it underwent a heating cycle similar to the ion coating process. Hence, silicon alloying is not a suitable choice for use as an intermediate layer for duplex treatment

  7. PDS 1-5. Divertor heat sink materials pre- and post-neutron irradiation. Tensile and fatigue tests of brazed joints of molybdenum alloys and 316L stainless steel

    International Nuclear Information System (INIS)

    Lind, Anders.

    1994-01-01

    Tensile specimens from brazed joints of molybdenum alloys (TZM or Mo-5%Re) and Type 316L austenitic stainless steel tubes have been tested at ambient temperature and 127 degrees C before and after neutron irradiation at about 40 degrees C to approximately 0.2 dpa. The unirradiated specimens showed generally ductile behaviour, but the irradiated specimens were notch sensitive and failed in a brittle manner with zero elongation; in all cases the fracture occurred in the molybdenum alloy. The brittle behaviour is consistent with previously published data and results from the increase in strength (radiation hardening) and the associated increase in the ductile-brittle transition temperature (radiation embrittlement) induced in the body-centered-cubic (BCC) molybdenum alloys by irradiation to relatively low displacement doses. The same type of irradiated specimens were also used in fatigue tests. However, the results from the fatigue tests are too limited and complementary studies are needed. During exposure to water locally up to 25% of the wall thickness of the Mo-alloys has corroded away. These observations cast serious doubts on the viability of the molybdenum alloys for divertor applications in fusion systems. 8 refs, 29 figs

  8. Computational design of precipitation-strengthened titanium-nickel-based shape memory alloys

    Science.gov (United States)

    Bender, Matthew D.

    Motivated by performance requirements of future medical stent applications, experimental research addresses the design of novel TiNi-based, superelastic shape-memory alloys employing nanoscale precipitation strengthening to minimize accommodation slip for cyclic stability and to increase output stress capability for smaller devices. Using a thermodynamic database describing the B2 and L21 phases in the Al-Ni-Ti-Zr system, Thermo-Calc software was used to assist modeling the evolution of phase composition during 600°C isothermal evolution of coherent L21 Heusler phase precipitation from supersaturated TiNi-based B2 phase matrix in an alloy experimentally characterized by atomic-scale Local Electrode Atom Probe (LEAP) microanalysis. Based on measured evolution of the alloy hardness (under conditions stable against martensitic transformation) a model for the combined effects of solid solution strengthening and precipitation strengthening was calibrated, and the optimum particle size for efficient strengthening was identified. Thermodynamic modeling of the evolution of measured phase fractions and compositions identified the interfacial capillary energy enabling thermodynamic design of alloy microstructure with the optimal strengthening particle size. Extension of alloy designs to incorporate Pt and Pd for reducing Ni content, enhancing radiopacity, and improving manufacturability were considered using measured Pt and Pd B2/L2 1 partitioning coefficients. After determining that Pt partitioning greatly increases interphase misfit, full attention was devoted to Pd alloy designs. A quantitative approach to radiopacity was employed using mass attenuation as a metric. Radiopacity improvements were also qualitatively observed using x-ray fluoroscopy. Transformation temperatures were experimentally measured as a function of Al and Pd content. Redlich-Kister polynomial modeling was utilized for the dependence of transformation reversion Af temperature on B2 matrix phase

  9. Interfacial Reaction During Dissimilar Joining of Aluminum Alloy to Magnesium and Titanium Alloys

    Science.gov (United States)

    Robson, J. D.; Panteli, A.; Zhang, C. Q.; Baptiste, D.; Cai, E.; Prangnell, P. B.

    Ultrasonic welding (USW), a solid state joining process, has been used to produce welds between AA6111 aluminum alloy and AZ31 magnesium alloys or titanium alloy Ti-6Al-4V. The mechanical properties of the welds have been assessed and it has been shown that it is the nature and thickness of the intermetallic compounds (IMCs) at the joint line that are critical in determining joint strength and particularly fracture energy. Al-Mg welds suffer from a very low fracture energy, even when strength is comparable with that of similar metal Mg-Mg welds, due to a thick IMC layer always being formed. It is demonstrated that in USW of Al-Ti alloy the slow interdiffusion kinetics means that an IMC layer does not form during welding, and fracture energy is greater. A model has been developed to predict IMC formation during welding and provide an understanding of the critical factors that determine the IMC thickness. It is predicted that in Al-Mg welds, most of the lMC thickening occurs whilst the IMC regions grow as separate islands, prior to the formation of a continuous layer.

  10. Flexibility and trackability of laser cut coronary stent systems.

    Science.gov (United States)

    Szabadíts, Péter; Puskás, Zsolt; Dobránszky, János

    2009-01-01

    Coronary stents are the most important supports in present day cardiology. Flexibility and trackability are two basic features of stents. In this paper, four different balloon-expandable coronary stent systems were investigated mechanically in order to compare their suitability. The coronary stent systems were assessed by measurements of stent flexibility as well as by comparison of forces during simulated stenting in a self-investigated coronary vessel model. The stents were cut by laser from a single tube of 316L stainless steel or L-605 (CoCr) cobalt chromium alloy. The one-and four-point bending tests were carried out to evaluate the stent flexibility E x I (Nmm(2)), under displacement control in crimped and expanded configurations. The flexibility of stents would be rather dependent on the design than on raw material. In general a more flexible stent needs lower tracking force during the implantation. The L-605 raw material stents need lower track force to pass through in the vessel model than the 316L raw material stents. The sort and long stents passed through the curved vessel model in different ways. The long stents nestled to the vessel wall at the outer arc and bent, while the short stents did not bend in the curve, only the delivery systems bent.

  11. Synthesis of nano-crystalline Zn-Ni alloy coatings by D.C plating

    International Nuclear Information System (INIS)

    Rizwan, R.; Mehmood, M.; Imran, M.; Akhtar, J.I.

    2006-01-01

    Nano crystalline Zinc-Nickel Alloy coatings were obtained from additive free chloride bath. The aqueous bath composition was varied from ZnCl/sub 2/ -200 g/l to 50 g/l, NiCI/sub 2/ 6H/sub 2/O -200 g/l to 50 g/l and H/sub 3/BO/sub 3/ -40 g/l. XRD patterns of electrodeposited alloys on copper substrate revealed the presence of gamma (Ni/sub 5/Zn/sub 21/) inter-metallic compound and eta (solid solution of nickel in zinc). The apparent grain size measured from FWHM of XRD reflections was found to be about 20nm- 50nm depending upon deposit composition. Analysis by EDX of deposits confirms the presence of Zn (81 to 94%), and Ni (6-19%) depending upon bath composition and current density applied. With increase in bath temperature deposition and dissolution potentials are shifted to nobler values. The temperature also affects the phase composition of alloy deposited. Cyclic Voltametry was performed on platinum substrate and deposits obtained for short duration exhibit voltamograms that reflects strong dependence of alloy components on solution chemistry during initial stage of deposition. Hence, initial composition of the deposit varies with solution chemistry but composition becomes almost independent of solution chemistry for thick deposits. The grain size of the deposits also depends upon the composition of deposit. (author)

  12. Dendritic solidification and thermal expansion of refractory Nb-Zr alloys investigated by electrostatic levitation

    Energy Technology Data Exchange (ETDEWEB)

    Yang, S.J.; Hu, L.; Wang, L.; Wei, B. [Northwestern Polytechnical University, Department of Applied Physics, Xi' an (China)

    2017-05-15

    The dendritic growth and thermal expansion of isomorphous refractory Nb-5%Zr, Nb-10%Zr, and Nb-15%Zr alloys were studied by electrostatic levitation technique. The obtained maximum undercoolings for the three alloys were 534 (0.2T{sub L}), 498 (0.19T{sub L}), and 483 K (0.18T{sub L}), respectively. Within these undercooling ranges, the dendritic growth velocities of the three alloys all exhibited power laws, and achieved 38.5, 34.0, and 27.1 m s{sup -1} at each maximum undercooling. The microstructures were characterized by coarse dendrites at small undercooling, while they transformed into refined dendrites under large undercooling condition. In addition, the measured thermal expansion coefficients of solid Nb-Zr alloys increased linearly with temperature. The values at liquid state were more than double of those at solid state, which also displayed linear dependence on temperature. (orig.)

  13. Order/disorder in electrodeposited aluminum-titanium alloys

    Directory of Open Access Journals (Sweden)

    Stafford G.R.

    2003-01-01

    Full Text Available The composition, morphology, and crystallographic microstructure of Al-Ti alloys electrodeposited from two different chloroaluminate molten salt electrolytes were examined. Alloys containing up to 28 % atomic fraction Ti were electrodeposited at 150 °C from 2:1 AlCl3-NaCl with controlled additions of Ti2+. The apparent limit on alloy composition is proposed to be due to a mechanism by which Al3Ti forms through the reductive decomposition of [Ti(AlCl43]-. The composition of Al-Ti alloys electrodeposited from the AlCl3-EtMeImCl melt at 80 °C is limited by the diffusion of Ti2+ to the electrode surface. Alloys containing up to 18.4 % atomic fraction Ti are only obtainable at high Ti2+ concentrations in the melt and low current densities. Alloys electrodeposited from the higher temperature melt have an ordered L12 crystal structure while alloys of similar composition but deposited at lower temperature are disordered fcc. The appearance of antiphase boundaries in the ordered alloys suggests that the deposit may be disordered initially and then orders in the solid state, subsequent to the charge transfer step and adatom incorporation into the lattice. This is very similar to the disorder-trapping observed in rapidly solidified alloys. The measured domain size is consistent with a mechanism of diffusion-controlled doman growth at the examined deposition temperatures and times.

  14. Corrosion of high purity Fe-Cr-Ni alloys in 13 N boiling nitric acid

    International Nuclear Information System (INIS)

    Ohta, Joji; Mayuzumi, Masami; Kusanagi, Hideo; Takaku, Hiroshi

    1998-01-01

    Corrosion in boiling nitric acid was investigated for high purity Fe-18%Cr-12%Ni alloys and type 304L stainless steels (SS). Owing to very low impurity concentration, the solution treated high purity alloys show almost no intergranular corrosion while the type 304L SS show severe intergranular corrosion. Both in the high purity alloys and type 304L SS, aging treatments ranging from 873 K to 1073 K for 1 h enhance intergranular corrosion. During the aging treatments, impurities should be segregated to the grain boundaries. The corrosion behaviors were discussed from a standpoint of impurity segregation to grain boundaries. This study is of importance for purex reprocessing of spent fuels

  15. Structure of as cast L12 compounds in Al3Zr-base alloys containing Cu and Mn

    International Nuclear Information System (INIS)

    Virk, I.S.; Varin, R.A.

    1991-01-01

    It was first shown that the low symmetry, tetragonal DO 23 crystal structure of Al 3 Zr intermetallic can be changed to the related cubic L1 2 crystal structure by alloying with Ni (Al 5 NiZr 2 ) and Cu(Al 5 CuZr 2 ). It has been reported that previous work has successfully modified Al 3 Zr with Fe, Cu, Cr and Ni obtaining nearly single phase materials with L1 2 structure. However, they only studied the microstructure and mechanical properties of Fe - modified intermetallic (Al-6at% Fe-25at% Zr). The purpose of the paper is to describe and interpret experimental observations on the microstructure of Al 5 CuZr 2 and Al 66 Mn 9 Zr 25 (at.%) modifications of base Al 3 Zr intermetallic. The one modified with Mn has not been reported in literature although its Al 3 Ti - base counterpart has recently been successfully produced (3, 4)

  16. Search for fully compensated ferrimagnet in Co substituted Mn2VGa alloy

    International Nuclear Information System (INIS)

    Deka, Bhargab; Singh, R.K.; Srinivasan, A.

    2015-01-01

    Crystallographic and magnetic properties of bulk (Mn 1−x Co x ) 2 VGa alloys with 0≤x≤0.50 are reported in this work. All the alloys exhibit stable L2 1 structure. Unit cell volume of this series of alloys decreased from 207.5 Å 3 to 195.1 Å 3 as x was increased from 0 to 0.50. All the alloys shows ferrimagnetic behavior with Curie temperature decreasing from 763 K to 367 K with increase in x. Saturation magnetization (M s ) measured for the alloys with x=0, 0.25 and 0.50 are 1.84 μ B /f.u., 0.85 μ B /f.u. and 0.30 μ B /f.u., respectively, as compared to the values of 2.00 μ B /f.u., 1.00 μ B /f.u. and 0 μ B /f.u., predicted by the Slater–Pauling (S–P) rule. While explaining the deviations in the M s from the values predicted by the S–P rule, a fully compensated ferrimagnet is expected in an alloy with total number of valance electrons of 24.1. - Highlights: • (Mn 1−x Co x ) 2 VGa alloys with highly ordered L2 1 structure has been obtained • With Co substitution, magnetization of (Mn 1-x Co x ) 2 VGa alloys reduces to 0.3= B /f.u. • Fully compensated ferrimagnet is expected in the alloy with 24.1 valance electrons

  17. A self-consistent mean field theory for diffusion in alloys

    International Nuclear Information System (INIS)

    Nastar, M.; Barbe, V.

    2007-01-01

    Starting from a microscopic model of the atomic transport via vacancies and interstitials in alloys, a self-consistent mean field (SCMF) kinetic theory yields the phenomenological coefficients L ij . In this theory, kinetic correlations are accounted for through a set of effective interactions within a non-equilibrium distribution function of the system. The introduction of a master equation describing the evolution with time of the distribution function and its moments leads to general self-consistent kinetic equations. The L ij of a face centered cubic alloy are calculated using the kinetic equations of Nastar (M. Nastar, Philos. Mag., 2005, 85, 3767, ref. 1) derived from a microscopic broken bond model of the vacancy jump frequency. A first approximation leads to an analytical expression of the L ij and a second approximation to a better agreement with the Monte Carlo simulations. A change of sign of the L ij is studied as a function of the microscopic parameters of the jump frequency. The L ij of a cubic centered alloy obtained for the complex diffusion mechanism of the dumbbell configuration of the interstitial are used to study the effect of an on-site rotation of the dumbbell on the transport. (authors)

  18. High-temperature steam oxidation testing of select advanced replacement alloys for potential core internals

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Lizhen [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pint, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-05-19

    Coupons from a total of fourteen commercial and custom fabricated alloys were exposed to 1 bar full steam with ~10 ppb oxygen content at 600 and 650°C. The coupons were weighed at 500-h intervals with a total exposure time of 5,000 h. The fourteen alloys are candidate alloys selected under the ARRM program, which include three ferritic steels (Grade 92, 439, and 14YWT), three austenitic stainless steels (316L, 310, and 800), seven Ni-base superalloys (X750, 725, C22, 690, 625, 625 direct-aging, and 625- plus), and one Zr-alloy (Zr–2.5Nb). Among the alloys, 316L and X750 are served as reference alloys for low- and high-strength alloys, respectively. The candidate Ni-base superalloy 718 was procured too late to be included in the tests. The corrosion rates of the candidate alloys can be approximately interpreted by their Cr, Ni and Fe content. The corrosion rate was significantly reduced with increasing Cr content and when Ni content is above ~15 wt%, but not much further reduced when Fe content is less than ~55 wt%. Simplified thermodynamics analyses of the alloy oxidation provided reasonable indications for the constituents of oxide scales formed on the alloys and explanations for the porosity and exfoliation phenomena because of the nature of specific types of oxides.

  19. Investigation into cathode polarization during deposition of rhodium-nickel and rhodium-indium alloys

    International Nuclear Information System (INIS)

    Evdokimova, N.V.; Byacheslavov, P.M.; Lokshtanova, O.G.

    1979-01-01

    The results of kinetic regularities experimental investigations during electrodeposition of rhodium-nickel and rhonium-indium alloys are presented. Methods of general and partial polarization curves have been used to show the nature of polarization during the rhonium-nickel and rhodium-indium alloys deposition. It is shown that indium into the rhodium-indium alloy and nickel into the rhodium-nickel alloy deposit with great depolarization ( PHIsub(In)sup(0)=-0.33B, PHIsub(Ni)sup(0)=-0.23B). Indium and nickel in pure form do not deposit from the electrolytes of the given composition (H 2 SO 4 - 50 g/l, HNH 2 SO 3 -10 g/l). The recalculation of partial polarization curve of indium precipitation into the rhodium-indium alloy in the mixed kinetics coordinates gives a straight line with 40 mV inclination angle. This corresponds to the delayed stage of the second electron addition with the imposition of diffusion limitations

  20. 5 CFR 847.605 - Methodology for determining the present value of annuity with service credit.

    Science.gov (United States)

    2010-01-01

    ... Retroactive Provisions § 847.605 Methodology for determining the present value of annuity with service credit. (a) OPM will determine the present value of the annuity including service credit for NAFI service..., the present value under paragraph (a) of this section equals the monthly annuity rate including credit...

  1. Inhibitive Action of Ferrous Gluconate on Aluminum Alloy in Saline Environment

    Directory of Open Access Journals (Sweden)

    Patricia Abimbola Idowu Popoola

    2013-01-01

    Full Text Available The corrosion of aluminum in saline environment in the presence of ferrous gluconate was studied using weight loss and linear polarization methods. The corrosion rates were studied in different concentrations of ferrous gluconate 0.5, 1.0, 1.5, and 2.0 g/mL at 28°C. Experimental results revealed that ferrous gluconate in saline environment reduced the corrosion rate of aluminum alloy at the different concentrations studied. The minimum inhibition efficiency was obtained at 1.5 g/mL concentration of inhibitor while the optimum inhibition efficiency was achieved with 1.0 g/mL inhibitor concentration. The results showed that adsorption of ferrous gluconate on the aluminium alloy surface fits Langmuir adsorption isotherm. The potentiodynamic polarization results showed that ferrous gluconate is a mixed type inhibitor. Ferrous gluconate acted as an effective inhibitor for aluminium alloy within the temperature and concentration range studied. The data obtained from weight loss and potentiodynamic polarization methods were in good agreement.

  2. Structure and stacking faults in layered Mg-Zn-Y alloys: A first-principles study

    International Nuclear Information System (INIS)

    Datta, Aditi; Waghmare, U.V.; Ramamurty, U.

    2008-01-01

    We use first-principles density functional theory total energy calculations based on pseudo-potentials and plane-wave basis to assess stability of the periodic structures with different stacking sequences in Mg-Zn-Y alloys. For pure Mg, we find that the 6-layer (6l) structure with the ABACAB stacking is most stable after the lowest energy hcp (2l) structure with ABAB stacking. Addition of 2 at.% Y leads to stabilization of the structure to 6l sequence whereas the addition of 2 at.% Zn makes the 6l energetically comparable to that of the hcp. Stacking fault (SF) on the basal plane of 6l structure is higher in energy than that of the hcp 2l Mg, which further increases upon Y doping and decreases significantly with Zn doping. SF energy surface for the prismatic slip indicates activation of non-basal slip in alloys with a 6l structure. Charge density analysis shows that the 2l and 6l structures are electronically similar which might be a cause for better stability of 6l structure over a 4l sequence or other periodic structures. Thus, in an Mg-Zn-Y alloy, Y stabilizes the long periodicity, while its mechanical properties are further improved due to Zn doping

  3. Kinetic study of hydrogen-material interactions in nickel base alloy 600 and stainless steel 316L through coupled experimental and numerical analysis

    International Nuclear Information System (INIS)

    Hurley, Caitlin-Mae

    2015-01-01

    In France all of the nuclear power plant facilities in service today are pressurized water reactors (PWR). Some parts of the PWR in contact with the primary circuit medium, such as the steam generator tubes (fabricated in nickel base alloy A600) and some reactor core internal components (fabricated in stainless steel 316L), can fall victim to environmental degradation phenomena such as stress corrosion cracking (SCC). In the late 1950's, H. Coriou observed experimentally and predicted this type of cracking in alloys traditionally renowned for their SCC resistance (A600). Just some 20 to 30 years later his predictions became a reality. Since then, numerous studies have focused on the description and comprehension of the SCC phenomenon in primary water under reactor operating conditions. In view of reactor lifetime extension, it has become both critical and strategic to be capable of simulating SCC phenomenon in order to optimize construction materials, operating conditions, etc. and to understand the critical parameters in order to limit the damage done by SCC. This study focuses on the role hydrogen plays in SCC phenomenon and in particular H-material interactions. Hydrogen, from primary medium in the form of dissolved H gas or H from the water, can be absorbed by the alloy during the oxidation process taking place under reactor operating conditions. Once absorbed, hydrogen may be transported across the material, diffusing in the interstitial sites of the crystallographic structure and interacting with local defects, such as dislocations, precipitates, vacancies, etc. The presence of these [local defect] sites can slow the hydrogen transport and may provoke local H accumulation in the alloy. This accumulation could modify the local mechanical properties of the material and favor premature rupture. It is therefore essential to identify the nature of these H-material interactions, specifically the rate of H diffusion and hydrogen trapping kinetics at these

  4. The electrochemistry of chromium, chromium-boron and chromium-phosphorus alloys

    International Nuclear Information System (INIS)

    Moffat, T.P.; Ruf, R.R.; Latanision, R.M.

    1987-01-01

    It is fairly well established that chromium-metalloid interactions represent the key to understanding the remarkable corrosion behavior of TM-Cr-M glasses; (Fe, Ni, Co,...)-Cr-(P, Si, C, S). The character and kinetics of passive film growth on the glasses are being studied ni order to assess the role of the film former, chromium, and the metalloids in the passivation process. A series of thin film microcrystalline chromium, Cr-B and Cr-P binary alloys have been fabricated by physical vapor deposition techniques. Vacuum melted conventionally processed chromium has also been studied. Examination of these materials in lM H/sub 2/SO/sub 4/ and lM HCl by voltammetry, potentiostatic and impedance techniques yields the following conclusion: 1. Pure chromium with a grain size varying from < 400 A to 0.5 mm exhibits no well defined differences in electrochemical behavior in lM H/sub 2/SO/sub 4/. 2. The tremendous corrosion resistance of Cr-B alloys has been confirmed. 3. The beneficial effects observed for boron alloyed with chromium may be considered surprising in view of the neutral/negative influence of alloying boron with iron, i.e. Fe/sub 80/B/sub 20/. 4. The interaction of the electrochemistry of the metalloid constituent with that of the transition base element determines the corrosion behavior. 5. Preliminary work with Cr-P alloys indicates that certain compositions exhibit promising properties - certain films were found to be intact after two days of immersion in concentrated HCl. Further work is in progress

  5. Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Zhen [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Han, Jiesheng; Lu, Jinjun [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Chen, Jianmin, E-mail: chenjm@lzb.ac.cn [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)

    2015-01-15

    Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276.

  6. Cavitation erosion behavior of Hastelloy C-276 nickel-based alloy

    International Nuclear Information System (INIS)

    Li, Zhen; Han, Jiesheng; Lu, Jinjun; Chen, Jianmin

    2015-01-01

    Highlights: • Cavitation erosion behavior of Hastelloy C-276 was studied by ultrasonic apparatus. • The cavitation-induced precipitates formed in the eroded surface for Hastelloy C-276. • The selective cavitation erosion was found in Hastelloy C-276 alloy. - Abstract: The cavitation erosion behavior of Hastelloy C-276 alloy was investigated using an ultrasonic vibratory apparatus and compared with that of 316L stainless steel. The mean depth of erosion (MDE) and erosion rate (ER) curves vs. test time were attained for Hastelloy C-276 alloy. Morphology and microstructure evolution of the eroded surface were observed by scanning electron microscopy (SEM) and field emission scanning electron microscopy (FESEM) and the predominant erosion mechanism was also discussed. The results show that the MDE is about 1/6 times lower than that of the stainless steel after 9 h of testing. The incubation period of Hastelloy C-276 alloy is about 3 times longer than that of 316L stainless steel. The cavitation-induced nanometer-scaled precipitates were found in the local zones of the eroded surface for Hastelloy C-276. The selective cavitation erosion was found in Hastelloy C-276 alloy. The formation of nanometer-scaled precipitates in the eroded surface may play a significant role in the cavitation erosion resistance of Hastelloy C-276

  7. 49 CFR 385.605 - New entrant registration driver's license and drug and alcohol testing requirements.

    Science.gov (United States)

    2010-10-01

    ... America-Domiciled Carriers § 385.605 New entrant registration driver's license and drug and alcohol... carrier must subject each of the drivers described in paragraph (a) of this section to drug and alcohol... 49 Transportation 5 2010-10-01 2010-10-01 false New entrant registration driver's license and drug...

  8. Antisite-defect-induced surface segregation in ordered NiPt alloy

    DEFF Research Database (Denmark)

    Pourovskii, L.V.; Ruban, Andrei; Abrikosov, I.A.

    2003-01-01

    alloys corresponds to the (111) truncation of the bulk L1(0) ordered structure. However, the (111) surface of the nickel deficient Ni49Pt51 alloy is strongly enriched by Pt and should exhibit the pattern of the 2x2 structure. Such a drastic change in the segregation behavior is due to the presence...

  9. Semisolid casting with ultrasonically melt-treated billets of Al-7mass%Si alloys

    Directory of Open Access Journals (Sweden)

    Yoshiki Tsunekawa

    2012-02-01

    Full Text Available The demand for high performance cast aluminum alloy components is often disturbed by increasing impurity elements, such as iron accumulated from recycled scraps. It is strongly required that coarse plate-like iron compound of モ-Al5FeSi turns into harmless form without the need for applying refining additives or expensive virgin ingots. The microstructural modification of Al-7mass%Si alloy billets with different iron contents was examined by applying ultrasonic vibration during the solidification. Ultrasonically melt-treated billets were thixocast right after induction heating up to the semisolid temperature of 583 ìC, the microstructure and tensile properties were evaluated in the thixocast components. Globular primary メ-Al is required to fill up a thin cavity in thixocasting, so that the microstructural modification by ultrasonic melt-treatment was firstly confirmed in the billets. With ultrasonic melt-treatment in the temperature range of 630 ìC to 605 ìC, the primary メ-Al transforms itself from dendrite into fine globular in morphology. The coarse plate-like モ-Al5FeSi compound becomes markedly finer compared with those in non-treated billets. Semisolid soaking up to 583 ìC, does not appreciably affect the size of モ-Al5FeSi compounds; however, it affects the solid primary メ-Al morphology to be more globular, which is convenient for thixocasting. After thixocasting with preheated billets, eutectic silicon plates are extremely refined due to the rapid solidification arising from low casting temperature. The tensile strength of thixocast samples with different iron contents does not change much even at 2mass% of iron, when thixocast with ultrasonically melt-treated billets. However, thixocast Al-7mass%Si-2mass%Fe alloy with non-treated billets exhibits an inferior strength of 80 MPa, compared with 180 MPa with ultrasonically melt-treated billets. The elongation is also improved by about a factor of two in thixocastings with

  10. Laser surface alloying of 316L stainless steel with Ru and Ni mixtures

    CSIR Research Space (South Africa)

    Lekala, MB

    2012-05-01

    Full Text Available an economically sound approach of modifying corrosion properties of alloys. Furthermore, since corrosion is a surface phenomenon, an equally cost-effective approach is to add these only on the surface, where protection is most required. Laser surface... powders were preplaced on the steel surface using a chemical binder. The thickness of the preplaced powder coatings could be controlled to approxi- mately 1mm. The laser surface alloying was performed with a Rofin Sinar DY044 continuous wave Nd : YAG...

  11. Microstructures and Electrochemical Behavior of Ti-Mo Alloys for Biomaterials

    Directory of Open Access Journals (Sweden)

    Back-Sub Sung

    2015-01-01

    Full Text Available The Ti alloy with 7 wt% Mo revealed a microstructure that contained only the orthorhombic α′′ phase of a fine acicular martensitic structure. The corrosion resistance of the Ti-Mo alloys increased as the Mo content increased. Based on the results obtained from the polarization curve and electrochemical impedance, the Ti-Mo alloys were shown to be corrosion resistant because of the passive films formed on their surfaces. No ion release was detected in SBF (simulated body fluid solution, while Ti ions were released in 0.1% lactic acid ranging from 0.05 to 0.12 μg/mL for the Ti-Mo alloys. In vitro tests showed that MC3T3-E1 cell proliferation on Ti-7 wt% Mo alloy was rather active compared to other Ti-Mo alloys and commercial-grade pure Ti.

  12. Laser surface alloying of aluminium-transition metal alloys

    International Nuclear Information System (INIS)

    Almeida, A.; Vilar, R.

    1998-01-01

    Laser surface alloying has been used as a tool to produce hard and corrosion resistant Al-transition metal (TM) alloys. Cr and Mo are particularly interesting alloying elements to produce stable high-strength alloys because they present low diffusion coefficients and solid solubility in Al. To produce Al-TM surface alloys a two-step laser process was developed: firstly, the material is alloyed using low scanning speed and secondly, the microstructure is modified by a refinement step. This process was used in the production of Al-Cr, Al-Mo and Al-Mo and Al-Nb surface alloys by alloying Cr, Mo or Nb powder into an Al and 7175 Al alloy substrate using a CO 2 laser . This paper presents a review of the work that has been developed at Instituto Superior Tecnico on laser alloying of Al-TM alloy, over the last years. (Author) 16 refs

  13. Pitting corrosion studies on nitrogen implanted 316L SS for biomedical applications

    International Nuclear Information System (INIS)

    Subbaiyan, M.; Veerabadran, K.M.; Thampi, N.S.; Kanwar Krishnan; Kamachi Mudali, U.; Dayal, R.K.

    1997-01-01

    Traditionally, human bone fracture and defects have been corrected using metal and alloy fixing devices. Austenitic stainless steels (such as 316L alloy studied here) are favoured because of low cost, compared to titanium alloys, ease of fabrication and fair corrosion resistance. Localized attack on 316l stainless steel, however, results in iron, chromium and nickel ions leaching into surrounding body fluids. This study reports on the successful use of nitrogen ion implantation into 316lSS to evaluate the optimum dose needed to minimise this localised attack, in a physiological saline solution. (UK)

  14. Effect of microstructure on crack growth rate of alloy 690 in primary water

    International Nuclear Information System (INIS)

    Sakakibara, Y.; Hirano, T.; Nakayama, G.

    2015-01-01

    It was reported that the chemical composition and fabrication process of alloy 690 were important for the resistance to SCC in primary water. In this paper, we evaluated crack growth rate (CGR) of commercial thick plates (WT, XT) and forgings (FT, FM) made by some material manufacturers. Specimen WT showed the highest CGR in the thick plates. WT had coarse grain and film-like carbides which were assumed as eutectic M 23 C 6 . Forged alloy 690 MA and TT (FM and FT) showed no CGR. One of alloy 690 plates (XT) was cold rolled by 30% of reduction in our laboratory to investigate the effect of the orientation of the specimen on CGR. The specimens in the S-L and the S-T orientation showed higher CGRs than those in the T-L and the L-S orientation. (authors)

  15. Stress corrosion cracking and oxidation of austenitic stainless steel 316 L and model alloy in supercritical water reactor

    International Nuclear Information System (INIS)

    Saez-Maderuelo, A.; Gomez-Briceno, D.; Diego, G.

    2015-01-01

    In this work, an austenitic stainless steel type 316 L was tested in deaerated supercritical water at 400 deg. C and 500 deg. C and 25 MPa to determine how variations in water conditions influence its stress corrosion cracking behaviour and to make progress in the understanding of mechanisms involved in SCC processes in this environment. Moreover, the influence of plastic deformation in the resistance of the material to SCC was also studied at both temperatures. In addition to this, previous oxidation experiments at 400 deg. C and 500 deg. C and at 25 MPa were taken into account to gain some insight in this kind of processes. Furthermore, a cold worked model alloy based on the stainless steel 316 L with some variations in the chemical composition in order to simulate the composition of the grain boundary after irradiation was tested at 400 deg. C and 25 MPa in deaerated supercritical water. (authors)

  16. The A1 to L10 transformation in FePt films with ternary alloying additions of Mg, V, Mn, and B

    International Nuclear Information System (INIS)

    Wang, B.; Barmak, K.; Klemmer, T. J.

    2011-01-01

    The impact of ternary additions of Mg, V, Mn, and B on the A1 [face centered cubic (fcc)] to L1 0 phase transformation has been studied. The films were cosputter deposited from elemental targets at room temperature and annealed after deposition. The films had Mg additions in the range ∼0-2.6 at.%, V additions in the range 0.7-12.2 at.%, Mn additions in the range 2.2-16.3 at.%, and B additions in the range 1.2-12.9 at.%. For all four ternary alloy systems, annealing resulted in the formation of no other phases than the L1 0 phase. Ternary additions of C than the binary FePt films with the same Pt content.

  17. Prediction and verification of creep behavior in metallic materials and components for the space shuttle thermal protection system

    Science.gov (United States)

    Davis, J. W.; Cramer, B. A.

    1976-01-01

    A method of analysis was developed for predicting permanent cyclic creep deflections in stiffened panel structures. This method uses creep equations based on cyclic tensile creep tests and a computer program to predict panel deflections as a function of mission cycle. Four materials were investigated - a titanium alloy (Ti-6Al-4V), a cobalt alloy (L605), and two nickel alloys (Rene'41 and TDNiCr). Steady-state and cyclic creep response data were obtained by testing tensile specimens fabricated from thin gage sheet (0.025 and 0.63 cm nominal). Steady-state and cyclic creep equations were developed which describe creep as a function of time, temperature and load. Tests were also performed on subsize (6.35 x 30.5 cm) rib and corrugation stiffened panels. These tests were used to correlate creep responses between elemental specimens and panels. The panel response was analyzed by use of a specially written computer program.

  18. Effect of Ta substitution method on the mechanical properties of Ni3(Si,Ti) intermetallic alloy

    International Nuclear Information System (INIS)

    Imajo, Daiki; Kaneno, Yasuyuki; Takasugi, Takayuki

    2013-01-01

    In this study, Ta was added to an L1 2 -type Ni 3 (Si,Ti) alloy at different levels and into different substitution sites, substituting for either Ni, Ti or Si. The solubility limits of Ta in the L1 2 phase were 1.9 at%, 5.7 at% and 1.0 at% when Ta substituted for Ni, Ti and Si, respectively. The lattice parameters in the L1 2 phase region increased in the order of the Ta(Ni)>Ta(Si)>Ta(Ti) quaternary alloys, in which Ta substituted for Ni, Si and Ti, respectively. The room-temperature hardness in the L1 2 phase region increased linearly with increasing Ta content, and the increment rate increased in the order of the Ta(Ni)>Ta(Si)>Ta(Ti) quaternary alloys. Similarly, the room-temperature 0.2% proof stress as well as the tensile strength in the L1 2 phase region increased linearly with increasing Ta content, and the increment rate increased in the order of the Ta(Ni)>Ta(Si)>Ta(Ti) quaternary alloys. High tensile elongation was observed at room temperature when the microstructures remain in the L1 2 single phase. At high temperatures, a positive temperature dependence of the hardness as well as the flow strength was observed in the quaternary alloys. It was also shown that the wear resistance of the quaternary Ta(Ti) alloys was improved and attributed to plastically induced hardening of the worn surfaces combined with the positive temperature dependence of the flow strength. The strengthening and hardening resulting from Ta addition was suggested to be due to the hardening of the solid solution arising from the misfits in the atomic radius between Ta and the constituent atoms Ni, Ti or Si

  19. Fabrication of the micro/nano-structure superhydrophobic surface on aluminum alloy by sulfuric acid anodizing and polypropylene coating.

    Science.gov (United States)

    Wu, Ruomei; Liang, Shuquan; Liu, Jun; Pan, Anqiang; Yu, Y; Tang, Yan

    2013-03-01

    The preparation of the superhydrophobic surface on aluminum alloy by anodizing and polypropylene (PP) coating was reported. Both the different anodizing process and different PP coatings of aluminum alloy were investigated. The effects of different anodizing conditions, such as electrolyte concentration, anodization time and current on the superhydrophobic surface were discussed. By PP coating after anodizing, a good superhydrophobic surface was facilely fabricated. The optimum conditions for anodizing were determined by orthogonal experiments. After the aluminium-alloy was grinded with 600# sandpaper, pretreated by 73 g/L hydrochloric acid solution at 1 min, when the concentration of sulfuric acid was 180 g/L, the concentration of oxalic acid was 5 g/L, the concentration of potassium dichromate was 10 g/L, the concentration of chloride sodium was 50 g/L and 63 g/L of glycerol, anodization time was 20 min, and anodization current was 1.2 A/dm2, anodization temperature was 30-35 degrees C, the best micro-nanostructure aluminum alloy films was obtained. On the other hand, the PP with different concentrations was used to the PP with different concentrations was used to coat the aluminum alloy surface after anodizing. The results showed that the best superhydrophobicity was achieved by coating PP, and the duration of the superhydrophobic surface was improved by modifying the coat the aluminum alloy surface after anodizing. The results showed that the best superhydrophobicity was surface with high concentration PP. The morphologies of micro/nano-structure superhydrophobic surface were further confirmed by scanning electron microscope (SEM). The material of PP with the low surface free energy combined with the micro/nano-structures of the surface resulted in the superhydrophobicity of the aluminum alloy surface.

  20. Structure and magnetic properties of nanostructured MnNi alloys fabricated by mechanical alloying and annealing treatments

    Science.gov (United States)

    Jalal, T.; Hossein Nedjad, S.; Khalili Molan, S.

    2013-05-01

    A nearly equiatomic MnNi alloy was fabricated from the elemental powders by means of mechanical alloying in a planetary ball milling apparatus. X-ray diffraction (XRD), scanning electron microscopy (SEM), differential scanning calorimetry (DSC), and measurements of magnetization were conducted to identify the structural states and properties of the prepared alloys. After ball milling for 20 h, a disordered face-centered cubic (f.c.c.) solid solution was formed which increased in lattice parameter by further milling up to 50 h. An exothermic reaction took place at around 300-400°C during continuous heating of the disordered f.c.c. solid solution. This reaction is attributed to a structural ordering leading to the formation of a face-centered tetragonal (f.c.t.) phase with L10 type ordering. Examination of the magnetic properties indicated that the structural ordering increases remnant magnetization and decreases coerecivity.

  1. Shape memory effects in a uranium + 14 at. % niobium alloy

    International Nuclear Information System (INIS)

    Vandermeer, R.A.; Ogle, J.C.; Snyder, W.B. Jr.

    1978-01-01

    There is a class of alloys that, on cooling from elevated temperatures, experience a martensitic phase change. Some of these, when stressed in the martensitic state to an apparently plastic strain, recover their predeformed shape simply by heating. This striking shape recovery is known as the ''shape memory effect'' (SME). Up to a certain limiting strain, epsilon/sub L/, 100% shape recovery may be accomplished. This memory phenomenon seems to be attributable to the thermoelastic nature of and deformational modes associated with the phase transformation in the alloy. Thus, shape recovery results when a stress-biased martensite undergoes a heat-activated reversion back to the parent phase from which it originated. There are uranium alloys that demonstrate SME-behavior. Uranium-rich, uranium--niobium alloys were the first to be documented; New experimental observations of SME in a polycrystalline uranium--niobium alloy are presented. This alloy can exhibit a two-way memory under cetain circumstances. Additional indirect evidence is presented suggesting that the characteristics of the accompanying phase transformation in this alloy meet the criteria or ''selection rules'' deemed essential for SME

  2. In vitro corrosion of magnesium alloy AZ31 — a synergetic influence of glucose and Tris

    Science.gov (United States)

    Li, Ling-Yu; Liu, Bin; Zeng, Rong-Chang; Li, Shuo-Qi; Zhang, Fen; Zou, Yu-Hong; Jiang, Hongwei George; Chen, Xiao-Bo; Guan, Shao-Kang; Liu, Qing-Yun

    2018-05-01

    Biodegradable Mg alloys have generated great interest for biomedical applications. Accurate predictions of in vivo degradation of Mg alloys through cost-effective in vivo evaluations require the latter to be conducted in an environment close to that of physiological scenarios. However, the roles of glucose and buffering agents in regulating the in vivo degradation performance of Mg alloys has not been elucidated. Herein, degradation behavior of AZ31 alloy is investigated by hydrogen evolution measurements, pH monitoring and electrochemical tests. Results indicate that glucose plays a content-dependent role in degradation of AZ31 alloy in buffer-free saline solution. The presence of a low concentration of glucose, i.e. 1.0 g/L, decreases the corrosion rate of Mg alloy AZ31, whereas the presence of 2.0 and 3.0 g/L glucose accelerates the corrosion rate during long term immersion in saline solution. In terms of Tris-buffered saline solution, the addition of glucose increases pH value and promotes pitting corrosion or general corrosion of AZ31 alloy. This study provides a novel perspective to understand the bio-corrosion of Mg alloys in buffering agents and glucose containing solutions.

  3. The influence of heat treatments on several types of base-metal removable partial denture alloys.

    Science.gov (United States)

    Morris, H F; Asgar, K; Rowe, A P; Nasjleti, C E

    1979-04-01

    Four removable partial denture alloys, Vitallium (Co-Cr alloy), Dentillium P.D. (Fe-Cr alloy), Durallium L.G. (Co-Cr-Ni alloy), and Ticonium 100 (Ni-Cr alloy), were evaluated in the as-cast condition and after heat treatment for 15 minutes at 1,300 degrees, 1,600 degrees, 1,900 degrees, and 2,200 degrees F followed by quenching in water. The following properties were determined and compared for each alloy at each heat treatment condition: the yield strengths at 0.01%, 0.1%, and 0.2% offsets, the ultimate tensile strength, the percent elongation, the modulus of elasticity, and the Knoop microhardness. The results were statistically analyzed. Photomicrographs were examined for each alloy and test condition. The following conclusions were made: 1. The "highest values" were exhibited by the as-cast alloy. 2. Heat treatment of the partial denture alloys tested resulted in reductions in strength, while the elongations varied. This study demonstrates that, in practice, one should avoid (a) prolonged "heat-soaking" while soldering and (b) grinding or polishing of the casting until the alloy is "red hot". 3. Durallium L.G. was the least affected by the various heat treatment conditions. 4. Conventional reporting of the yield strength at 0.2% offset, the ultimate tensile strength, and percent elongation are not adequate to completely describe and compare the mechanical behavior of alloys. The reporting of the yield strength at 0.01% offset, in addition to the other reported properties, will provide a more complete description of the behavior of the dental alloys.

  4. Study of the controllable reactivity of aluminum alloys and their promising application for hydrogen generation

    International Nuclear Information System (INIS)

    Fan Meiqiang; Sun Lixian; Xu Fen

    2010-01-01

    The hydrolysis performances of two aluminum alloys are investigated as their reactivity can be controlled via the different additives. The additive of NaCl has the positive effect to improve the hydrolysis properties of the aluminum alloys with quicker hydrolysis kinetic and lower hydrolysis temperature. For examples, in 6 min of hydrolysis reaction, the Al-5 wt%Hg-5 wt%NaCl can produce 971 mL g -1 hydrogen, higher than 917 mL g -1 hydrogen from Al-10 wt%Hg alloy. The Al-In-NaCl alloy has lower hydrolysis temperature about 10 K than that of Al-In alloy. Meanwhile, the reactivity of Al alloys can be improved or reduced via the additive metals. It can be found that the additive cadmium can reduce the reactivity of Al-Hg alloy. The Al-Hg-Cd alloys can keep good stability at the moist atmosphere below 343 K and have excellent hydrolysis performance around 343-373 K. The debased reactivity of Al-Hg-Cd composite comes from the formation of CdHg 2 compounds in the milling process. But the additive Zn and Ga doped into the Al-In-NaCl alloys can quickly increase the reactivity of the alloy which can quickly react with water at room temperature and have high hydrogen yield up to the theoretic value. Therefore, it is a promising possibility that the controllable reactivity of aluminum alloys can be obtained through the different additive according to the practical request, and the Al alloys can produce pure hydrogen for the fuel cell via the hydrolysis reaction.

  5. Amorphous phase formation in the Cu{sub 36}Zr{sub 59}A{sub l5} and Cu{sub 48}Zr{sub 43}A{sub l9} ternary alloys studied by molecular dynamics; Estudo da formacao de fase amorfa nas ligas ternarias Cu{sub 36}Zr{sub 59}A{sub l5} e Cu{sub 48}Zr{sub 43}A{sub l9} por dinamica molecular

    Energy Technology Data Exchange (ETDEWEB)

    Aliaga, L.C.R.; Schimidt, C.S.; Lima, L.V.; Domingues, G.M.B.; Bastos, I.N., E-mail: aliaga@iprj.uer.br [Universidade do Estado do Rio de Janeiro (UERJ), Nova friburgo, RJ (Brazil). Departamento de Materiais

    2016-07-01

    Amorphous alloys presents better mechanical and physical properties than its crystalline counterparts. However, there is a scarce understanding on structure - properties relationship in this class of materials. This paper presents the results of the molecular dynamics application to obtain an atomistic description of melting, solidification and the glass forming ability in the ternary Cu{sub 36}Zr{sub 59}A{sub l5} and Cu{sub 48}Zr{sub 43}A{sub l9} alloys. In the study we used the EAM potential and different cooling rates, β = 0.1, 1 and 100 K/ps to form the amorphous phase in a system consisting of 32,000 atoms by using the free code LAMMPS. The solidus and liquidus temperatures, on a heating rate of the 5 K/ps, were obtained. Also, on the cooling down step, it was observed that the glass transition temperature (T{sub g}) decreases as cooling rate increases. The structural evolution was analyzed through the radial distribution functions and Voronoi polyhedra. Furthermore, it was determined the evolution of viscosity upper T{sub g}, as well as the fragility (m) parameter for each amorphous alloy. The thermal parameters of the simulation obtained are compared with those of the experiments. (author)

  6. Microstructural characterization and phase transformation of ternary alloys near at Al3Ti compound

    International Nuclear Information System (INIS)

    Angeles Ch, C.

    1999-01-01

    This research work is related with the structural characteristic and compositional values of the crystalline phases, which are found in ternary alloys of Ti-Al-Fe and TI-Al-Cu. These types of alloys were obtained using a rapid solidification technique (10 3 -10 4 K/s) and pure elements such as Al, Ti, Fe and Cu (99.99%). These cooling velocities allow the formation of stable phases and small grain sizes (approximately in range of a few micras). The obtained results indicate the presence of Al 3 Ti and others phases of L1 2 type. These phases are commonly found in a matrix rich in A1. The microalloyed elements (Cu and Fe) substitute the aluminum in both kinds of phases. Alloys with low content of Cu show transition states from the tetragonal structure DO 22 to the cubic phases L1 2 . The structural characteristics of the alloys are related with some microhardness measurement. The results show that the presence of the L1 2 phase tends to increase to hardness depending of the content of this phase

  7. Effect of Bi on the corrosion resistance of zirconium alloys

    International Nuclear Information System (INIS)

    Yao Meiyi; Zhou Bangxin; Li Qiang; Zhang Weipeng; Zhu Li; Zou Linghong; Zhang Jinlong; Peng Jianchao

    2014-01-01

    In order to investigate systematically the effect of Bi addition on the corrosion resistance of zirconium alloys, different zirconium-based alloys, including Zr-4 (Zr-l.5Sn-0.2Fe-0.1Cr), S5 (Zr-0.8Sn-0.35Nb-0.4Fe-0.1Cr), T5 (Zr-0.7Sn-l.0Nb-0.3Fe-0.1Cr) and Zr-1Nb, were adopted to prepare the zirconium alloys containing Bi of 0∼0.5% in mass fraction. These alloys were denoted as Zr-4 + xBi, S5 + xBi, T5 + xBi and Zr-1Nb + xBi, respectively. The corrosion behavior of these specimens was investigated by autoclave testing in lithiated water with 0.01 M LiOH or deionized water at 360 ℃/18.6 MPa and in superheated steam at 400 ℃/10.3 MPa. The microstructure of the alloys was examined by TEM and the second phase particles (SPPs) were analyzed by EDS. Microstructure observation shows that the addition of Bi promotes the precipitation of Sn as second phase particles (SPPs) because Sn is in solid solution in α-Zr matrix in Zr-4, S5 and T5 alloys. The concentration of Bi dissolved in α-Zr matrix increase with the increase of Nb in the alloys, and the excess Bi precipitates as Bi-containing SPPs. The corrosion results show that the effect of Bi addition on the corrosion behavior of different zirconium-based alloys is very complicated, depending on their compositions and corrosion conditions. In the case of higher Bi concentration in α-Zr, the zirconium alloys exhibit better corrosion resistance. However, in the case of precipitation of Bi-containing SPPs, the corrosion resistance gets worse. This indicates that the solid solution of Bi in α-Zr matrix can improve the corrosion resistance, while the precipitation of the Bi-containing SPPs is harmful to the corrosion resistance. (authors)

  8. In vitro corrosion and biocompatibility of binary magnesium alloys.

    Science.gov (United States)

    Gu, Xuenan; Zheng, Yufeng; Cheng, Yan; Zhong, Shengping; Xi, Tingfei

    2009-02-01

    As bioabsorbable materials, magnesium alloys are expected to be totally degraded in the body and their biocorrosion products not deleterious to the surrounding tissues. It's critical that the alloying elements are carefully selected in consideration of their cytotoxicity and hemocompatibility. In the present study, nine alloying elements Al, Ag, In, Mn, Si, Sn, Y, Zn and Zr were added into magnesium individually to fabricate binary Mg-1X (wt.%) alloys. Pure magnesium was used as control. Their mechanical properties, corrosion properties and in vitro biocompatibilities (cytotoxicity and hemocompatibility) were evaluated by SEM, XRD, tensile test, immersion test, electrochemical corrosion test, cell culture and platelet adhesion test. The results showed that the addition of alloying elements could influence the strength and corrosion resistance of Mg. The cytotoxicity tests indicated that Mg-1Al, Mg-1Sn and Mg-1Zn alloy extracts showed no significant reduced cell viability to fibroblasts (L-929 and NIH3T3) and osteoblasts (MC3T3-E1); Mg-1Al and Mg-1Zn alloy extracts indicated no negative effect on viabilities of blood vessel related cells, ECV304 and VSMC. It was found that hemolysis and the amount of adhered platelets decreased after alloying for all Mg-1X alloys as compared to the pure magnesium control. The relationship between the corrosion products and the in vitro biocompatibility had been discussed and the suitable alloying elements for the biomedical applications associated with bone and blood vessel had been proposed.

  9. Study of the embedded atom method of atomistic calculations for metals and alloys

    International Nuclear Information System (INIS)

    Johnson, R.A.

    1990-10-01

    Two projects were completed in the past year. The stability of a series of binary alloys was calculated using the embedded-atom method (EAM) with an analytic form for two-body potentials derived previously. Both disordered alloys and intermetallic compounds with the L1 0 and L1 2 structures were studied. The calculated heats of solution of alloys of Cu, Ag, Au, Ni, and Pt were satisfactory, while results for alloys containing Pd were too high. Atomistic calculations using the EAM were also carried out for point defects in hcp metals. By comparison with results in the literature, it was found that many body effects from the EAM significantly alter predicted physical properties of hcp metals. For example, the EAM calculations yield anisotropic vacancy diffusion with greater vacancy mobility in the basal plane, and imply that diffusion will start at a lower fraction of the melting temperature

  10. The experimental search for new predicted binary-alloy structures

    Science.gov (United States)

    Erb, K. C.; Richey, Lauren; Lang, Candace; Campbell, Branton; Hart, Gus

    2010-10-01

    Predicting new ordered phases in metallic alloys is a productive line of inquiry because configurational ordering in an alloy can dramatically alter their useful material properties. One is able to infer the existence of an ordered phase in an alloy using first-principles calculated formation enthalpies.ootnotetextG. L. W. Hart, ``Where are Nature's missing structures?,'' Nature Materials 6 941-945 2007 Using this approach, we have been able to identify stable (i.e. lowest energy) orderings in a variety of binary metallic alloys. Many of these phases have been observed experimentally in the past, though others have not. In pursuit of several of the missing structures, we have characterized potential orderings in PtCd, PtPd and PtMo alloys using synchrotron x-ray powder diffraction and symmetry-analysis tools.ootnotetextB. J. Campbell, H. T. Stokes, D. E. Tanner, and D. M. Hatch, ``ISODISPLACE: a web-based tool for exploring structural distortions,'' J. Appl. Cryst. 39, 607-614 (2006)

  11. Corrosion behaviour of austenitic stainless steel, nickel-base alloy and its weldments in aqueous LiBr solutions

    Energy Technology Data Exchange (ETDEWEB)

    Blasco-Tamarit, E.; Igual-Munoz, A.; Garcia Anton, J.; Garcia-Garcia, D. [Departamento de Ingenieria Quimica y Nuclear. E.T.S.I.Industriales, Universidad Politecnica de Valencia, P.O. Box 22012 E-46071 Valencia (Spain)

    2004-07-01

    With the advances in materials production new alloys have been developed, such as High- Alloy Austenitic Stainless Steels and Nickel-base alloys, with high corrosion resistance. These new alloys are finding applications in Lithium Bromide absorption refrigeration systems, because LiBr is a corrosive medium which can cause serious corrosion problems, in spite of its favourable properties as absorbent. The objective of the present work was to study the corrosion resistance of a highly alloyed austenitic stainless steel (UNS N08031) used as base metal, a Nickel-base alloy (UNS N06059) used as its corresponding filler metal, and the weld metal obtained by the Gas Tungsten Arc Welding (GTAW) procedure. The materials have been tested in different LiBr solutions (400 g/l, 700 g/l, 850 g/l and a commercial 850 g/l LiBr heavy brine containing Lithium Chromate as corrosion inhibitor), at 25 deg. C. Open Circuit Potential tests and potentiodynamic anodic polarization curves have been carried out to obtain information about the general electrochemical behaviour of the materials. The polarization curves of all the alloys tested were typical of passivable materials. Pitting corrosion susceptibility has been evaluated by means of cyclic potentiodynamic curves, which provide parameters to analyse re-passivation properties. The galvanic corrosion generated by the electrical contact between the welded and the base material has been estimated from the polarization diagrams according to the Mixed Potential Method. Samples have been etched to study the microstructure by Scanning Electron Microscopy (SEM). The results demonstrate that the pitting resistance of all these materials increases as the LiBr concentration decreases. In general, the presence of chromate tended to shift the pitting potential to more positive values than those obtained in the 850 g/l LiBr solution. (authors)

  12. Enhancement of magnetic properties of Co2MnSi Heusler alloy prepared by mechanical alloying method

    International Nuclear Information System (INIS)

    Rabie, Naeemeh; Gordani, Gholam Reza; Ghasemi, Ali

    2017-01-01

    Highlights: • Ferromagnetic Heusler alloys of Co 2 MnSi were synthesized at low temperature. • There is an at least 30% reduction in the phase formation temperature. • Saturation magnetization of alloy was increased significantly after annealing. - Abstract: Ferromagnetic Heusler alloys of Co 2 MnSi were synthesized by mechanical alloying method at low temperature. The effect of milling time and annealing process on structural and magnetic properties of ferromagnetic alloy samples were studied by X-ray diffraction, scanning electron microscopy and vibration sample magnetometer methods, respectively. Structural characteristics such as crystallite size, phase percentage, and lattice parameter determined using the Rietveld method. The values of these parameters were obtained 362.9 nm, 5.699 Å and 98.7%, respectively for annealed sample. Magnetization studies show that the Co2MnSi phase is formed at 15 h of milling and is optimized after 20 h of milling. VSM results showed that saturation magnetization (M s ) of milled samples reduces from 112 to 75 (emu/g) with increasing milling time and then increased gradually to 95 emu/g. The effect of post-annealing on the structural and magnetic properties of milled samples was also investigated. The saturation magnetization of annealed sample (120 emu/g) is higher than the optimum milled sample (95 emu/g) due to increasing preferential ordered L2 1 structure.

  13. Microstructural examination of commercial ferritic alloys at 299 DPA

    International Nuclear Information System (INIS)

    Gelles, D.S.

    1995-11-01

    Microstructures and density change measurements are reported for Martensitic commercial steels HT-9 and Modified 9Cr-lMo (T9) and oxide dispersion strengthened ferritic alloys MA956 and NU957 following irradiation in the FFTF/MOTA at 420 degrees C to 200 DPA. Swelling as determined by density change remains below 2% for all conditions. Microstructures are found to be stable except in recrystallized grains of MA957, which are fabrication artifacts, with only minor swelling in the Martensitic steels and α' precipitation in alloys with 12% or more chromium. These results further demonstrate the high swelling resistance and microstructural stability of the ferritic alloy class

  14. In-situ investigation of stress conditions during expansion of bare metal stents and PLLA-coated stents using the XRD sin(2)ψ-technique.

    Science.gov (United States)

    Kowalski, Wolfgang; Dammer, Markus; Bakczewitz, Frank; Schmitz, Klaus-Peter; Grabow, Niels; Kessler, Olaf

    2015-09-01

    Drug eluting stents (DES) consist of platform, coating and drug. The platform often is a balloon-expandable bare metal stent made of the CoCr alloy L-605 or stainless steel 316 L. The function of the coating, typically a permanent polymer, is to hold and release the drug, which should improve therapeutic outcome. Before implantation, DES are compressed (crimped) to allow implantation in the human body. During implantation, DES are expanded by balloon inflation. Crimping, as well as expansion, causes high stresses and high strains locally in the DES struts, as well as in the polymer coating. These stresses and strains are important design criteria of DES. Usually, they are calculated numerically by finite element analysis (FEA), but experimental results for validation are hardly available. In this work, the X-ray diffraction (XRD) sin(2)ψ-technique is applied to in-situ determination of stress conditions of bare metal L-605 stents, and Poly-(L-lactide) (PLLA) coated stents. This provides a realistic characterization of the near-surface stress state and a validation option of the numerical FEA. XRD-results from terminal stent struts of the bare metal stent show an increasing compressive load stress in tangential direction with increasing stent expansion. These findings correlate with numerical FEA results. The PLLA-coating also bears increasing compressive load stress during expansion. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Fundamental Studies on Ambient Temperature Creep Deformation Behavior of Alpha and Alpha-Beta Titanium Alloys

    Science.gov (United States)

    1994-02-15

    Solutions [49] A-Etch 25 (mL) Hydrofluoric Acid (HF 50%) 25 Nitric Acid Cone (HN03) 50 Glycerine R-Etch 18.5 gm (17 mL) Benzalkonium Chloride 35 (mL... Reduction Project (0704-0188) Washington, DC 20503. 1. AGENCY USE ONLY (Leave Blank) 2. REPORT DATE 1994 3. REPORT TYPE AND DATES COVERED Final 4...K and a 60% reduction in area was given for all of the alloys. This work was found to be sufficient to recrystallize all of the alloys within 12

  16. Effect of Ta substitution method on the mechanical properties of Ni{sub 3}(Si,Ti) intermetallic alloy

    Energy Technology Data Exchange (ETDEWEB)

    Imajo, Daiki; Kaneno, Yasuyuki; Takasugi, Takayuki, E-mail: takasugi@mtr.osakafu-u.ac.jp

    2013-12-20

    In this study, Ta was added to an L1{sub 2}-type Ni{sub 3}(Si,Ti) alloy at different levels and into different substitution sites, substituting for either Ni, Ti or Si. The solubility limits of Ta in the L1{sub 2} phase were 1.9 at%, 5.7 at% and 1.0 at% when Ta substituted for Ni, Ti and Si, respectively. The lattice parameters in the L1{sub 2} phase region increased in the order of the Ta(Ni)>Ta(Si)>Ta(Ti) quaternary alloys, in which Ta substituted for Ni, Si and Ti, respectively. The room-temperature hardness in the L1{sub 2} phase region increased linearly with increasing Ta content, and the increment rate increased in the order of the Ta(Ni)>Ta(Si)>Ta(Ti) quaternary alloys. Similarly, the room-temperature 0.2% proof stress as well as the tensile strength in the L1{sub 2} phase region increased linearly with increasing Ta content, and the increment rate increased in the order of the Ta(Ni)>Ta(Si)>Ta(Ti) quaternary alloys. High tensile elongation was observed at room temperature when the microstructures remain in the L1{sub 2} single phase. At high temperatures, a positive temperature dependence of the hardness as well as the flow strength was observed in the quaternary alloys. It was also shown that the wear resistance of the quaternary Ta(Ti) alloys was improved and attributed to plastically induced hardening of the worn surfaces combined with the positive temperature dependence of the flow strength. The strengthening and hardening resulting from Ta addition was suggested to be due to the hardening of the solid solution arising from the misfits in the atomic radius between Ta and the constituent atoms Ni, Ti or Si.

  17. First principle investigations on Boron doped Fe2VAl Heusler alloy

    International Nuclear Information System (INIS)

    Venkatesh, Ch.; Srivastava, S.K.; Rao, V.V.

    2014-01-01

    The role of atomic size of sp-element is investigated through theoretical calculations and basic experiments to understand the physical properties of Boron doped Fe 2 VAl alloy. The results of ab-initio calculations on ordered L2 1 structure of Fe 2 VAl 1-x B x (x=0, 0.5, 1) alloys have been compared to understand the role of sp-element size on the hybridization among their respective valance states. Interestingly, semi-metallic and paramagnetic like ground states were found in the Boron doped alloys in similar to Fe 2 VAl, eliminating the role of size of the doppent sp-atom. These calculations result in hybridization where the covalent distribution of valance states among the atoms is responsible to produce a finite pseudo-gap at the Fermi level. The observed features could be explained on the basis of covalent theory of magnetism in which an amount of spectral weight transfer occurs in the DOS spectrum among the same spin orbitals, leading to symmetric distribution of bonding and anti-bonding states. However, the obtained experimental findings on Boron doped alloys are in contrast with these calculations, indicating that experimentally the alloy formation into an ideal L2 1 lattice does not happen while doping with Boron. Further, the micro structural analysis shows Boron segregation across the grain boundaries that may form magnetic inhomogeneities in the lattice of Boron doped Fe 2 VAl alloys which preferably cause these experimental anomalies

  18. Positron annihilation study on the Fermi surface of Cd-Mg alloys

    International Nuclear Information System (INIS)

    Koike, Shu-ichi; Hirabayashi, Makoto; Suzuki, Toshiharu; Hasegawa, Masayuki.

    1979-01-01

    Angular correlation measurements of annihilation photons have been made on single crystals of the Cd-Mg alloys over all compositions. It is found that the Fermi surfaces of the alloys in the Cd-rich region distort considerably from a free-electron sphere; the 3rd band ''stars'' and the 4th band horizontal ''cigars'' around the points L do not exist in Cd, and appear at 10 at % Mg accompanying an appreciable decrease of the energy gap at L. It is proposed that changes in the 4d core states cause the sudden decrease of the energy gap. (author)

  19. Conversion Coatings Produced on AZ61 Magnesium Alloy by Low-Voltage Process

    Directory of Open Access Journals (Sweden)

    Nowak M.

    2016-03-01

    Full Text Available The resultes of anodic oxide conversion coatings on wrought AZ61 magnesium alloy production are describe. The studies were conducted in a solution containing: KOH (80 g/l and KF (300 g/l using anodic current densities of 3, 5 and 10 A/dm2 and different process durations. The obtained coatings were examined under a microscope and corrosion tests were performed by electrochemical method. Based on these results, it was found that the low-voltage process produces coatings conferring improved corrosion resistance to the tested magnesium alloy.

  20. Atmospheric corrosion of uranium-carbon alloys; Corrosion atmospherique des alliages uranium-carbone

    Energy Technology Data Exchange (ETDEWEB)

    Rousset, P; Accary, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-07-01

    The authors study the corrosion of uranium-carbon alloys having compositions close to that of the mono-carbide; they show that the extent of the observed corrosion effects increases with the water vapour content of the surrounding gas and they conclude that the atmospheric corrosion of these alloys is due essentially to the humidity of the air, the effect of the oxygen being very slight at room temperature. They show that the optimum conditions for preserving U-C alloys are either a vacuum or a perfectly dry argon atmosphere. The authors have also established that the type of corrosion involved is a corrosion which 'cracks under stress' and is transgranular (it can also be intergranular in the case of sub-stoichiometric alloys). They propose, finally, two hypotheses for explaining this mechanism, one of which is illustrated by the existence, at the fissure interface, of corrosion products which can play the role of 'corners' in the mono-carbide grains. (authors) [French] Les auteurs etudient la corrosion des alliages uranium-carbone de composition voisine du monocarbure; ils montrent que l'importance des effets de la corrosion observee augmente avec la teneur en vapeur d'eau du milieu gazeux ambiant et concluent que la corrosion atmospherique de ces alliages est due essentiellement a l'humidite de l'air, l'action de l'oxygene de l'air etant tres faible a la temperature ambiante. Ils indiquent que les conditions optimales de conservation des alliages U-C sont le vide ou une atmosphere d'argon parfaitement desseches. D'autre part, les auteurs etablissent que le type de corrosion mis en jeu est une corrosion 'fissurante sous contrainte', transgranulaire (pouvant egalement etre intergranulaire dans le cas d'alliages sous-stoechiometriques). Ils proposent enfin deux hypotheses pour rendre compte de ce mecanisme, dont l'une est illustree par la mise en evidence, a l'interface des fissures, de produits de corrosion pouvant jouer le role de 'coins' dans les grains de

  1. Anomalous jump of stress upon the variation of the rate of deformation of single crystals of the Ni3Ge alloys with L12 superstructure under the conditions of cubic slip

    International Nuclear Information System (INIS)

    Starenchenko, V.A.; Solov'eva, Yu.V.; Gettinger, M.V.; Kovalevskaya, T.A.

    2005-01-01

    Experimental results are given on variations of plastic strain rate for Ni 3 Ge alloy with L1 2 superstructure possessing anomalous temperature dependence of mechanical properties. For the first time an anomalous strain rate dependence of mechanical properties of the alloy is revealed under conditions of cubic slip. The mechanism is proposed to explain the observed form of stress jump. Using the mechanism proposed normal and anomalous constituents of stress jump are separated. Temperature dependences of stress jump, normal and anomalous constituents of stress jump are analyzed [ru

  2. Magnesium secondary alloys: Alloy design for magnesium alloys with improved tolerance limits against impurities

    Energy Technology Data Exchange (ETDEWEB)

    Blawert, C., E-mail: carsten.blawert@gkss.d [GKSS Forschungszentrum Geesthacht GmbH, Max-Planck-Str. 1, 21502 Geesthacht (Germany); Fechner, D.; Hoeche, D.; Heitmann, V.; Dietzel, W.; Kainer, K.U. [GKSS Forschungszentrum Geesthacht GmbH, Max-Planck-Str. 1, 21502 Geesthacht (Germany); Zivanovic, P.; Scharf, C.; Ditze, A.; Groebner, J.; Schmid-Fetzer, R. [TU Clausthal, Institut fuer Metallurgie, Robert-Koch-Str. 42, 38678 Clausthal-Zellerfeld (Germany)

    2010-07-15

    The development of secondary magnesium alloys requires a completely different concept compared with standard alloys which obtain their corrosion resistance by reducing the levels of impurities below certain alloy and process depending limits. The present approach suitable for Mg-Al based cast and wrought alloys uses a new concept replacing the {beta}-phase by {tau}-phase, which is able to incorporate more impurities while being electro-chemically less detrimental to the matrix. The overall experimental effort correlating composition, microstructure and corrosion resistance was reduced by using thermodynamic calculations to optimise the alloy composition. The outcome is a new, more impurity tolerant alloy class with a composition between the standard AZ and ZC systems having sufficient ductility and corrosion properties comparable to the high purity standard alloys.

  3. Alloying principles for magnesium base heat resisting alloys

    International Nuclear Information System (INIS)

    Drits, M.E.; Rokhlin, L.L.; Oreshkina, A.A.; Nikitina, N.I.

    1982-01-01

    Some binary systems of magnesium-base alloys in which solid solutions are formed, are considered for prospecting heat resistant alloys. It is shown that elements having essential solubility in solid magnesium strongly decreasing with temperature should be used for alloying maqnesium base alloys with high strength properties at increased temperatures. The strengthening phases in these alloys should comprise essential quantity of magnesium and be rather refractory

  4. Influence of hydrogen on metals behavior. 1 - Mechanical behavior of Ti 6 pc Al 6 pc V 2 pc Sn titanium alloy versus hydrogen: influence of heat treatment and of oxygen content; Influence de l'hydrogene sur le comportement des metaux. 1 - comportement mecanique de l'alliage de titane T A6 V6 E2 vis-a-vis de l'hydrogene: influence du traitement thermique et de la teneur en oxygene

    Energy Technology Data Exchange (ETDEWEB)

    Schaller, Bernard

    1972-06-26

    The mechanical behavior of Ti 6 pc Al 6 pc V Sn alloy during dynamic testing has been investigated versus hydrogen and oxygen content. The hydrogen susceptibility depends only slightly on its microstructure, acicular or equi-axed: it depends much more on conditions of hydrogen contamination and on the thermal history afterward. When the alloy has been stabilized by annealing in {alpha} - {beta} and provided hydrogen absorption does not induce phase transformations, hydrogen sensitivity is relatively low: brittleness occurs suddenly but at a high concentration threshold (2000 ppm H), which coincides with hydrogen saturation of {beta} phase. When the alloy includes unstabilized phases, its response to hydrogen changes whether it has been finally annealed or not, in the 300 - 500 C temperature area, prone to {omega} phase formation. In the absence of such an annealing, a reduction in ductility only occurs at high concentrations (> 1500 ppm H). In the other and, after annealing at 400 C, alloy hardening and a ductility decrease start even at the lowest hydrogen amounts: then hydrogen susceptibility is very high. Low oxygen concentration (up to 2000 ppm) do not sensibly affect the good hydrogen tolerance of this alloy. Beyond 2500 ppm, oxygen, while improving tensile strength, yet severely decreases ductility. [French] Le comportement mecanique de l'alliage TA6-V6-E2 lors d'un essai dynamique a ete etudie en fonction de la teneur en hydrogene et en oxygene. La sensibilite vis-a-vis de l'hydrogene ne depend que tres faiblement de sa structure migrographique, aciculaire ou equiaxe; elle depend bien plus des conditions de contamination par l'hydrogene et de son histoire thermique apres contamination. Lorsque l'alliage a ete stabilise par un recuit dans le domaine biphase, et a condition que l'absorption d'hydrogene n'entraine pas de modification structurale, la sensibilite vis-a-vis de l'hydrogene est relativement faible: la fragilite apparait brutalement mais pour un

  5. The glass-forming ability of model metal-metalloid alloys

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Kai; Liu, Yanhui; Schroers, Jan [Department of Mechanical Engineering and Materials Science, Yale University, New Haven, Connecticut 06520 (United States); Center for Research on Interface Structures and Phenomena, Yale University, New Haven, Connecticut 06520 (United States); Shattuck, Mark D. [Department of Physics and Benjamin Levich Institute, The City College of the City University of New York, New York, New York 10031 (United States); Department of Mechanical Engineering and Materials Science, Yale University, New Haven, Connecticut 06520 (United States); O’Hern, Corey S. [Department of Mechanical Engineering and Materials Science, Yale University, New Haven, Connecticut 06520 (United States); Center for Research on Interface Structures and Phenomena, Yale University, New Haven, Connecticut 06520 (United States); Department of Physics, Yale University, New Haven, Connecticut 06520 (United States); Department of Applied Physics, Yale University, New Haven, Connecticut 06520 (United States)

    2015-03-14

    Bulk metallic glasses (BMGs) are amorphous alloys with desirable mechanical properties and processing capabilities. To date, the design of new BMGs has largely employed empirical rules and trial-and-error experimental approaches. Ab initio computational methods are currently prohibitively slow to be practically used in searching the vast space of possible atomic combinations for bulk glass formers. Here, we perform molecular dynamics simulations of a coarse-grained, anisotropic potential, which mimics interatomic covalent bonding, to measure the critical cooling rates for metal-metalloid alloys as a function of the atomic size ratio σ{sub S}/σ{sub L} and number fraction x{sub S} of the metalloid species. We show that the regime in the space of σ{sub S}/σ{sub L} and x{sub S} where well-mixed, optimal glass formers occur for patchy and LJ particle mixtures, coincides with that for experimentally observed metal-metalloid glass formers. Thus, our simple computational model provides the capability to perform combinatorial searches to identify novel glass-forming alloys.

  6. The effect of thermohydrogen treatment on the structure and properties of casts obtained from titanium alloys

    International Nuclear Information System (INIS)

    Il'in, A.A.; Skvortsova, S.V.; Mamonov, A.M.; Permyakova, G.V.; Kurnikov, D.A.

    2002-01-01

    The method based on the combination of high temperature gas-static and thermal hydrogen treatments is suggested to increase mechanical properties of cast pseudo-α and (α+β)-titanium alloys. The study is carried out using alloys VT20L, VT23L and alloy Ti-6%Al-2%Mo-4%Zr-2%Sn. It is shown that the method proposed provides the change in a cast structure, an increase in density of castings, an increase of strength properties by 10-20% and fatigue by a factor of 1.5-2 at satisfactory ductility and impact strength [ru

  7. Enhancement of magnetic properties of Co{sub 2}MnSi Heusler alloy prepared by mechanical alloying method

    Energy Technology Data Exchange (ETDEWEB)

    Rabie, Naeemeh; Gordani, Gholam Reza; Ghasemi, Ali, E-mail: ali13912001@yahoo.com

    2017-07-15

    Highlights: • Ferromagnetic Heusler alloys of Co{sub 2}MnSi were synthesized at low temperature. • There is an at least 30% reduction in the phase formation temperature. • Saturation magnetization of alloy was increased significantly after annealing. - Abstract: Ferromagnetic Heusler alloys of Co{sub 2}MnSi were synthesized by mechanical alloying method at low temperature. The effect of milling time and annealing process on structural and magnetic properties of ferromagnetic alloy samples were studied by X-ray diffraction, scanning electron microscopy and vibration sample magnetometer methods, respectively. Structural characteristics such as crystallite size, phase percentage, and lattice parameter determined using the Rietveld method. The values of these parameters were obtained 362.9 nm, 5.699 Å and 98.7%, respectively for annealed sample. Magnetization studies show that the Co2MnSi phase is formed at 15 h of milling and is optimized after 20 h of milling. VSM results showed that saturation magnetization (M{sub s}) of milled samples reduces from 112 to 75 (emu/g) with increasing milling time and then increased gradually to 95 emu/g. The effect of post-annealing on the structural and magnetic properties of milled samples was also investigated. The saturation magnetization of annealed sample (120 emu/g) is higher than the optimum milled sample (95 emu/g) due to increasing preferential ordered L2{sub 1} structure.

  8. Influence of atomic ordering on elastocaloric and magnetocaloric effects of a Ni–Cu–Mn–Ga ferromagnetic shape memory alloy

    International Nuclear Information System (INIS)

    Huang, Chonghui; Wang, Yu; Tang, Zhao; Liao, Xiaoqi; Yang, Sen; Song, Xiaoping

    2015-01-01

    Highlights: • Ni 51 Cu 4 Mn 20 Ga 25 alloy exhibits normal elastocaloric and magnetocaloric effects. • L2 1 atomic order of the alloy is increased after annealing at 773 K for 10 h. • Increasing L2 1 atomic order improves its elastocaloric and magnetocaloric effects. • Atomic ordering modifies the magnetic and martensitic transitions of the system. - Abstract: The coexisting elastocaloric and magnetocaloric effects in ferromagnetic shape memory alloys have attracted much attention for the potential application in solid state refrigeration. Previous studies show that the L2 1 atomic ordering of Heusler ferromagnetic shape memory alloys plays important role on their magnetocaloric effect. However, no research work investigates the effect of atomic ordering on their elastocaloric effect yet. In this study, we investigated the influence of atomic ordering on the elastocaloric and magnetocaloric effects of a Ni 51 Cu 4 Mn 20 Ga 25 ferromagnetic shape memory alloy. The alloy exhibits normal elastocaloric effect and normal magnetocaloric effect near room temperature. Moreover, we found that the enhancement of atomic order in this alloy can greatly increase the entropy change and refrigeration capacity of its elastocaloric and magnetocaloric effects. This is attributed to that the atomic ordering modifies the magnetic and martensitic transitions of the system

  9. Alloy materials

    Energy Technology Data Exchange (ETDEWEB)

    Hans Thieme, Cornelis Leo (Westborough, MA); Thompson, Elliott D. (Coventry, RI); Fritzemeier, Leslie G. (Acton, MA); Cameron, Robert D. (Franklin, MA); Siegal, Edward J. (Malden, MA)

    2002-01-01

    An alloy that contains at least two metals and can be used as a substrate for a superconductor is disclosed. The alloy can contain an oxide former. The alloy can have a biaxial or cube texture. The substrate can be used in a multilayer superconductor, which can further include one or more buffer layers disposed between the substrate and the superconductor material. The alloys can be made a by process that involves first rolling the alloy then annealing the alloy. A relatively large volume percentage of the alloy can be formed of grains having a biaxial or cube texture.

  10. Developing precipitation hardenable high entropy alloys

    Science.gov (United States)

    Gwalani, Bharat

    High entropy alloys (HEAs) is a concept wherein alloys are constructed with five or more elements mixed in equal proportions; these are also known as multi-principle elements (MPEs) or complex concentrated alloys (CCAs). This PhD thesis dissertation presents research conducted to develop precipitation-hardenable high entropy alloys using a much-studied fcc-based equi-atomic quaternary alloy (CoCrFeNi). Minor additions of aluminium make the alloy amenable for precipitating ordered intermetallic phases in an fcc matrix. Aluminum also affects grain growth kinetics and Hall-Petch hardenability. The use of a combinatorial approach for assessing composition-microstructure-property relationships in high entropy alloys, or more broadly in complex concentrated alloys; using laser deposited compositionally graded AlxCrCuFeNi 2 (0 mechanically processed via conventional techniques. The phase stability and mechanical properties of these alloys have been investigated and will be presented. Additionally, the activation energy for grain growth as a function of Al content in these complex alloys has also been investigated. Change in fcc grain growth kinetic was studied as a function of aluminum; the apparent activation energy for grain growth increases by about three times going from Al0.1CoCrFeNi (3% Al (at%)) to Al0.3CoCrFeNi. (7% Al (at%)). Furthermore, Al addition leads to the precipitation of highly refined ordered L12 (gamma') and B2 precipitates in Al0.3CoCrFeNi. A detailed investigation of precipitation of the ordered phases in Al0.3CoCrFeNi and their thermal stability is done using atom probe tomography (APT), transmission electron microscopy (TEM) and Synchrotron X-ray in situ and ex situ analyses. The alloy strengthened via grain boundary strengthening following the Hall-Petch relationship offers a large increment of strength with small variation in grain size. Tensile strength of the Al0.3CoFeNi is increased by 50% on precipitation fine-scale gamma' precipitates

  11. Contribution to the micrographic study of uranium and its alloys; Contribution a l'etude micrographique de l'uranium et de ses alliages

    Energy Technology Data Exchange (ETDEWEB)

    Monti, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1956-06-15

    The present report is the result of research carried out by the radio metallurgy section, to perfect micrographic techniques applicable to the study of samples of irradiated uranium. In the first part of this work, two polishing baths are developed, having the qualities with a minimum of disadvantages inherent in their respective compositions: they are, on the one hand perchloric acid-ethanol mixtures, and on the other hand a phospho-chromic-ethanol bath. In the chapter following, the micrographic attack of uranium is studied. The only satisfactory process is oxidation by cathode bombardment forming epitaxic layers. In the third chapter, an attempt is made to characterise the different surface states of the uranium by dissolution potential measurements and electronic diffraction. In the fourth chapter are given some examples of the application of these techniques to the micrographic study of various uranium alloys. In an appendix, it is shown how the chemical oxidation after phospho-chromic-alcohol polishing allows the different inclusions present in the molten uranium to be distinguished. By X-ray diffraction, uranium monocarbide and mononitride inclusions in particular are characterised. (author) [French] Le present rapport est le resultat de recherches effectuees au service de radiometallurgie pour la mise au point de techniques micrographiques applicables a l'etude d'echantillons d'uranium irradie. Dans la premiere partie de ce travail, nous mettons au point deux bains de polissage qui presentent les qualites inherentes a leur composition respective, avec le minimum d'inconvenients: ce sont d'une part des melanges acide perchlorique-ethanol, et d'autre part un bain phospho-chromique-ethanol. Dans le chapitre suivant, nous etudions l'attaque micrographique de l'uranium. Seul le procede d'oxydation par bombardement cathodique formant des couches epitaxiques, est satisfaisant. Dans le troisieme chapitre, nous essayons de caracteriser les differents etats de

  12. Microgalvanic Corrosion Behavior of Cu-Ag Active Braze Alloys Investigated with SKPFM

    Directory of Open Access Journals (Sweden)

    Armen Kvryan

    2016-04-01

    Full Text Available The nature of microgalvanic couple driven corrosion of brazed joints was investigated. 316L stainless steel samples were joined using Cu-Ag-Ti and Cu-Ag-In-Ti braze alloys. Phase and elemental composition across each braze and parent metal interface was characterized and scanning Kelvin probe force microscopy (SKPFM was used to map the Volta potential differences. Co-localization of SKPFM with Energy Dispersive Spectroscopy (EDS measurements enabled spatially resolved correlation of potential differences with composition and subsequent galvanic corrosion behavior. Following exposure to the aggressive solution, corrosion damage morphology was characterized to determine the mode of attack and likely initiation areas. When exposed to 0.6 M NaCl, corrosion occurred at the braze-316L interface preceded by preferential dissolution of the Cu-rich phase within the braze alloy. Braze corrosion was driven by galvanic couples between the braze alloys and stainless steel as well as between different phases within the braze microstructure. Microgalvanic corrosion between phases of the braze alloys was investigated via SKPFM to determine how corrosion of the brazed joints developed.

  13. Stress corrosion cracking of nickel alloys in bicarbonate and chloride solutions

    International Nuclear Information System (INIS)

    Ares, A. E.; Carranza, R. M.; Giordano, C. M.; Zadorozne, N. S.; Rebak, R.B.

    2013-01-01

    Alloy 22 is one of the candidates for the manufacture of high level radioactive waste containers. These containers provide services in natural environments characterized by multi-ionics solutions, it is estimated they could suffer three types of deterioration: general corrosion, localized corrosion (crevice corrosion) and stress corrosion cracking (SCC). It has been confirmed that the presence of bicarbonate at temperatures above 60°C and applied potentials around +400 mVSCE are necessary in order to produce cracking, . This susceptibility may be associated to the instability of the passive film formed and to the formation of an anodic current peak in the polarization curves in these media. Until now, it is unclear the role played by each alloying element (Ni, Cr or Mo) in the SCC susceptibility of Alloy 22 in these media The aim of this work is to evaluate the SCC susceptibility of nickel-based alloys in media containing bicarbonate and chloride ions, at high temperature. Slow Strain Rate Testing (SSRT) was conducted to samples of different alloys: 22 (Ni-Cr-Mo), 600 (Ni-Cr-Fe), 800H (Ni-Fe-Cr) y 201 (99.5% Ni).This tests were conducted in 1.1 mol/L NaHCO 3 +1.5 mol/L NaCl a 90°C and different applied potentials (+200mVSCE,+300 mVSCE, +400 mVSCE). These results were complemented with those obtained in a previous work, where we studied the anodic electrochemical behavior of nickel base alloys under the same conditions. It was found that alloy 22 showed a current peak in a potential range between +200 mVSCE and +300 mVSCE when immersed in bicarbonate ions containing solutions. This peak was attributed to the presence of chromium in the alloys. The SSRT showed that only alloy 22 has a clear indication of stress corrosion cracking. The current results suggested that the presence of an anodic peak in the polarization curves was not a sufficient condition for cracking. (author)

  14. Microstructure, biocorrosion and cytotoxicity evaluations of rapid solidified Mg-3Ca alloy ribbons as a biodegradable material.

    Science.gov (United States)

    Gu, X N; Li, X L; Zhou, W R; Cheng, Y; Zheng, Y F

    2010-06-01

    Rapidly solidified (RS) Mg–3Ca alloy ribbons were prepared by the melt-spinning technique at different wheel rotating speeds (15 m s(-1), 30 m s(-1) and 45 m s(-1) with the as-cast Mg–3Ca alloy ingot as a raw material. The RS45 Mg–3Ca alloy ribbon showed a much more fine grain size feature (approximately 200–500 nm) in comparison to the coarse grain size (50–100 μm)of the original as-cast Mg–3Ca alloy ingot. The corrosion electrochemical tests in simulated body fluid indicated that the corrosion rate of the as-cast Mg–3Ca alloy was strongly reduced by the RS procedure and tended to be further decreased with increasing wheel rotating speeds(1.43 mm yr(-1) for RS15, 0.94 mm yr(-1) for RS30 and 0.36 mm yr(-1) for RS45). The RS Mg–3Ca alloy ribbons showed more uniform corrosion morphology compared with the as-cast Mg–3Ca alloy after polarization. The cytotoxicity evaluation revealed that the three experimental as-spun Mg–3Ca alloy ribbon extracts did not induce toxicity to the L-929 cells,whereas the as-cast Mg–3Ca alloy ingot extract did. The L-929 cells showed more improved adhesion on the surfaces of the three as-spun Mg–3Ca alloy ribbons than that of the as-cast Mg–3Ca alloy ingot.

  15. Microstructure, biocorrosion and cytotoxicity evaluations of rapid solidified Mg-3Ca alloy ribbons as a biodegradable material

    International Nuclear Information System (INIS)

    Gu, X N; Zhou, W R; Zheng, Y F; Li, X L; Cheng, Y

    2010-01-01

    Rapidly solidified (RS) Mg-3Ca alloy ribbons were prepared by the melt-spinning technique at different wheel rotating speeds (15 m s -1 , 30 m s -1 and 45 m s -1 ) with the as-cast Mg-3Ca alloy ingot as a raw material. The RS45 Mg-3Ca alloy ribbon showed a much more fine grain size feature (approximately 200-500 nm) in comparison to the coarse grain size (50-100 μm) of the original as-cast Mg-3Ca alloy ingot. The corrosion electrochemical tests in simulated body fluid indicated that the corrosion rate of the as-cast Mg-3Ca alloy was strongly reduced by the RS procedure and tended to be further decreased with increasing wheel rotating speeds (1.43 mm yr -1 for RS15, 0.94 mm yr -1 for RS30 and 0.36 mm yr -1 for RS45). The RS Mg-3Ca alloy ribbons showed more uniform corrosion morphology compared with the as-cast Mg-3Ca alloy after polarization. The cytotoxicity evaluation revealed that the three experimental as-spun Mg-3Ca alloy ribbon extracts did not induce toxicity to the L-929 cells, whereas the as-cast Mg-3Ca alloy ingot extract did. The L-929 cells showed more improved adhesion on the surfaces of the three as-spun Mg-3Ca alloy ribbons than that of the as-cast Mg-3Ca alloy ingot.

  16. Synthesis of FeNi Alloy Nanomaterials by Proteic Sol-Gel Method: Crystallographic, Morphological, and Magnetic Properties

    Directory of Open Access Journals (Sweden)

    Cássio Morilla dos Santos

    2016-01-01

    Full Text Available Proteic Sol-Gel method was used for the synthesis of FeNi alloy at different temperature conditions and flow reduction. The solids were characterized by XRD, H2-TPR, SEM, TEM, Mössbauer spectroscopy, and VSM. It was observed by X-ray diffraction pure FeNi alloy in the samples reduced at 600°C (40 mL/min H2 flow and 700°C (25 mL/min H2 flow. The FeNi alloy presented stability against the oxidizing atmosphere up to 250°C. The morphology exhibited agglomerates relatively spherical and particles in the range of 10–40 nm. Mössbauer spectroscopy showed the presence of disordered ferromagnetic FeNi alloy, and magnetic hysteresis loop revealed a typical behavior of soft magnetic material.

  17. Microstructure and mechanical properties of multiphase NiAl-based alloys

    Science.gov (United States)

    Pank, D. R.; Koss, D. A.; Nathal, M. V.

    1990-01-01

    The effect of the gamma-prime phase on the deformation behavior and fracture resistance of melt-spun ribbons and consolidated bulk specimens of a series of Nial-based alloys with Co and Hf additions has been examined. The morphology, location, and volume fraction of the gamma-prime phase are significant factors in enhancing the fracture resistance of the normally brittle NiAl-based alloys. In particular, the results indicate that a continuous-grain-boundary film of gamma-prime can impart limited room-temperature ductility regardless of whether B2 or L10 NiAl is present. Guidelines for microstructure control in multiphase NiAl-based alloys are also presented.

  18. Ductile shape memory alloys of the Cu-Al-Mn system

    International Nuclear Information System (INIS)

    Kainuma, R.; Takahashi, S.; Ishida, K.

    1995-01-01

    Cu-Al-Mn shape memory alloys with enhanced ductility have been developed by decreasing the degree of order in the β parent phase. Cu-Al-Mn alloys with Al contents lower than 18% exhibit good ductility with elongations of about 15% and excellent cold-workability arising from a lower degree of order in the Heusler (L21) β 1 parent phase, without any loss in their shape memory behavior. In this paper the mechanical and shape memory characteristics, such as the cold-workability, the Ms temperatures, the shape memory effect and the pseudo-elasticity of such ductile Cu-Al-Mn alloys are presented. (orig.)

  19. Crystal growth velocity in deeply undercooled Ni-Si alloys

    Science.gov (United States)

    Lü, Y. J.

    2012-02-01

    The crystal growth velocity of Ni95Si5 and Ni90Si10 alloys as a function of undercooling is investigated using molecular dynamics simulations. The modified imbedded atom method potential yields the equilibrium liquidus temperatures T L ≈ 1505 and 1387 K for Ni95Si5 and Ni90Si10 alloys, respectively. From the liquidus temperatures down to the deeply undercooled region, the crystal growth velocities of both the alloys rise to the maximum with increasing undercooling and then drop slowly, whereas the athermal growth process presented in elemental Ni is not observed in Ni-Si alloys. Instead, the undercooling dependence of the growth velocity can be well-described by the diffusion-limited model, furthermore, the activation energy associated with the diffusion from melt to interface increases as the concentration increases from 5 to 10 at.% Si, resulting in the remarkable decrease of growth velocity.

  20. Hydrogen Induced Intergranular Cracking of Nickel-Base Alloys.

    Science.gov (United States)

    1982-02-01

    alloys are discussed. Experimental The steel used in the present investigation is a fully bainitic 2 1/4 Cr-lMo pressure vessel steel , ASTM A542 Class 3...Appendix A describes recent experiments performed in order to study the influence of plastic deformation on hydrogen transport in a 214 Cr-lMo steel (8...PLASTIC DEFORMATION ON HYDROGEN TRANSPORT IN 2 1/4 Cr-lMo STEEL M. Kurkela, G.S. Frankel, and R.M. Latanision Department of Materials Science and

  1. Thermal conductivity of nanocrystalline SiGe alloys using molecular dynamics simulations

    Science.gov (United States)

    Abs da Cruz, Carolina; Katcho, Nebil A.; Mingo, Natalio; Veiga, Roberto G. A.

    2013-10-01

    We have studied the effect of nanocrystalline microstructure on the thermal conductivity of SiGe alloys using molecular dynamics simulations. Nanograins are modeled using both the coincidence site lattice and the Voronoi tessellation methods, and the thermal conductivity is computed using the Green-Kubo formalism. We analyze the dependence of the thermal conductivity with temperature, grain size L, and misorientation angle. We find a power dependence of L1/4 of the thermal conductivity with the grain size, instead of the linear dependence shown by non-alloyed nanograined systems. This dependence can be derived analytically underlines the important role that disorder scattering plays even when the grains are of the order of a few nm. This is in contrast to non-alloyed systems, where phonon transport is governed mainly by the boundary scattering. The temperature dependence is weak, in agreement with experimental measurements. The effect of angle misorientation is also small, which stresses the main role played by the disorder scattering.

  2. Working hardening modelization in zirconium alloys

    International Nuclear Information System (INIS)

    Sanchez, P.; Pochettino, Alberto A.

    1999-01-01

    Working hardening effects on mechanical properties and crystallographic textures formation in Zr-based alloys are studied. The hardening mechanisms for different grain deformations and topological conditions of simple crystal yield are considered. Results obtained show that the differences in the cold rolling textures (L and T textures) can be related with hardening microstructural parameters. (author)

  3. Influence of atomic ordering on elastocaloric and magnetocaloric effects of a Ni–Cu–Mn–Ga ferromagnetic shape memory alloy

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Chonghui [MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter and State Key Laboratory for Mechanical Behavior of Materials, Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Yu, E-mail: yuwang@mail.xjtu.edu.cn [MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter and State Key Laboratory for Mechanical Behavior of Materials, Xi’an Jiaotong University, Xi’an 710049 (China); Multi-disciplinary Materials Research Center, Frontier Institute of Science and Technology, Xi’an Jiaotong University, Xi’an 710049 (China); Tang, Zhao; Liao, Xiaoqi; Yang, Sen; Song, Xiaoping [MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter and State Key Laboratory for Mechanical Behavior of Materials, Xi’an Jiaotong University, Xi’an 710049 (China)

    2015-05-05

    Highlights: • Ni{sub 51}Cu{sub 4}Mn{sub 20}Ga{sub 25} alloy exhibits normal elastocaloric and magnetocaloric effects. • L2{sub 1} atomic order of the alloy is increased after annealing at 773 K for 10 h. • Increasing L2{sub 1} atomic order improves its elastocaloric and magnetocaloric effects. • Atomic ordering modifies the magnetic and martensitic transitions of the system. - Abstract: The coexisting elastocaloric and magnetocaloric effects in ferromagnetic shape memory alloys have attracted much attention for the potential application in solid state refrigeration. Previous studies show that the L2{sub 1} atomic ordering of Heusler ferromagnetic shape memory alloys plays important role on their magnetocaloric effect. However, no research work investigates the effect of atomic ordering on their elastocaloric effect yet. In this study, we investigated the influence of atomic ordering on the elastocaloric and magnetocaloric effects of a Ni{sub 51}Cu{sub 4}Mn{sub 20}Ga{sub 25} ferromagnetic shape memory alloy. The alloy exhibits normal elastocaloric effect and normal magnetocaloric effect near room temperature. Moreover, we found that the enhancement of atomic order in this alloy can greatly increase the entropy change and refrigeration capacity of its elastocaloric and magnetocaloric effects. This is attributed to that the atomic ordering modifies the magnetic and martensitic transitions of the system.

  4. Ideal solution behaviour of glassy Cu–Ti, Zr, Hf alloys and properties of amorphous copper

    International Nuclear Information System (INIS)

    Ristić, R.; Cooper, J.R.; Zadro, K.; Pajić, D.; Ivkov, J.; Babić, E.

    2015-01-01

    Highlights: • Ideal solution behaviour (ISB) is established in all Cu–Ti, Zr, Hf glassy alloys. • ISB enables reliable estimates for various properties of amorphous Cu. • ISB also impacts glass forming ability in these and probably other similar alloys. - Abstract: A comprehensive study of selected properties of amorphous (a) Cu–TE alloys (TE = Ti, Zr and Hf) has been performed. Data for average atomic volumes of a-Cu–Hf, Ti alloys combined with literature data show that ideal solution behaviour (Vegard’s law) extends over the whole glass forming range (GFR) in all a-Cu–TE alloys. This enables one to obtain an insight into some properties and probable atomic arrangements for both, a-TEs (Ristić et al., 2010) and a-Cu by extrapolation of the data for alloys. Indeed the atomic volumes and other properties studied for all a-Cu–TE alloys extrapolate to the same values for a-Cu. Depending on the property, these values are either close to those of crystalline (c) Cu, or are close to those for liquid (L) Cu. In particular, the electronic transport properties of a-Cu seem close to those of L-Cu, whereas the static properties, such as the density of states, and Young’s modulus, converge to those of c-Cu. The possible impact of these results on our understanding of a-Cu–TE alloys, including glass forming ability, is discussed

  5. Strengthening mechanisms, creep, and fatigue processes in dispersion-hardened niobium alloy. Final scientific report, 1 Feb 89-31 Jan 92

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, A.K.; Gibeling, J.C.

    1992-04-20

    The creep and fatigue properties of pure Nb and Nb-l%Zr alloy were investigated. A model was developed based on the migration of subgrain boundary that can explain the anomalous primary creep transients found in Nb-l%Zr alloy, due to coarsening of subgrain structure. TEM investigations confirmed that such subgrain coarsening occurs during primary creep of Nb-l%Zr. Baseline low cycle fatigue studies of Nb and Nb-l%Zr were completed. Cyclic hardening is observed and there is a microplastic plateau in Nb. The Nb-1%Zr is stronger in cyclic deformation than Nb, with little influence of strain rate. The deformation in the alloy at both high and low strain rates is controlled by the interaction between gliding edge dislocation and solute atoms.

  6. Precipitation hardening in dilute Al–Zr alloys

    Directory of Open Access Journals (Sweden)

    Pedro Henrique Lamarão Souza

    2018-01-01

    Full Text Available The aim of this study was to investigate the effect of solute content (hipoperitectic Al–0.22 wt.%Zr and hiperperitectic Al–0.32 wt.%Zr on the precipitation hardening and microstructural evolution of dilute Al–Zr alloys isothermally aged. The materials were conventionally cast in a muffle furnace, solidified in a water-cooled Cu mold and subsequently heat-treated at the temperature of 650 K (377 °C for 4, 12, 24, 100 and 400 h. Mechanical characterization was performed at room temperature, using a microhardness tester and microstructural characterization was carried out on a Transmission Electron Microscope – TEM. The observed microhardness values increased during isothermal aging, due to the precipitation of nanometer-scale Al3Zr L12 particles. Peak strength was achieved within 100 h of aging. After aging for 400 h, microhardness values presented a slight decrease for both alloys, thus indicating overaging due to the coalescence of precipitates. Microhardness values increased with solute content, due to the precipitation of a higher number density of finer precipitates. After 400 h of heat-treating, coalescence was higher for the alloy with lower solute content and, also, the presence of antiphase boundaries – APBs, planar faults associated with the L12 to D023 structural transition, were observed. Comparing theoretical calculations of the increment in strength due to precipitation strengthening with experimental results, it was observed that their values are in reasonable agreement. The Orowan dislocation looping mechanism takes place during precipitation hardening for both alloys in the peak hardness condition.

  7. Structural Investigation of Rapidly Quenched FeCoPtB Alloys

    International Nuclear Information System (INIS)

    Grabias, A.; Kopcewicz, M.; Latuch, J.; Oleszak, D.

    2011-01-01

    Two sets of Fe 52-x Co x Pt 28 B 20 (x = 0-26 at.%) and Fe 60-x Co x Pt 25 B 15 (x = 0-40 at.%) alloys were prepared in the form of ribbons by the rapid quenching technique. Structure of the samples was characterized by Moessbauer spectroscopy and X-ray diffraction. In the as-quenched alloys the amorphous phase coexisted with the fcc-(Fe,Co)Pt disordered solid solution. Differential scanning calorimetry measurements performed in the range 50-720 ± C revealed one or two exothermal peaks. The magnetically hard ordered L1 0 (Fe,Co)Pt and magnetically soft (Fe,Co) 2 B nanocrystalline phases were formed due to thermal treatment of the alloys. The influence of Co content on the structure of the as-quenched and heated alloys was studied. (authors)

  8. The Interfacial Microstructure and Mechanical Properties of Diffusion-Bonded Joints of 316L Stainless Steel and the 4J29 Kovar Alloy Using Nickel as an Interlayer

    Directory of Open Access Journals (Sweden)

    Tingfeng Song

    2016-11-01

    Full Text Available 316L stainless steel (Fe–18Cr–11Ni and a Kovar (Fe–29Ni–17Co or 4J29 alloy were diffusion-bonded via vacuum hot-pressing in a temperature range of 850–950 °C with an interval of 50 °C for 120 min and at 900 °C for 180 and 240 min, under a pressure of 34.66 MPa. Interfacial microstructures of diffusion-bonded joints were characterized by optical microscopy (OM, scanning electron microscopy (SEM, X-ray diffraction (XRD, and energy dispersive spectroscopy (EDS. The inter-diffusion of the elements across the diffusion interface was revealed via electron probe microanalysis (EPMA. The mechanical properties of the joints were investigated via micro Vickers hardness and tensile strength. The results show that an Ni interlayer can serve as an effective diffusion barrier for the bonding of 316L stainless steel and the 4J29 Kovar alloy. The composition of the joints was 316L/Ni s.s (Fe–Cr–Ni/remnant Ni/Ni s.s (Fe–Co–Ni/4J29. The highest tensile strength of 504.91 MPa with an elongation of 38.75% was obtained at 900 °C for 240 min. After the width of nickel solid solution (Fe–Co–Ni sufficiently increased, failure located at the 4J29 side and the fracture surface indicated a ductile nature.

  9. Properties of Mechanically Alloyed W-Ti Materials with Dual Phase Particle Dispersion

    Czech Academy of Sciences Publication Activity Database

    Lukáč, František; Vilémová, Monika; Nevrlá, Barbara; Klečka, Jakub; Chráska, Tomáš; Molnárová, O.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 3. ISSN 2075-4701 R&D Projects: GA ČR(CZ) GA15-15609S Institutional support: RVO:61389021 Keywords : tungsten-titanium alloys * mechanical alloying * particle dispersion * pulsed electric current sintering * thermal conductivity * bending strength Subject RIV: JJ - Other Materials OBOR OECD: Materials engineering Impact factor: 1.984, year: 2016

  10. Precipitation structures and mechanical properties of Al-Li-Zr alloy containing V

    International Nuclear Information System (INIS)

    Ying, J.K.; Ohashi, T.

    1999-01-01

    It is known that Al-Li alloys possess high elastic modulus and low density, and the metastable δ' (Al 3 Li) precipitate in these alloys affords considerable strengthening effect. However, with the strengthening resulting from the precipitation of δ' which is coherent with the matrix, these alloys suffer from low ductility and fracture toughness. It seems that the loss of ductility is the slip localization which occurs as a result of slip planes during deformation in connection with the specific hardening mechanism. As a result it indicates typical intergranular fracture. On the one hand, zirconium is used in many aluminum alloys to inhibit recrystallization during alloy processing. When zirconium is present in the alloy grain refinement occurs, which consequently, is considered as a factor that reduces the slip distance, and lowers the stress concentration across grain boundaries and at grain boundary triple points. Nevertheless, if only zirconium is added in Al-Li alloy it still shows intergranular fracture. By Zedaris et al., equilibrium phase Al 3 (Zr,V) in Al-Zr alloy containing V reduces the lattice mismatch along the c-axis with Al and, the L1 2 -structure metastable precipitates Al 3 (Zr,V) in Al-Zr-V alloys are stable at elevated temperature. Therefore, it is interesting to elucidate the effect of V in Al-Li-Zr alloy at the precipitation structures and mechanical properties of these alloys

  11. Effect of mixed alloy combinations on fretting corrosion performance of spinal screw and rod implants.

    Science.gov (United States)

    Mali, Sachin A; Singh, Vaneet; Gilbert, Jeremy L

    2017-07-01

    Spinal implants are made from a variety of materials to meet the unique mechanical demands of each application. However, the medical device community has raised concern about mixing dissimilar metals in an implant because of fear of inducing corrosion. There is a lack of systematic studies on the effects of mixing metals on performance of spinal implants, especially in fretting corrosion conditions. Hence, the goal was to determine whether mixing stainless steel (SS316L), titanium alloy (Ti6Al4V) and cobalt chromium (CoCrMo) alloy components in a spinal implant leads to any increased risk of corrosion degradation. Spinal constructs consisting of single assembly screw-connector-rod components were tested using a novel short-term cyclic fretting corrosion test method. A total of 17 alloy component combinations (comprised of SS316L, Ti6Al4V-anodized and CoCrMo alloy for rod, screws and connectors) were tested under three anatomic orientations. Spinal constructs having all SS316L were most susceptible to fretting-initiated crevice corrosion attack and showed higher average fretting currents (∼25 - 30 µA), whereas constructs containing all Ti6Al4V components were less susceptible to fretting corrosion with average fretting currents in the range of 1 - 6 µA. Mixed groups showed evidence of fretting corrosion but they were not as severe as all SS316L group. SEM results showed evidence of severe corrosion attack in constructs having SS316L components. There also did not appear to be any galvanic effects of combining alloys together. © 2016 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 105B: 1169-1177, 2017. © 2016 Wiley Periodicals, Inc.

  12. 41 CFR 101-26.605 - Items other than petroleum products and electronic items available from the Defense Logistics...

    Science.gov (United States)

    2010-07-01

    ... petroleum products and electronic items available from the Defense Logistics Agency. 101-26.605 Section 101... available from the Defense Logistics Agency. Agencies required to use GSA supply sources should also use... Logistics Agency, the catalog will contain only those items in Federal supply classification classes which...

  13. Caracterização microestrutural de soldas dissimilares dos aços ASTM A-508 e AISI 316L Characterization of dissimilar metal weld between low alloy steel ASTM A-508 and 316L stainless steel

    Directory of Open Access Journals (Sweden)

    Luciana Iglésias Lourenço Lima

    2010-06-01

    Full Text Available As soldas dissimilares (dissimilar metal welds - DMWs são utilizadas em diversos segmentos da indústria. No caso específico de usinas nucleares, tais soldas são necessárias para conectar tubulações de aço inoxidável com componentes fabricados em aços baixa liga. Os materiais de adição mais utilizados neste tipo de solda são as ligas de níquel 82 e 182. Este trabalho consistiu na soldagem de uma junta dissimilar de aço baixa liga ASTM A-508 G3 e aço inoxidável austenítico AISI 316L utilizando as ligas de níquel 82 e 182 como metais de adição. A soldagem foi realizada manualmente empregando os processos de soldagem ao arco SMAW (Shielded Metal Arc Welding e GTAW (Gas Tungsten Arc Welding. Os corpos de prova foram caracterizados microestruturalmente utilizando-se microscópio óptico e microscópio eletrônico de varredura com microanálise por dispersão de energia de raios X (EDS e ensaios de microdureza Vickers. Observou-se uma microestrutura constituída de dendritas de austenita com a presença de precipitados com formas e dimensões definidas pelo aporte térmico e pela direção de soldagem. Não houve variação significativa da dureza ao longo da junta soldada, demonstrando a adequação dos parâmetros de soldagem utilizados.The dissimilar metal welds (DMWs are used in several areas of the industries. In the nuclear power plant, this weld using nickel alloy welding wires is used to connect stainless steel pipes to low alloy steel components on the reactor pressured vessels. The filler materials commonly used in this type of weld are nickel alloys 82 and 182.. In this study, dissimilar metal welds composed of low alloy steel ASTM A-508 G3, nickel alloys 82 e 182 as weld metals, and austenitic stainless steel AISI 316L were prepared by manual shielded metal arc welding (SMAW and gas tungsten arc welding techniques (GTAW. Samples were microstructural characterized by optical microscopy and scanning electron microscopy

  14. Stress-corrosion-cracking studies on candidate container alloys for the Tuff Repository

    International Nuclear Information System (INIS)

    Beavers, J.A.; Durr, C.L.

    1992-05-01

    Cortest Columbus Technologies, Inc. (CC Technologies) investigated the long-term performance of container materials used for high-level waste package as part of the information needed by the Nuclear Regulatory Commission (NRC) to assess the Department of Energy's application to construct to geologic repository for high-level radioactive waste. At the direction of the NRC, the program focused on the Tuff Repository. This report summarizes the results of Stress-Corrosion-Cracking (SCC) studies performed in Tasks 3, 5, and 7 of the program. Two test techniques were used; U-bend exposures and Slow-Strain-Rate (SSR) tests. The testing was performed on two copper-base alloys (Alloy CDA 102 and Alloy CDA 175) and two Fe-Cr-Ni alloys (Alloy 304L and Alloy 825) in simulated J-13 groundwater and other simulated solutions for the Tuff Repository. These solutions were designed to simulate the effects of concentration and irradiation on the groundwater composition. All SCC testing on the Fe-Cr-Ni Alloys was performed on solution-annealed specimens and thus issues such as the effect of sensitization on SCC were not addressed

  15. Microstructure, biocorrosion and cytotoxicity evaluations of rapid solidified Mg-3Ca alloy ribbons as a biodegradable material

    Energy Technology Data Exchange (ETDEWEB)

    Gu, X N; Zhou, W R; Zheng, Y F [State Key Laboratory for Turbulence and Complex System and Department of Advanced Materials and Nanotechnology, College of Engineering, Peking University, Beijing 100871 (China); Li, X L [Center for Biomedical Materials and Engineering, Harbin Engineering University, Harbin 150001 (China); Cheng, Y, E-mail: yfzheng@pku.edu.c [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China)

    2010-06-01

    Rapidly solidified (RS) Mg-3Ca alloy ribbons were prepared by the melt-spinning technique at different wheel rotating speeds (15 m s{sup -1}, 30 m s{sup -1} and 45 m s{sup -1}) with the as-cast Mg-3Ca alloy ingot as a raw material. The RS45 Mg-3Ca alloy ribbon showed a much more fine grain size feature (approximately 200-500 nm) in comparison to the coarse grain size (50-100 {mu}m) of the original as-cast Mg-3Ca alloy ingot. The corrosion electrochemical tests in simulated body fluid indicated that the corrosion rate of the as-cast Mg-3Ca alloy was strongly reduced by the RS procedure and tended to be further decreased with increasing wheel rotating speeds (1.43 mm yr{sup -1} for RS15, 0.94 mm yr{sup -1} for RS30 and 0.36 mm yr{sup -1} for RS45). The RS Mg-3Ca alloy ribbons showed more uniform corrosion morphology compared with the as-cast Mg-3Ca alloy after polarization. The cytotoxicity evaluation revealed that the three experimental as-spun Mg-3Ca alloy ribbon extracts did not induce toxicity to the L-929 cells, whereas the as-cast Mg-3Ca alloy ingot extract did. The L-929 cells showed more improved adhesion on the surfaces of the three as-spun Mg-3Ca alloy ribbons than that of the as-cast Mg-3Ca alloy ingot.

  16. Investigation on mechanical alloying process for v-cr-ti alloys

    International Nuclear Information System (INIS)

    Stanciulescu, M.; Carlan, P.; Mihalache, M.; Bucsa, G.; Abrudeanu, M.; Galateanu, A.

    2015-01-01

    Mechanical alloying (MA) is an efficient approach for fabricating oxide-dispersion alloys and structural materials including vanadium alloys for fusion and fission application. Dissolution behaviour of the alloying elements is a key issue for optimizing the mechanical alloying process in fabricating vanadium alloys. This paper studies the MA process of V-4wt.%Cr-4wt.%Ti alloy. The outcomes of the MA powders in a planetary ball mill are reported in terms of powder particle size and morphology evolution and elemental composition. The impact of spark-plasma sintering process on the mechanically alloyed powder is analysed. An optimal set of sintering parameters, including the maximum temperature, the dwell time and the heating rate are determined. (authors)

  17. Pneumonitis and lethal pulmonary fibrosis (Hamman-Rich syndrome) due to Parathione (E605) poisoning

    International Nuclear Information System (INIS)

    Lotz, W.; Fasske, E.; Forschungsinstitut Borstel

    1986-01-01

    A patient with chronic Parathione (E 605) poisoning was observed over a period of 55 days. During that time he developed progressive changes, which were identical to those of progressive idiopathic pulmonary fibrosis. The rapid development of an alveolitis, followed by a lethal pulmonary fibrosis, differed in no way, macroscopically nor microscopically, from the lung changes in paraquat poisoning (paraquat lung). The radiologic course has been correlated with the clinical and post mortem findings. (orig.) [de

  18. Survey of degradation modes of four nickel-chromium-molybdenum alloys

    International Nuclear Information System (INIS)

    Gdowski, G.E.

    1991-03-01

    This report examines the degradation modes of four Ni-Cr-Mo alloys under conditions relevant to the Yucca Mountain Site Characterization Project (YMP). The materials considered are Alloys C-276, C-4, C-22, and 625 because they have desirable characteristics for the conceptual design (CD) of the high-level radioactive-waste containers presented in the YMP Site Characterization Plan (SCP). The types of degradation covered in this report are general corrosion; localized corrosion, including pitting and crevice corrosion; stress corrosion cracking in chloride environments; hydrogen embrittlement (HE); and undesirable phase transformations due to a lack of phase stability. Topics not specifically addressed are welding concerns and microbiological corrosion. The four Ni-Cr-Mo alloys have excellent corrosion resistance in chloride environments such as seawater as well as in more aggressive environments. They have significantly better corrosion resistance than the six materials considered for the CD waste container in the YMP SCP. (Those six materials are Types 304L and 3161L stainless steels, Alloy 825, unalloyed copper, Cu(70)-Ni(30), and 7% aluminum bronze.) In seawater, the Ni-Cr-Mo alloys have negligible general corrosion rates and show little evidence of localized corrosion. The four base materials of these alloys are expected to have nearly indistinguishable corrosion resistance in the YMP environments. The strength requirements of the SCP-CD waste container are met by these materials in the annealed condition; in this condition, they are highly resistant to HE. Historically, HE has been noted when these materials have been strengthened (cold-worked) and used in sour gas (H 2 S and CO 2 ) well service -- conditions that are not expected for the YMP. Metallurgical phase stability may be a concern under conditions favoring (1) the formation of intermetallics and carbides, and (2) microstructural ordering

  19. Surface effect theory in binary alloys: surfaces with cut-off

    International Nuclear Information System (INIS)

    Kumar, V.; Silva, C.E.T.G. da; Moran-Lopez, J.L.

    1981-01-01

    A surface effect theory in binary alloys which ore ordered with surfaces with cut-off is presented. This theory is based in a model of pair interaction between first neighbours and includes long and short range effects. The (120) surface with sup(-) (110) monoatomic cut-off and terrace in the (110) planes of an alloy with body centered cubic structure is presented as example. Results for the concentrations in all the different surface sites are given. (L.C.) [pt

  20. Grain distinct stratified nanolayers in aluminium alloys

    Energy Technology Data Exchange (ETDEWEB)

    Donatus, U., E-mail: uyimedonatus@yahoo.com [School of Materials, The University of Manchester, Manchester, M13 9PL, England (United Kingdom); Thompson, G.E.; Zhou, X.; Alias, J. [School of Materials, The University of Manchester, Manchester, M13 9PL, England (United Kingdom); Tsai, I.-L. [Oxford Instruments NanoAnalysis, HP12 2SE, High Wycombe (United Kingdom)

    2017-02-15

    The grains of aluminium alloys have stratified nanolayers which determine their mechanical and chemical responses. In this study, the nanolayers were revealed in the grains of AA6082 (T6 and T7 conditions), AA5083-O and AA2024-T3 alloys by etching the alloys in a solution comprising 20 g Cr{sub 2}O{sub 3} + 30 ml HPO{sub 3} in 1 L H{sub 2}O. Microstructural examination was conducted on selected grains of interest using scanning electron microscopy and electron backscatter diffraction technique. It was observed that the nanolayers are orientation dependent and are parallel to the {100} planes. They have ordered and repeated tunnel squares that are flawed at the sides which are aligned in the <100> directions. These flawed tunnel squares dictate the tunnelling corrosion morphology as well as appearing to have an affect on the arrangement and sizes of the precipitation hardening particles. The inclination of the stratified nanolayers, their interpacing, and the groove sizes have significant influence on the corrosion behaviour and seeming influence on the strengthening mechanism of the investigated aluminium alloys. - Highlights: • Stratified nanolayers in aluminium alloy grains. • Relationship of the stratified nanolayers with grain orientation. • Influence of the inclinations of the stratified nanolayers on corrosion. • Influence of the nanolayers interspacing and groove sizes on hardness and corrosion.

  1. Microstructure, mechanical properties, castability and in vitro biocompatibility of Ti-Bi alloys developed for dental applications.

    Science.gov (United States)

    Qiu, K J; Liu, Y; Zhou, F Y; Wang, B L; Li, L; Zheng, Y F; Liu, Y H

    2015-03-01

    In this study, the microstructure, mechanical properties, castability, electrochemical behaviors, cytotoxicity and hemocompatibility of Ti-Bi alloys with pure Ti as control were systematically investigated to assess their potential applications in the dental field. The experimental results showed that, except for the Ti-20Bi alloy, the microstructure of all other Ti-Bi alloys exhibit single α-Ti phase, while Ti-20Bi alloy is consisted of mainly α-Ti phase and a small amount of BiTi2 and BiTi3 phases. The tensile strength, hardness and wear resistance of Ti-Bi alloys were demonstrated to be improved monotonically with the increase of Bi content. The castability test showed that Ti-2Bi alloy increased the castability of pure Ti by 11.7%. The studied Ti-Bi alloys showed better corrosion resistance than pure Ti in both AS (artificial saliva) and ASFL (AS containing 0.2% NaF and 0.3% lactic acid) solutions. The concentrations of both Ti ion and Bi ion released from Ti-Bi alloys are extremely low in AS, ASF (AS containing 0.2% NaF) and ASL (AS containing 0.3% lactic acid) solutions. However, in ASFL solution, a large number of Ti and Bi ions are released. In addition, Ti-Bi alloys produced no significant deleterious effect to L929 cells and MG63 cells, similar to pure Ti, indicating a good in vitro biocompatibility. Besides, both L929 and MG63 cells perform excellent cell adhesion ability on Ti-Bi alloys. The hemolysis test exhibited that Ti-Bi alloys have an ultra-low hemolysis percentage below 1% and are considered nonhemolytic. To sum up, the Ti-2Bi alloy exhibits the optimal comprehensive performance and has great potential for dental applications. Copyright © 2015 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  2. Fatigue crack growth rates and fracture toughness of rapidly solidified Al-8.5 pct Fe-1.2 pct V-1.7 pct Si alloys

    International Nuclear Information System (INIS)

    Hariprasad, S.; Sastry, S.M.L.; Jerina, K.L.

    1994-01-01

    The room-temperature fatigue crack growth rates (FCGR) and fracture toughness were evaluated for different crack plane Orientations of an Al-8.5 pct Fe-1.2 pct V-1.7 pct Si alloy produced by planar flow casting (PFC) and atomized melt deposition (AMD) processes. For the alloy produced by the PFC process, properties were determined in six different orientations, including the short transverse directions S-T and S-L. Diffusion bonding and adhesive bonding methods were used to prepare specimens for determining FCGR and fracture toughness in the short transverse direction. Interparticle boundaries control fracture properties in the alloy produced by PFC. Fracture toughness of the PFC alloy varies from 13.4 MPa√ bar m to 30.8 MPa√ bar m, depending on the orientation of the crack plane relative to the interparticle boundaries. Fatigue crack growth resistance and fracture toughness are greater in the L-T, L-S, and T-S directions than in the T-L, S-T, and S-L orientations. The alloy produced by AMD does not exhibit anisotropy in fracture toughness and fatigue crack growth resistance in the as-deposited condition or in the extruded condition. The fracture toughness varies from 17.2 MPa√ bar m to 18.5 MPa√ bar m for the as-deposited condition and from 19.8 MPa√ bar m to 21.0 MPa√ bar m for the extruded condition. Fracture properties are controlled by intrinsic factors in the alloy produced by AMD. Fatigue crack growth rates of the AMD alloy are comparable to those of the PFC alloy in the L-T orientation. The crack propagation modes were studied by optical metallographic examination of crack-microstructure interactions and scanning electron microscopy of the fracture surfaces

  3. Influence de la contrainte moyenne sur la tenue en fatigue de l ...

    African Journals Online (AJOL)

    Dans ce cadre, le présent document montre l\\'influence de la contrainte moyenne sur l\\'amplitude des contraintes de deux alliages d\\'aluminium, le 1200 et le 5005 ... This model is near to experimental reality for the Al alloy1200 but badly estimate the effect of means stress on the stress amplitudes for the Al alloy 5005 H18.

  4. Effect of rolling reduction on the development of rolling and recrystallization textures in Al-Mg alloys

    Energy Technology Data Exchange (ETDEWEB)

    Endou, S; Inagaki, H [Shonan Inst. of Tech., Fujisawashi (Japan)

    2002-07-01

    In order to investigate the effect of Mg content on the development of the rolling textures in Al pure Al, Al-3% Mg alloy and Al-5% Mg alloy were cold rolled by varying rolling reductions up to 97%. Their rolling textures were investigated by the orientation distribution function analysis. The extent of work hardening introduced by cold rolling was estimated by the hardness measurements. It was found that, at all rolling reductions, the main orientations of the rolling textures depended strongly on the Mg content. In pure Al, {l_brace}123{r_brace} left angle 634 right angle was always the main orientation, whereas {l_brace}112{r_brace} left angle 111 right angle was most strong in the Al-3%Mg alloy. In the Al-5% Mg alloy, the development of both {l_brace}123{r_brace} left angle 634 right angle and {l_brace}112{r_brace} left angle 111 right angle were strongly suppressed, whereas {l_brace}110{r_brace} left angle 112 right angle developed remarkably. In pure Al, most of the texture development occurred at the later half of work hardening, i.e. at rolling reductions above 70%. With increasing Mg content, rolling texture tended to develop already at lower rolling reductions. Dynamic recovery, which occurred at very high rolling reductions, suppressed the development of the rolling textures. All these results strongly suggested that the formation of dislocation cell structures and shear banding are origins of the formation of these rolling textures. On annealing these specimens at 450 C for 30 min, recrystallization textures developed only in specimens having strong rolling textures, i. e. in the specimens cold rolled more than 70%. {l_brace}100{r_brace} left angle 001 right angle developed only in pure Al and in the Al-3% Mg ally, in which {l_brace}123{r_brace} left angle 634 right angle and {l_brace}112{r_brace} left angle 111 right angle were strong in the rolling textures. Recrystallization textures of the Al-5% Mg alloy was wather random. Its main orientation, {l

  5. Toughness testing and high-temperature oxidation evaluations of advanced alloys for core internals

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Lizhen [ORNL; Pint, Bruce A [ORNL; Chen, Xiang [ORNL

    2016-09-16

    Alloy X-750 was procured from Carpenter Technology and Bodycote in this year. An appropriate TMT was developed on Alloy 439 to obtain materials with refined grain size for property screening tests. Charpy V-notch impact tests were completed for the three ferritic steels Grade 92, Alloy 439, and 14YWT. Fracture toughness tests at elevated temperatures were completed for 14YWT. The tests will be completed for the other alloys in next fiscal year. Steam oxidation tests of the three ferritic steels, 316L, and Zr–2.5Nb have been completed. The steam tests of the Ni-based superalloys and the other austenitic stainless steels will be continued and finished in next fiscal year. Performance ranking in terms of steam oxidation resistance and impact/fracture toughness of the alloys will be deduced.

  6. Corrosion performance of Cr3C2-NiCr+0.2%Zr coated super alloys under actual medical waste incinerator environment

    Science.gov (United States)

    Ahuja, Lalit; Mudgal, Deepa; Singh, Surendra; Prakash, Satya

    2018-03-01

    Incineration techniques are widely used to dispose of various types of waste which lead to formation of very corrosive environment. Such corrosive environment leads to the degradation of the alloys used in these areas. To obviate this problem, zirconium modified Cr3C2-(NiCr) coating powder has been deposited on three superalloys namely Superni 718, Superni 600 and Superco 605 using Detonation gun technique. Corrosion test was conducted in actual medical waste incinerator environment. The samples were hung inside the secondary chamber operated at 1050°C for 1000h under cyclic condition. Corrosion kinetics was monitored using the weight gain measurements and thickness loss. Corrosion products were characterized using scanning electron microscopy, energy dispersive spectroscopy and X-ray diffraction technique. It was observed that coating is found to be successful in impeding the corrosion problem in superalloys.

  7. In vitro metal ion release and biocompatibility of amorphous Mg67Zn28Ca5 alloy with/without gelatin coating

    International Nuclear Information System (INIS)

    Chan, W.Y.; Chian, K.S.; Tan, M.J.

    2013-01-01

    Amorphous zinc-rich Mg–Zn–Ca alloys have exhibited good tissue compatibility and low hydrogen evolution in vivo. However, suboptimal cell–surface interaction on magnesium alloy surface observed in vitro could lead to reduced integration with host tissue for regenerative purpose. This study aims to improve cell–surface interaction of amorphous Mg 67 Zn 28 Ca 5 alloy by coating a gelatin layer by electrospinning. Coated/uncoated alloys were immersed and extracted for 3 days under different CO 2 . The immersion results showed that pH and metal ion release in the alloy extracts were affected by gelatin coating and CO 2 , suggesting their roles in alloy biocorrosion and a mechanism has been proposed for the alloy–CO 2 system with/without coating. Cytotoxicity results are evident that gelatin-coated alloy with 2-day crosslinking not only exhibited no indirect cytotoxicity, but also supported attachment of L929 and MG63 cell lines around/on the alloy with high viability. Therefore, amorphous Mg 67 Zn 28 Ca 5 alloy coated with gelatin by electrospinning technique provides a useful method to improve alloy biocompatibility. - Highlights: • Electrospinning is a new method to coat amorphous Mg 67 Zn 28 Ca 5 alloy with gelatin. • Gelatin-coated alloy has differential effect on pH and ion release at various CO 2 . • L929 cell proliferation correlates with Mg 2+ level in alloy extracts. • Biomimetic gelatin coating significantly improves cell–surface interaction

  8. Characteristics of mechanical alloying of Zn-Al-based alloys

    International Nuclear Information System (INIS)

    Zhu, Y.H.; Hong Kong Polytechnic; Perez Hernandez, A.; Lee, W.B.

    2001-01-01

    Three pure elemental powder mixtures of Zn-22%Al-18%Cu, Zn-5%Al-11%Cu, and Zn-27%Al-3%Cu (in wt.%) were mechanically alloyed by steel-ball milling processing. The mechanical alloying characteristics were investigated using X-ray diffraction, scanning electron microscopy, and transmission electron microscopy techniques. It was explored that mechanical alloying started with the formation of phases from pure elemental powders, and this was followed by mechanical milling-induced phase transformation. During mechanical alloying, phases stable at the higher temperatures formed at the near room temperature of milling. Nano-structure Zn-Al-based alloys were produced by mechanical alloying. (orig.)

  9. Estimation of Enthalpy of Formation of Liquid Transition Metal Alloys: A Modified Prescription Based on Macroscopic Atom Model of Cohesion

    Science.gov (United States)

    Raju, Subramanian; Saibaba, Saroja

    2016-09-01

    The enthalpy of formation Δo H f is an important thermodynamic quantity, which sheds significant light on fundamental cohesive and structural characteristics of an alloy. However, being a difficult one to determine accurately through experiments, simple estimation procedures are often desirable. In the present study, a modified prescription for estimating Δo H f L of liquid transition metal alloys is outlined, based on the Macroscopic Atom Model of cohesion. This prescription relies on self-consistent estimation of liquid-specific model parameters, namely electronegativity ( ϕ L) and bonding electron density ( n b L ). Such unique identification is made through the use of well-established relationships connecting surface tension, compressibility, and molar volume of a metallic liquid with bonding charge density. The electronegativity is obtained through a consistent linear scaling procedure. The preliminary set of values for ϕ L and n b L , together with other auxiliary model parameters, is subsequently optimized to obtain a good numerical agreement between calculated and experimental values of Δo H f L for sixty liquid transition metal alloys. It is found that, with few exceptions, the use of liquid-specific model parameters in Macroscopic Atom Model yields a physically consistent methodology for reliable estimation of mixing enthalpies of liquid alloys.

  10. Crevice corrosion resistance of Ni-Cr-Mo alloys as engineered barriers in nuclear waste repositories

    International Nuclear Information System (INIS)

    Hornus, E. C.; Carranza, R. M.; Giordano, C. M.; Rodríguez, M. A.; Rebak, R. B.

    2013-01-01

    The crevice corrosion re passivation potential was determined by the Potentiodynamic- Galvanostatic-Potentiodynamic (PD-GS-PD) method. Alloys 625, C-22, C-22HS and HYBRID-BC1 were used. Specimens contained 24 artificially creviced spots formed by a ceramic washer (crevice former) wrapped with a PTFE tape. Crevice corrosion tests were performed in 0,1 mol/L and 1 mol/L NaCl solutions at temperatures between 20 and 90ºC, and CaCl2 5 mol/L solution at temperatures between 20 and 117°C. The crevice corrosion resistance of the alloys increased in the following order: 625 < C-22 < C-22HS < HYBRID-BC1. The repassivation potential (ECO) showed the following relationship with temperature (T) and chloride concentration ([Cl-]) ECO = (A + B T) log [Cl-] + C T + D; where A, B, C and D are constants. At temperatures above 90°C, ECO for alloy 625 stabilized at a minimum value of -0.26 VSCE (author)

  11. Work hardening characteristics in Al base alloys with 12.6 and 45 wt.% Zn

    International Nuclear Information System (INIS)

    Abd El-Salam, F.; Mostafa, M.M.; Wahab, L.A.; Mostafa, M.T.; Abd El-Aziz, Sh.M.

    2008-01-01

    The stress-strain curves were obtained for Al-Zn alloys of 12.6 wt.% Zn (alloy I) and 45 wt.% Zn (alloy II) with elements of purity (99.99). The monotonic shift of these curves towards lower flow stress and higher ductility was interrupted at the transformation temperatures 483 K (alloy I) and both 543, 603 K (alloy II). By increasing deformation temperature, Young's modulus, Y, yield and fracture stresses, σ y and σ f , respectively, fracture time, t f , the coefficient of parabolic work hardening, χ, decreased while fracture strain, ε f , and dislocation slip distance, L, increased. From the obtained X-rays diffraction patterns the lattice strain, ε, crystallite size, η, and dislocation density, ρ, were obtained at different deformation temperatures around transformation

  12. Effect of Si addition on the glass-forming ability of a NiTiZrAlCu alloy

    International Nuclear Information System (INIS)

    Liang, W.Z.; Shen, J.; Sun, J.F.

    2006-01-01

    The effect of Si addition on the glass-forming ability (GFA) of a NiTiZrAlCu alloy was investigated by using differential scanning calorimetry (DSC), differential thermal analysis (DTA), X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The maximum diameter of glassy rods increased from 0.5 mm for the Ni 42 Ti 20 Zr 25 Al 8 Cu 5 alloy (the base alloy) to 2.5 mm for the Ni 42 Ti 20 Zr 21.5 Al 8 Cu 5 Si 3.5 alloy and to 3 mm for the Ni 42 Ti 19 Zr 22.5 Al 8 Cu 5 Si 3.5 alloy, when prepared by using the copper mould casting. The GFA of the alloys can be assessed by the reduced glass transition temperature T rg (=T g /T l ) and a newly proposed parameter, δ(=T x /T l - T g ). An addition of a proper amount of Si and a minor substitution of Ti with Zr can enhance the GFA of the base alloy by suppressing the formation of primary Ni(TiZr) and (TiZr)(CuAl) 2 phases and inducing the composition close to eutectic

  13. Microstructure, mechanical property, corrosion behavior, and in vitro biocompatibility of Zr-Mo alloys.

    Science.gov (United States)

    Zhou, F Y; Wang, B L; Qiu, K J; Li, L; Lin, J P; Li, H F; Zheng, Y F

    2013-02-01

    In this study, the microstructure, mechanical properties, corrosion behaviors, and in vitro biocompatibility of Zr-Mo alloys as a function of Mo content after solution treatment were systemically investigated to assess their potential use in biomedical application. The experimental results indicated that Zr-1Mo alloy mainly consisted of an acicular structure of α' phase, while ω phase formed in Zr-3Mo alloy. In Zr-5Mo alloy, retained β phase and a small amount of precipitated α phase were observed. Only the retained β phase was obtained in Zr-10Mo alloy. Zr-1Mo alloy exhibited the greatest hardness, bending strength, and modulus among all experimental Zr-Mo alloys, while β phase Zr-10Mo alloy had a low modulus. The results of electrochemical corrosion indicated that adding Mo into Zr improved its corrosion resistance which resulted in increasing the thermodynamic stability and passivity of zirconium. The cytotoxicity test suggested that the extracts of the studied Zr-Mo alloys produced no significant deleterious effect to fibroblast cells (L-929) and osteoblast cells (MG 63), indicating an excellent in vitro biocompatibility. Based on these facts, certain Zr-Mo alloys potentially suitable for different biomedical applications were proposed. Copyright © 2012 Wiley Periodicals, Inc.

  14. Study of thermodynamic properties of binary and ternary liquid alloys of aluminium with the elements iron, cobalt, nickel and oxygen; Etude des proprietes thermodynamiques des alliages liquides binaires et ternaires de l'aluminium avec les elements fer, cobalt, nickel et l'oxygene

    Energy Technology Data Exchange (ETDEWEB)

    Vachet, F [CEA Vallee du Rhone, 26-Pierrelatte (France)

    1966-07-01

    The present work deals with the thermodynamic study of aluminium liquid alloys with the metals iron, cobalt and nickel. The experiments carried out lead to the activity, at 1600 deg C, of aluminium in the (Al, Fe), (Al, Co), (Al, Ni) liquid alloys. The experimental method used consists in studying the partition of aluminium between the liquid immiscible phases made up with the pairs of metals (Fe, Ag), (Co, Ag), (Ni, Ag). The informations so obtained are used for drawing the isothermal equilibrium phases diagrams sections of (Al, Fe, Ag), (Al, Co, Ag), (Al, Ni, Ag) systems. The study of the partition of silver between lead and aluminium joined with the determinations of several authors allows us to determine the aluminium activity, analytically presented, in the metal M (iron cobalt and nickel). The Wagner's interaction parameters of aluminium in metal M are determined. The results obtained as the equilibrium phases diagrams of (Al, M) systems allow to compare the thermodynamic properties of the Al Fe system in liquid and solid states and to estimate the enthalpies of melting of the AlCo and AlNi intermetallic compounds. The activity, at 1600 deg C, of aluminium in (Al, Fe, Co), (Al, Fe, Ni), (Al, Co, Ni) liquid alloys is estimated through thermodynamic properties of binary components systems by application of several methods leading to results in good agreement. The study of aluminium-oxygen interactions in the liquid metallic solvants M allows us to propose an explanation for the shape of the deoxidation equilibrium line of iron, cobalt and nickel by aluminium and to compare the de-oxidizing power of aluminium toward iron, cobalt and nickel oxides. (author) [French] Le travail presente se rapporte a l'etude thermodynamique des alliages liquides de l'aluminium avec les metaux fer, cobalt et nickel. Les experiences effectuees ont pour but de determiner l'activite, a 1600 C, de l'aluminium dans les alliages liquides (Al, Fe), (Al, Co), (Al, Ni). La methode

  15. 38 CFR 14.605 - Suits against Department of Veterans Affairs employees arising out of a wrongful act or omission...

    Science.gov (United States)

    2010-07-01

    ... MISCELLANEOUS CLAIMS Federal Tort Claims § 14.605 Suits against Department of Veterans Affairs employees arising... damage, personal injury, or death allegedly occurring as a result of malpractice or negligence committed... Health Administration. Accordingly, a malpractice or negligence suit for property damage, personal injury...

  16. An efficient biomimetic coating methodology for a prosthetic alloy

    International Nuclear Information System (INIS)

    Adawy, Alaa; Abdel-Fattah, Wafa I.

    2013-01-01

    The combination of the load-bearing metallic implants with the bioactive materials in the design of synthetic implants is an important aspect in the biomaterials research. Biomimetic coating of bioinert alloys with calcium phosphate phases provides a good alternative to the prerequisite for the continual replacement of implants because of the failure of bone-implant integration. We attempted to accelerate the biomimetic coating process of stainless steel alloy (316L) with biomimetic apatite. In addition, we investigated the incorporation of functioning minerals such as strontianite and smithsonite into the deposited layer. In order to develop a highly mature apatite coating, our method requires soaking of the pre-treated alloy in highly concentrated synthetic body fluid for only few hours. Surface characterizations were performed by scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDX) and Diffuse Reflectance Infrared Fourier Transform Spectroscopy (DRIFTS). Also, the deposited apatitic layers were analysed by powder diffraction X-ray analysis (XRD). 316L surface showed the growth of highly crystalline, low carbonated hydroxyapatite, after only 6 h of the whole soaking process. Highlights: ► The manuscript describes a fast and efficient biomimetic coating methodology. ► This methodology can be used for metallic implants. ► 316L was coated with crystalline hydroxyapatite. ► Addition of strontium and zinc lead to the deposition of brushite. ► Coating of all synthetic solutions is highly crystalline

  17. Modelling the Flow Stress of Alloy 316L using a Multi-Layered Feed Forward Neural Network with Bayesian Regularization

    Science.gov (United States)

    Abiriand Bhekisipho Twala, Olufunminiyi

    2017-08-01

    In this paper, a multilayer feedforward neural network with Bayesian regularization constitutive model is developed for alloy 316L during high strain rate and high temperature plastic deformation. The input variables are strain rate, temperature and strain while the output value is the flow stress of the material. The results show that the use of Bayesian regularized technique reduces the potential of overfitting and overtraining. The prediction quality of the model is thereby improved. The model predictions are in good agreement with experimental measurements. The measurement data used for the network training and model comparison were taken from relevant literature. The developed model is robust as it can be generalized to deformation conditions slightly below or above the training dataset.

  18. Stress corrosion cracking behavior of annealed and cold worked 316L stainless steel in supercritical water

    Energy Technology Data Exchange (ETDEWEB)

    Sáez-Maderuelo, A., E-mail: alberto.saez@ciemat.es; Gómez-Briceño, D.

    2016-10-15

    Highlights: • The alloy 316L is susceptible to stress corrosion cracking in supercritical water. • The susceptibility of alloy 316L increases with temperature and plastic deformation. • Dynamic strain ageing processes may be active in the material. - Abstract: The supercritical water reactor (SCWR) is one of the more promising designs considered by the Generation IV International Forum due to its high thermal efficiency and improving security. To build this reactor, standardized structural materials used in light water reactors (LWR), like austenitic stainless steels, have been proposed. These kind of materials have shown an optimum behavior to stress corrosion cracking (SCC) under LWR conditions except when they are cold worked. It is known that physicochemical properties of water change sharply with pressure and temperature inside of the supercritical region. Owing to this situation, there are several doubts about the behavior of candidate materials like austenitic stainless steel 316L to SCC in the SCWR conditions. In this work, alloy 316L was studied in deaerated SCW at two different temperatures (400 °C and 500 °C) and at 25 MPa in order to determine how changes in this variable influence the resistance of this material to SCC. The influence of plastic deformation in the behavior of alloy 316L to SCC in SCW was also studied at both temperatures. Results obtained from these tests have shown that alloy 316L is susceptible to SCC in supercritical water reactor conditions where the susceptibility of this alloy increases with temperature. Moreover, prior plastic deformation of 316L SS increased its susceptibility to environmental cracking in SCW.

  19. Biomimetic hydrophobic surface fabricated by chemical etching method from hierarchically structured magnesium alloy substrate

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yan; Yin, Xiaoming; Zhang, Jijia [Key Laboratory of Bionic Engineering (Ministry of Education), Jilin University, Changchun 130022 (China); Wang, Yaming [Institute for Advanced Ceramics, Harbin Institute of Technology, Harbin 150001 (China); Han, Zhiwu, E-mail: zwhan@jlu.edu.cn [Key Laboratory of Bionic Engineering (Ministry of Education), Jilin University, Changchun 130022 (China); Ren, Luquan [Key Laboratory of Bionic Engineering (Ministry of Education), Jilin University, Changchun 130022 (China)

    2013-09-01

    As one of the lightest metal materials, magnesium alloy plays an important role in industry such as automobile, airplane and electronic product. However, magnesium alloy is hindered due to its high chemical activity and easily corroded. Here, inspired by typical plant surfaces such as lotus leaves and petals of red rose with super-hydrophobic character, the new hydrophobic surface is fabricated on magnesium alloy to improve anti-corrosion by two-step methodology. The procedure is that the samples are processed by laser first and then immersed and etched in the aqueous AgNO{sub 3} solution concentrations of 0.1 mol/L, 0.3 mol/L and 0.5 mol/L for different times of 15 s, 40 s and 60 s, respectively, finally modified by DTS (CH{sub 3}(CH{sub 2}){sub 11}Si(OCH{sub 3}){sub 3}). The microstructure, chemical composition, wettability and anti-corrosion are characterized by means of SEM, XPS, water contact angle measurement and electrochemical method. The hydrophobic surfaces with microscale crater-like and nanoscale flower-like binary structure are obtained. The low-energy material is contained in surface after DTS treatment. The contact angles could reach up to 138.4 ± 2°, which hydrophobic property is both related to the micro–nano binary structure and chemical composition. The results of electrochemical measurements show that anti-corrosion property of magnesium alloy is improved. Furthermore, our research is expected to create some ideas from natural enlightenment to improve anti-corrosion property of magnesium alloy while this method can be easily extended to other metal materials.

  20. Crystallographic aspects of L10 magnetic materials

    International Nuclear Information System (INIS)

    Laughlin, David E.; Srinivasan, Kumar; Tanase, Mihaela; Wang, Lisha

    2005-01-01

    In this paper we present an overview of various features of the structure of L1 0 magnetic phase. We discuss the various microstructural features which occur in these materials due to the changes in symmetry (translational and orientational domains) as well as the relationship between the crystal symmetry and features such as the thermodynamic order of the disorder to order phase transition. We also show the various ways that the magnetic moments of the elements align themselves in these alloys producing ferromagnetic and antiferromagnetic materials. Finally we discuss the way that the atomic order, composition and magnetic order affect the Curie temperatures of the FePd L1 0 alloys

  1. Precipitation behaviors of cubic and tetragonal Zr–rich phase in Al–(Si–)Zr alloys

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Tong [Australian Centre for Microscopy & Microanalysis, The University of Sydney, NSW 2006 (Australia); Key Laboratory of Liquid–Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Ceguerra, Anna; Breen, Andrew [Australian Centre for Microscopy & Microanalysis, The University of Sydney, NSW 2006 (Australia); Liu, Xiangfa; Wu, Yuying [Key Laboratory of Liquid–Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Ringer, Simon, E-mail: simon.ringer@sydney.edu.au [Australian Centre for Microscopy & Microanalysis, The University of Sydney, NSW 2006 (Australia)

    2016-07-25

    The precipitation behaviors of Zr–rich phase in binary Al–0.5Zr and ternary Al–3Si–0.5Zr alloys were investigated by high resolution transmission electron microscopy and atom probe. After the alloys were aged at 525 °C for 24 h, the precipitates in Al–0.5Zr alloy are identified as L1{sub 2}–ZrAl{sub 3}, performing a coherent relationship with the Al matrix. While in Al–3Si–0.5Zr alloy, the precipitates are Si–containing D0{sub 23}–Zr(Al,Si){sub 3}, which has an approximate 90° reversed cube–on–cube orientation relationship with Al. It is regarded that Si accelerates the precipitation of D0{sub 23}–Zr(Al,Si){sub 3}. - Highlights: • L1{sub 2}–ZrAl{sub 3} and D0{sub 23}–Zr(Al, Si){sub 3} particles precipitate in Al–Zr and Al–Si–Zr alloys. • D0{sub 23}–Zr(Al, Si){sub 3} performs an approximate 90° reversed cube–on–cube orientation relationship with Al. • Si accelerates the precipitation process of D0{sub 23}–Zr(Al,Si){sub 3}.

  2. Corrosion of iron-base alloys by lithium

    International Nuclear Information System (INIS)

    Selle, J.E.

    1976-01-01

    A review of corrosion mechanisms operating in lithium-iron-base alloy systems is presented along with data obtained with thermal-convection loops of niobium-stabilized 2 1 / 4 percent Cr-1 percent Mo steel and types 304L and 321 stainless steels. A corrosion rate of 2.3 μm/year (0.09 mil/year) was obtained on the 2 1 / 4 percent Cr-1 percent Mo steel at 600 0 C. Considerably more mass transport of alloying constituents and a maximum corrosion rate of about 14 μm/year (0.55 mil/year) was obtained with the austenitic stainless steels. Results of metallography, x-ray fluorescence analysis, scanning electron microscopy, and weight-change data are presented and discussed

  3. Aluminium-nickel-iron alloys resistant to corrosion by water at high temperature. Their basic properties - their improvement; Les alliages aluminium-nickel-fer resistant a la corrosion par l'eau a haute temperature. Bases de leurs proprietes - leur amelioration

    Energy Technology Data Exchange (ETDEWEB)

    Coriou, H; Fournier, R; Grall, L; Hure, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    The development of the investigations carried out on these alloys is reviewed, showing the establishment of their fundamental, particularly structural, properties. This is followed by studies on: 1 - The penetration process in corrosion. The results of micrographic studies of the metal oxide interface are given for a series of alloys treated in water and steam between 350 and 395 deg. C. The hypothesis of attack by pockets of gas pressure is corroborated, and a second process of deep penetration by islands of intergranular-type corrosion is shown to take place. These patches, distinct from the surface corrosion layer and sometimes forming at a considerable depth inside the metal, would be due to heterogeneities in composition of the solid solution making up the matrix of these alloys. 2 - The role of titanium and zirconium additions on rolled metal. Systematic studies are carried out on a series of alloys with titanium and zirconium contents between 0.05 and 0.15 per cent. The favourable effect of titanium in particular has been demonstrated. Zirconium acts in the same way, but less efficiently. The improvement due to these additions can be compared to their action on the distribution of the second phases, which tend to become more pronounced and more homogeneously distributed. The influence of solder on these alloys has been studied, showing up the part played by the structure gradients introduced by fission. (author) [French] Apres un rappel de l'evolution des etudes sur ces alliages, montrant l'etablissement de leurs proprietes fondamentales et, en particulier, structurales, on etudie: 1 - Les processus de penetration de la corrosion. On expose les resultats de l'etude micrographique de l'interface metal-oxyde sur une serie d'alliages traites dans l'eau et la vapeur entre 350 et 395 deg. C. On verifie l'hypothese de l'attaque par poches de pression gazeuse et on met en evidence un second processus de progression en profondeur par ilots de corrosion de type

  4. Contribution to the micrographic study of uranium and its alloys; Contribution a l'etude micrographique de l'uranium et de ses alliages

    Energy Technology Data Exchange (ETDEWEB)

    Monti, H. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1956-06-15

    The present report is the result of research carried out by the radio metallurgy section, to perfect micrographic techniques applicable to the study of samples of irradiated uranium. In the first part of this work, two polishing baths are developed, having the qualities with a minimum of disadvantages inherent in their respective compositions: they are, on the one hand perchloric acid-ethanol mixtures, and on the other hand a phospho-chromic-ethanol bath. In the chapter following, the micrographic attack of uranium is studied. The only satisfactory process is oxidation by cathode bombardment forming epitaxic layers. In the third chapter, an attempt is made to characterise the different surface states of the uranium by dissolution potential measurements and electronic diffraction. In the fourth chapter are given some examples of the application of these techniques to the micrographic study of various uranium alloys. In an appendix, it is shown how the chemical oxidation after phospho-chromic-alcohol polishing allows the different inclusions present in the molten uranium to be distinguished. By X-ray diffraction, uranium monocarbide and mononitride inclusions in particular are characterised. (author) [French] Le present rapport est le resultat de recherches effectuees au service de radiometallurgie pour la mise au point de techniques micrographiques applicables a l'etude d'echantillons d'uranium irradie. Dans la premiere partie de ce travail, nous mettons au point deux bains de polissage qui presentent les qualites inherentes a leur composition respective, avec le minimum d'inconvenients: ce sont d'une part des melanges acide perchlorique-ethanol, et d'autre part un bain phospho-chromique-ethanol. Dans le chapitre suivant, nous etudions l'attaque micrographique de l'uranium. Seul le procede d'oxydation par bombardement cathodique formant des couches epitaxiques, est satisfaisant. Dans le troisieme chapitre, nous essayons

  5. Mapping the Galvanic Corrosion of Three Coupled Metal Alloys Using Coupled Multielectrode Array: Influence of Chloride Ion Concentration

    Directory of Open Access Journals (Sweden)

    Hong Ju

    2018-04-01

    Full Text Available The galvanic corrosion behavior of three metal alloys commonly used in water desalination plants was investigated using coupled multielectrode arrays consisting of aluminum-brass (HAl77-2, titanium alloy (TA2, and 316L stainless steel (316L SS. The three electrode types were coupled galvanically and arranged in different geometric configurations. Their corrosion behavior was characterized as a function of the chloride concentration. The potential and current distributions of the three-electrode coupling systems display electrochemical inhomogeneity. Generally, the aluminum-brass wires are anodic versus the titanium alloy and stainless steel. The titanium alloy acts as a primary cathode, and the 316L SS acts as a secondary cathode. The corrosion rate of aluminum-brass depends on the concentration of chloride ion, with a maximum corrosion rate at a chloride concentration of 2.3 wt %. In terms of geometrical arrangements, when the anodic HAl77-2 wires are located on the edge and are connected to the 316L SS wires in the coupling system, the main anodic area enlarges, especially in the area adjacent to the 316L SS wires. When the HAl77-2 wires are located between (in the middle of the two other types of wires, the corrosion rates are higher than the corrosion rates observed from the other two geometrical arrangements.

  6. Mapping the Galvanic Corrosion of Three Coupled Metal Alloys Using Coupled Multielectrode Array: Influence of Chloride Ion Concentration.

    Science.gov (United States)

    Ju, Hong; Duan, JinZhuo; Yang, Yuanfeng; Cao, Ning; Li, Yan

    2018-04-20

    The galvanic corrosion behavior of three metal alloys commonly used in water desalination plants was investigated using coupled multielectrode arrays consisting of aluminum-brass (HAl77-2), titanium alloy (TA2), and 316L stainless steel (316L SS). The three electrode types were coupled galvanically and arranged in different geometric configurations. Their corrosion behavior was characterized as a function of the chloride concentration. The potential and current distributions of the three-electrode coupling systems display electrochemical inhomogeneity. Generally, the aluminum-brass wires are anodic versus the titanium alloy and stainless steel. The titanium alloy acts as a primary cathode, and the 316L SS acts as a secondary cathode. The corrosion rate of aluminum-brass depends on the concentration of chloride ion, with a maximum corrosion rate at a chloride concentration of 2.3 wt %. In terms of geometrical arrangements, when the anodic HAl77-2 wires are located on the edge and are connected to the 316L SS wires in the coupling system, the main anodic area enlarges, especially in the area adjacent to the 316L SS wires. When the HAl77-2 wires are located between (in the middle of) the two other types of wires, the corrosion rates are higher than the corrosion rates observed from the other two geometrical arrangements.

  7. Effect of silicon ion implantation upon the structure and corrosion resistance of the surface layer of stainless steel 316L, Vitalium and titanium alloy Ti6Al14V

    International Nuclear Information System (INIS)

    Baszkiewicz, J.; Kaminski, M.; Krupa, D.; Kozubowski, J.; Barcz, A.; Gawlik, A.; Jagielski, J.

    1995-01-01

    Samples of 316L stainless steel, Vitalium and Ti6A14V titanium alloy have been implanted with doses of 1.5, 3, and 4.5 x 10 17 Si + /cm 2 . Transmission electron microscopy shows that during ion implantation amorphous layers are formed. When samples of titanium alloy were implanted with a dose of 0.5 x 10 17 Si + /cm 2 , the implanted layer consisted of a dispersion of fine silicide crystallites instead of being amorphous. The corrosion resistance was analyzed by electrochemical techniques in 0.9% NaCl at the temperature of 37 C. The increase of corrosion resistance has been observed as a result of structural modifications of the surface layer. (author). 7 refs, 4 tabs

  8. Effect of composition on the high rate dynamic behaviour of tungsten heavy alloys

    Directory of Open Access Journals (Sweden)

    Latif Kesemen

    2015-01-01

    Full Text Available Tungsten heavy alloys are currently used as kinetic energy penetrators in military applications due to their high density and superior mechanical properties. In the literature, quasi-static properties of different tungsten heavy alloys based on W-Ni-Cu and W-Ni-Fe ternary systems are well documented and presented. However, comparison of the dynamic behaviour of these alloys in terms of the correlation between quasi-static mechanical characterization and dynamical properties is lacking. In the present study, dynamic properties of tungsten heavy alloys having different binder phase compositions (90W-7Ni-3Cu and 90W-8Ni-2Fe at different projectile velocities were investigated. The examined and tested alloys were produced through the conventional powder metallurgy route of mixing, cold compaction and sintering. Mechanical characterization of these alloys was performed. In the ballistic tests, cylindrical tungsten heavy alloys with L/D ratio of 3 were impacted to hardened steel target at different projectile velocities. After the ballistic tests, deformation characteristics of test specimens during dynamic loading were evaluated by comparing the change of length and diameter of the specimens versus kinetic energy densities. The study concluded that 90W-8Ni-2Fe alloy has better perforation characteristics than 90W-7Ni-3Cu alloy.

  9. Modification of anomalous deposition of Zn-Ni alloy by using tin additions

    Energy Technology Data Exchange (ETDEWEB)

    Zhou Zeyang; O`Keefe, T.J. [Missouri Univ., Rolla, MO (United States). Dept. of Metallurgical Engineering

    1997-11-25

    One of the common examples of anomalous deposition in electrolytic processing is the Zn-Ni alloy coating system. These alloys, in the range 10-15% Ni, are also of commercial interest in electrogalvanizing for protecting steel from corrosion while retaining good formability, weldability and paintability. The primary objective of this research was to obtain a better fundamental understanding of anomalous deposition and to identify ways to modify its influence. Specifically, the effects of tin additions on the composition, structure and surface morphology of Zn-Ni alloy deposits from electrolyte containing 80 g l{sup -1} Zn and 10 g l{sup -1} Ni were studied. Previous work had shown that low concentrations (parts per million) of cations such as antimony and arsenic were very effective in countering the anomalous deposition and increasing the relative nickel content of the deposits. Unfortunately, the morphology and current efficiency were adversely affected by use of these additives. It was found that the addition of tin also appreciably increased the nickel content of the alloy deposit, as well as giving smooth, dense deposits with a current efficiency of about 90%. The surface morphology of the deposits was correlated with the amount of tin added. The limited electrochemical impedance spectroscopy tests conducted showed that the low concentrations of tin did lower the charge transfer resistance of the reaction. Overall, the results were promising but considerably more research is needed to elucidate the basic factors that influence zinc alloy electrocrystallization mechanisms. (orig.) 27 refs.

  10. Preparation technology of 103Pd-110Agm composite alloy membranes

    International Nuclear Information System (INIS)

    Liu Zhuo; Chen Daming; Jin Xiaohai; Li Zhongyong; Guo Feihu; Qin Hongbin

    2012-01-01

    The preparation of 103 Pd- 110 Ag m alloy membranes was the basis for the production of 103 Pd- 125 I composite sources. Taking 103 Pd and 110 Ag m as trace elements, the method of non-electrolytical plating was chosen to prepare the alloy membrane. A γ-detector and electron microscope (SEM) were used for quantitative and qualitative analysis, respectively. The pre-treatment of the support before the preparation of Palladium-silver composite membranes was discussed in detail. It was found that when the concentration of PdCl 2 was between 0.5 and 2.0 mmol/L the result was good. The effects of various factors were investigated, including the proportion of Pd and Ag, the concentrations of the total metal, ammonium hydroxide hydrazine and ethylenediaminetetraacetic acid, temperature, the time, and the rotation speed. By improving the reaction conditions the alloy membrane with metallic luster was obtained. Besides, the presence of Pd and Ag was observed in the alloy membranes by qualitative analysis. (authors)

  11. Microstructure and Mechanical Properties in Gamma(face-centered cubic) + Gamma Prime(L12) Precipitation-Strengthened Cobalt-based Superalloys

    Science.gov (United States)

    Bocchini, Peter J.

    High-temperature structural alloys for aerospace and energy applications have long been dominated by Ni-based superalloys, whose high-temperature strength and creep resistance can be attributed to a two-phase microstructure consisting of a large volume fraction of ordered gamma'(L12)-precipitates embedded in a disordered gamma(f.c.c.)-matrix. These alloys exhibit excellent mechanical behavior and thermal stability, but after decades of incremental improvement, are nearing the theoretical limit of their operating temperatures. In 2006, an analogous gamma(f.c.c.) + gamma'(L12) microstructure was identified in the Co-Al-W ternary system with liquidus and solidus temperatures 50-150 °C higher than conventional Ni-based superalloys. The work herein focuses on assessing the effects of alloying additions on microstructure and mechanical behavior in an effort to lay the foundations for understanding this emerging alloy system. A variety of Co-based superalloys are investigated in order to study fundamental materials properties and to address key engineering challenges. Coarsening rate constants and temporal exponents are measured for gamma'(L1 2)-precipitates in a ternary Co-Al-W alloy aged at 650 °C and 750 °C. A series of Co-Al-W-B-Zr alloys are cast to study the influence of segregation of B and Zr to grain boundaries (GBs) on mechanical properties. Co-Ni-Al-W-Ti alloys with various amounts of Al, W, and Ti are cast in order to fabricate Co-based superalloys with decreased density and increased gamma'(L1 2)-solvus temperature. 2-D dislocation dynamics modeling is employed to predict how gamma'(L12)-precipitate size and volume fraction affect the mechanical properties of Ni- and Co-based superalloys. Compositional information such as phase concentrations, partitioning behavior, and GB segregation are measured with local electrode atom probe (LEAP) tomography in alloys with fine microstructures and with scanning electron microscope (SEM) electron dispersive x

  12. The natural aging and precipitation hardening behaviour of Al-Mg-Si-Cu alloys with different Mg/Si ratios and Cu additions

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Lipeng [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 China (China); Jia, Zhihong, E-mail: zhihongjia@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 China (China); Zhang, Zhiqing; Sanders, Robert E.; Liu, Qing [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 China (China); Yang, Guang [Electronic Materials Research Laboratory, Key Laboratory of the Ministry of Education and International Centre for Dielectric Research, Xi’an Jiaotong University, Xi’an 710049 (China)

    2015-03-11

    The natural aging and artificial aging behaviours of Al-Mg-Si-Cu alloys with different Mg/Si ratios and Cu additions were investigated using Vickers microhardness measurements, differential scanning calorimetry (DSC) analysis and transmission electron microscopy (TEM) characterisation. Excess Si and Cu additions enhanced the alloy hardening ability during natural (NA) and artificial aging (AA). Alloys with low Cu and high Si contents exhibited higher precipitation hardening than alloys rich in Mg during artificial aging. In contrast, the alloys with high amounts of Cu were less dependent on the Mg/Si ratio during precipitation hardening due to their similar aging kinetics. The main precipitate phases that contributed to the peak-aging hardness were the L, Q′ and β″ phases. In the over-aging conditions, the alloys rich in Mg and Cu had finer and more numerous precipitates than their Si-rich equivalents due to the preferential precipitation of the L phase. The combination of excess Mg and high Cu resulted in an alloy with a relatively low hardness in T4 temper and a relatively higher hardness after the paint baking cycle. Thus, this alloy has good potential for use in auto body panel applications.

  13. Contribution to the study of the electrodeposition of iron-nickel alloys; Contribution a l'etude du depot electrolytique des alliages fer-nickel

    Energy Technology Data Exchange (ETDEWEB)

    Valignat, J [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1967-12-01

    Using a coulometric technique based upon the anodic intentiostatic dissolution, we studied the potentiostatic, deposition of nickel, iron and nickel iron alloys. We have shown that the minimum of the curve I = f (t) (deposition current versus time) is probably due to the transitory blocking of the surface by hydrogen and that the syn-crystallisation of nickel and iron is responsible for the anomalous co-deposition of these two elements. (author) [French] En employant une methode coulometrique par dissolution anodique intensipstatique, nous avons etudie le depot potentiostatique du nickel, du fer et des alliages fer-nickel. Nous avons pu montrer que le minimum de la courbe I = f (t) enregistree au cours du depot est du probablement au blocage momentane de la surface par l'hydrogene et que la syncristallisation du fer et du nickel est responsable de l'anomalie du depot simultane de ces deux elements. (auteur)

  14. Microstructure Characterization and Hardness Evaluation of Alloy 52 Welded Stainless Steel 316 Subjected to Ultrasonic Nanocyrtal Surface Modification Technique

    Energy Technology Data Exchange (ETDEWEB)

    Kim, H. D.; Amanov, A.; Pyun, Y. S. [Sun Moon Univ., Asan (Korea, Republic of); Kim, Y. S.; Choi, Y. S. [Andong National Univ., Andong (Korea, Republic of)

    2015-10-15

    In this study, an ultrasonic nanocrystal surface modification (UNSM) technique was applied to dissimilar weld point between STS316L and Alloy 52. This UNSM technique is a patented technology, which can be described as a type of ultrasonic cold-forging technology. It has been demonstrated that the UNSM technique is a simple method to produce a nanocrystalline surface layer at the top surface of metallic materials. Microstructure and hardness of STS316L and Alloy 52 are investigated before and after UNSM treatment. It is expected according to the previous study that the UNSM technique is able to release the residual stress which delays PWSCC. In this study, microstructural characterization and hardness evaluation of STS316L and welded Alloy 52 subjected to UNSM technique were investigated.

  15. Characterization of oxide layers on amorphous Mg-based alloys by Auger electron spectroscopy with sputter depth profiling

    Energy Technology Data Exchange (ETDEWEB)

    Baunack, S.; Wolff, U. [Leibniz-Institut fuer Festkoerper- und Werkstoffforschung Dresden, Postfach 270016, 01171, Dresden (Germany); Subba Rao, R.V. [Indira Ghandi Centre for Atomic Research, 603 102, Kalpakkam, Tamil Nadu (India)

    2003-04-01

    Amorphous ribbons of Mg-Y-TM-[Ag](TM: Cu, Ni), prepared by melt spinning, were subjected to electrochemical investigations. Oxide layers formed anodically under potentiostatic control in different electrolytes were investigated by AES and sputter depth profiling. Problems and specific features of characterization of the composition of oxide layers and amorphous ternary or quaternary Mg-based alloys have been investigated. In the alloys the Mg(KL{sub 23}L{sub 23}) peak exhibits a different shape compared to that in the pure element. Analysis of the peak of elastically scattered electrons proved the absence of plasmon loss features, characteristic of pure Mg, in the alloy. A different loss feature emerges in Mg(KL{sub 23}L{sub 23}) and Cu(L{sub 23}VV). The system Mg-Y-TM-[Ag] suffers preferential sputtering. Depletion of Mg and enrichment of TM and Y are found. This is attributed mainly to the preferential sputtering of Mg. Thickness and composition of the formed oxide layer depend on the electrochemical treatment. After removing the oxide by sputtering the concentration of the underlying alloy was found to be affected by the treatment. (orig.)

  16. Effects of Alloying Elements on Room and High Temperature Tensile Properties of Al-Si Cu-Mg Base Alloys =

    Science.gov (United States)

    Alyaldin, Loay

    result of the presence of both Mg and Cu. These alloy types display excellent strength values at both low and high temperatures. Additions of Zr, Ni, Mn and Sc would be expected to maintain the performance of these alloys at still higher temperatures. Six alloys were prepared using 0.2 wt% Ti grain-refined 354 alloy, comprising alloy R (354 + 0.25wt% Zr) considered as the base or reference alloy, and five others, viz., alloys S, T, U, V, and Z containing various amounts of Ni, Mn, Sc and Zr, added individually or in combination. For comparison purposes, another alloy L was prepared from 398 (Al-16%Si) alloy, reported to give excellent high temperature properties, to which the same levels of Zr and Sc additions were made, as in alloy Z. Tensile test bars were prepared from the different 354 alloys using an ASTM B-108 permanent mold. The test bars were solution heat treated using a one-step or a multi-step solution heat treatment, followed by quenching in warm water, and then artificial aging employing different aging treatments (T5, T6, T62 and T7). The one-step (or SHT 1) solution treatment consisted of 5 h 495 °C) and the multi-step (or SHT 2) solution treatment comprised 5 h 495°C + 2 h 515°C + 2 h 530°C. Thermal analysis of the various 354 alloy melts was carried out to determine the sequence of reactions and phases formed during solidification under close-to-equilibrium cooling conditions. The main reactions observed comprised formation of the alpha-Al dendritic network at 598°C followed by precipitation of the Al-Si eutectic and post-eutectic beta-Al5FeSi phase at 560°C; Mg2Si phase and transformation of the beta-phase into pi-Al8Mg 3FeSi6 phase at 540°C and 525°C; and lastly, precipitation of Al2Cu and Q-Al5Mg8Cu2Si 6 almost simultaneously at 498°C and 488°C. Larger sizes of AlFeNi and AlCuNi phase particles were observed in T alloy with its higher Ni content of 4 wt%, when compared to those seen in S alloy at 2% Ni content. Mn addition in Alloy U helps

  17. Magnesium and related low alloys

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, J; Caillat, R; Darras, R [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    In the first part the authors examine the comparative corrosion of commercial magnesium, of a magnesium-zirconium alloy (0,4 per cent {<=} Zr {<=} 0,7 per cent) of a ternary magnesium-zinc-zirconium alloy (0,8 per cent {<=} Zn {<=} 1,2 per cent) and of english 'Magnox type' alloys, in dry carbon dioxide-free air, in damp carbon dioxide-free air, and in dry and damp carbon dioxide, at temperatures from 300 to 600 deg. C. In the second part the structural stability of these materials is studied after annealings, of 10 to 1000 hours at 300 to 450 deg. C. Variations in grain after these heat treatments and mechanical stretching properties at room temperature are presented. Finally various creep rate and life time diagrams are given for these materials, for temperatures ranging from 300 to 450 deg. C. (author) [French] Dans une premiere partie les auteurs etudient la corrosion comparee du magnesium commercial, d'un alliage magnesium-zirconium (0,4 pour cent {<=} Zr {<=} 0,7 pour cent), d'un alliage ternaire magnesium-zinc-zirconium (0,8 pour cent {<=} Zn {<=} 1,2 pour cent), et d'alliages anglais 'type Magnox', dans l'air sec decarbonate, l'air humide decarbonate, le gaz carbonique sec et humide a des temperatures de 300 a 600 deg. C. Dans une seconde partie, est etudiee la stabilite structurale de ces materiaux apres des recuits de 300 a 450 deg. C, et de 10 a 1000 heures. Sont presentees les variations, apres ces traitements thermiques, de la grosseur du grain, et des caracteristiques mecaniques de traction a la temperature ambiante. Enfin, quelques diagrammes de vitesse de fluage et de durees de vie sont presentes sur ces materiaux pour des temperatures variant entre 300 et 450 deg. C. (auteur)

  18. Monotectic four-phase reaction in Al-Bi-Zn alloys

    Energy Technology Data Exchange (ETDEWEB)

    Groebner, J. [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Str. 42, D-38678 Clausthal-Zellerfeld (Germany); Mirkovic, D. [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Str. 42, D-38678 Clausthal-Zellerfeld (Germany); Schmid-Fetzer, R. [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Str. 42, D-38678 Clausthal-Zellerfeld (Germany)]. E-mail: schmid-fetzer@tu-clausthal.de

    2005-06-15

    Thermodynamic phase diagram calculations were used for the systematic search for a monotectic four-phase reaction in ternary Al-alloys. Systems with intermetallic phases and also the elements Cd and Hg were excluded in the present search. The ternary Al-Bi-Zn is a rare occasion where such a reaction, L' = L' + (Al)' + (Zn), actually occurs. Experimental work could be focused on key samples in that system and involved DSC for thermal analysis and calorimetry, and also metallographic analysis using SEM/EDX. Experimental results verify the existence of the monotectic reaction and were also used for a quantitative thermodynamic modeling of Al-Bi-Zn. Solidification paths and microstructures of Al-Bi-Zn alloys are shown to be rather complex. Using thermodynamic calculations, these rich details involving up to three invariant reactions and unexpected monovariant reaction types can be clearly revealed and understood.

  19. Design and development of novel MRI compatible zirconium- ruthenium alloys with ultralow magnetic susceptibility

    Science.gov (United States)

    Li, H.F.; Zhou, F.Y.; Li, L.; Zheng, Y.F.

    2016-01-01

    In the present study, novel MRI compatible zirconium-ruthenium alloys with ultralow magnetic susceptibility were developed for biomedical and therapeutic devices under MRI diagnostics environments. The results demonstrated that alloying with ruthenium into pure zirconium would significantly increase the strength and hardness properties. The corrosion resistance of zirconium-ruthenium alloys increased significantly. High cell viability could be found and healthy cell morphology observed when culturing MG 63 osteoblast-like cells and L-929 fibroblast cells with zirconium-ruthenium alloys, whereas the hemolysis rates of zirconium-ruthenium alloys are alloys and Ti-based alloys, the magnetic susceptibilities of the zirconium-ruthenium alloys (1.25 × 10−6 cm3·g−1–1.29 × 10−6 cm3·g−1 for zirconium-ruthenium alloys) are ultralow, about one-third that of Ti-based alloys (Ti–6Al–4V, ~3.5 × 10−6 cm3·g−1, CP Ti and Ti–6Al–7Nb, ~3.0 × 10−6 cm3·g−1), and one-sixth that of Co–Cr alloys (Co–Cr–Mo, ~7.7 × 10−6 cm3·g−1). Among the Zr–Ru alloy series, Zr–1Ru demonstrates enhanced mechanical properties, excellent corrosion resistance and cell viability with lowest magnetic susceptibility, and thus is the optimal Zr–Ru alloy system as therapeutic devices under MRI diagnostics environments. PMID:27090955

  20. Microstructural characterization of as-cast hf-b alloys

    Directory of Open Access Journals (Sweden)

    João Carlos Jânio Gigolotti

    2012-04-01

    Full Text Available An accurate knowledge of several metal-boron phase diagrams is important to evaluation of higher order systems such as metal-silicon-boron ternaries. The refinement and reassessment of phase diagram data is a continuous work, thus the reevaluation of metal-boron systems provides the possibility to confirm previous data from an investigation using higher purity materials and better analytical techniques. This work presents results of rigorous microstructural characterization of as-cast hafnium-boron alloys which are significant to assess the liquid composition associated to most of the invariant reactions of this system. Alloys were prepared by arc melting high purity hafnium (minimum 99.8% and boron (minimum 99.5% slices under argon atmosphere in water-cooled copper crucible with non consumable tungsten electrode and titanium getter. The phases were identified by scanning electron microscopy, using back-scattered electron image mode and X-ray diffraction. In general, a good agreement was found between our data and those from the currently accepted Hafnium-Boron phase diagram. The phases identified are αHfSS and B-RhomSS, the intermediate compounds HfB and HfB2 and the liquide L. The reactions are the eutectic L ⇔ αHfSS + HfB and L ⇔ HfB2 + B-Rhom, the peritectic L + HfB2 ⇔ HfB and the congruent formation of HfB2.

  1. Lattice dynamics of Ru2FeX (X = Si, Ge) Full Heusler alloys

    Science.gov (United States)

    Rizwan, M.; Afaq, A.; Aneeza, A.

    2018-05-01

    In present work, the lattice dynamics of Ru2FeX (X = Si, Ge) full Heusler alloys are investigated using density functional theory (DFT) within generalized gradient approximation (GGA) in a plane wave basis, with norm-conserving pseudopotentials. Phonon dispersion curves and phonon density of states are obtained using first-principles linear response approach of density functional perturbation theory (DFPT) as implemented in Quantum ESPRESSO code. Phonon dispersion curves indicates for both Heusler alloys that there is no imaginary phonon in whole Brillouin zone, confirming dynamical stability of these alloys in L21 type structure. There is a considerable overlapping between acoustic and optical phonon modes predicting no phonon band gap exists in dispersion curves of alloys. The same result is shown by phonon density of states curves for both Heusler alloys. Reststrahlen band for Ru2FeSi is found smaller than Ru2FeGe.

  2. High strength and large ductility in spray-deposited Al–Zn–Mg–Cu alloys

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Hongchun, E-mail: hcyu@hnu.edu.cn [School of Materials Science and Engineering, Central South University, Changsha 410083, Hunan (China); Wang, Mingpu; Jia, Yanlin [School of Materials Science and Engineering, Central South University, Changsha 410083, Hunan (China); Xiao, Zhu, E-mail: xiaozhu8417@gmail.com [School of Engineering, University of Liverpool, Liverpool L69 3GH (United Kingdom); Chen, Chang; Lei, Qian; Li, Zhou; Chen, Wei [School of Materials Science and Engineering, Central South University, Changsha 410083, Hunan (China); Zhang, Hao [Jiangsu Haoran Spray Forming Alloys Co., Ltd., Zhengjiang 212009, Jiangsu (China); Wang, Yanguo; Cai, Canying [School of Physics and Microelectronics, Hunan University, Changsha 410082, Hunan (China)

    2014-07-15

    Highlights: • Spray deposition process was used to produce Al alloys with excellent performance. • The deposited alloys exhibited a high strength of 690 MPa and elongation up to 17.2%. • The η′ phase was coherent with α-Al and their orientation relationship was studied. • The interface misfits and the transition matrixes of two phases were calculated. - Abstract: The mechanical properties and microstructure of large-scale Al–Zn–Mg–Cu alloys fabricated by spray deposition/rapid solidification technology were investigated in detail. The as-extruded alloys under peak-aging temper exhibited ultimate tensile strength (UTS), yield strength (YS) and elongation of 690 MPa, 638 MPa and 17.2%, respectively. The simultaneous coexisting of high strength and large tensile ductility of the alloys were achieved in our experiment. It was considered that the high-density nano-precipitates distributed uniformly in the peak-aged alloys may be responsible for the high strength and improved ductility. Orientation relationship between η′ precipitates and α-Al matrix were verified by high resolution transmission electron microscopy (HRTEM) and selected area electron diffraction patterns (SADPs) observations. The η′ phases in the alloy were fully coherent with the aluminum matrix, with the orientation relationship of (101{sup ¯}0){sub η{sup ′}}//{110}{sub Al} and [1{sup ¯}21{sup ¯}0]{sub η{sup ′}}//<1{sup ¯}12>{sub Al}. The relationship between the lattice parameters of η′ phase and the related plane-spacing of the aluminum were a{sub η{sup ′}}=3d{sub (112){sub A{sub l}}} and c{sub η{sup ′}}=6d{sub (111){sub A{sub l}}}. Based on obtained orientation relationship, the transition matrix of η′ phases were also calculated.

  3. Surface modification of 5083 Al alloy by electrical discharge alloying processing with a 75 mass% Si-Fe alloy electrode

    Energy Technology Data Exchange (ETDEWEB)

    Stambekova, Kuralay [Department of Materials Science and Engineering, National Chung Hsing University, 250 Kuo-Kuang Rd., Taichung 40227, Taiwan (China); Lin, Hung-Mao [Department of Mechanical Engineering, Far East University, No. 49, Zhonghua Rd., Xinshi Dist., Tainan City 74448, Taiwan (China); Uan, Jun-Yen, E-mail: jyuan@dragon.nchu.edu.tw [Department of Materials Science and Engineering, National Chung Hsing University, 250 Kuo-Kuang Rd., Taichung 40227, Taiwan (China)

    2012-03-01

    This study experimentally investigates the surface modification of 5083 Al alloy by the electrical discharge alloying (EDA) process with a Si-Fe alloy as an electrode. Samples were analyzed by transmission electron microscopy (TEM), scanning electron microscopy (SEM), micro-hardness and corrosion resistance tests. The micro-hardness of EDA alloyed layer was evidently higher than that of the base metal (5083 Al alloy). The TEM results show that the matrix of the alloyed layer has an amorphous-like structure; the matrix contains fine needle-like Si particles, block-like Si particles and nano-size Al{sub 4.5}FeSi and Al{sub 13}Fe{sub 4} particles. The TEM results support experimental results for the high hardness of the alloyed layer. Moreover, the EDA alloyed layer with composite microstructures has good corrosion resistance in NaCl aqueous solution.

  4. Design and development of novel MRI compatible zirconium- ruthenium alloys with ultralow magnetic susceptibility.

    Science.gov (United States)

    Li, H F; Zhou, F Y; Li, L; Zheng, Y F

    2016-04-19

    In the present study, novel MRI compatible zirconium-ruthenium alloys with ultralow magnetic susceptibility were developed for biomedical and therapeutic devices under MRI diagnostics environments. The results demonstrated that alloying with ruthenium into pure zirconium would significantly increase the strength and hardness properties. The corrosion resistance of zirconium-ruthenium alloys increased significantly. High cell viability could be found and healthy cell morphology observed when culturing MG 63 osteoblast-like cells and L-929 fibroblast cells with zirconium-ruthenium alloys, whereas the hemolysis rates of zirconium-ruthenium alloys are zirconium-ruthenium alloys (1.25 × 10(-6) cm(3)·g(-1)-1.29 × 10(-6) cm(3)·g(-1) for zirconium-ruthenium alloys) are ultralow, about one-third that of Ti-based alloys (Ti-6Al-4V, ~3.5 × 10(-6) cm(3)·g(-1), CP Ti and Ti-6Al-7Nb, ~3.0 × 10(-6) cm(3)·g(-1)), and one-sixth that of Co-Cr alloys (Co-Cr-Mo, ~7.7 × 10(-6) cm(3)·g(-1)). Among the Zr-Ru alloy series, Zr-1Ru demonstrates enhanced mechanical properties, excellent corrosion resistance and cell viability with lowest magnetic susceptibility, and thus is the optimal Zr-Ru alloy system as therapeutic devices under MRI diagnostics environments.

  5. Synthesis Of NiCrAlC alloys by mechanical alloying

    International Nuclear Information System (INIS)

    Silva, A.K.; Pereira, J.I.; Vurobi Junior, S.; Cintho, O.M.

    2010-01-01

    The purpose of the present paper is the synthesis of nickel alloys (NiCrAlC), which has been proposed like a economic alternative to the Stellite family Co alloys using mechanical alloying, followed by sintering heat treatment of milled material. The NiCrAlC alloys consist of a chromium carbides dispersion in a Ni 3 Al intermetallic matrix, that is easily synthesized by mechanical alloying. The use of mechanical alloying enables higher carbides sizes and distribution control in the matrix during sintering. We are also investigated the compaction of the processed materials by compressibility curves. The milling products were characterized by X-ray diffraction, and the end product was featured by conventional metallography and scanning electronic microscopy (SEM), that enabled the identification of desired phases, beyond microhardness test, which has been shown comparable to alloys manufactured by fusion after heat treating. (author)

  6. Anisotropic Deformation Behavior of Al2024T351 Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    R Khan

    2013-06-01

    Full Text Available The objective of this work was to investigate the effects of material anisotropy on the yielding and hardening behavior of 2024T351 aluminum alloy using isotropic and anisotropic yield criteria. Anisotropy may be induced in a material during the manufacturing through processes like rolling or forging. This induced anisotropy gives rise to the concept of orientation-dependent material properties such as yield strength, ductility, strain hardening, fracture strength, or fatigue resistance. Inclusion of the effects of anisotropy is essential in correctly predicting the deformation behavior of a material. In this study, uniaxial tensile tests were first performed in all three rolling directions, L , T  and S , for smooth bar specimens made from hot rolled plate of Al2024 alloy. The experimental results showed that the L - and T -directions yielded higher yield strengths and a greater percentage of elongation before fracture than the S -direction. Subsequently, finite element analysis of tensile specimens was performed using isotropic (von Mises and anisotropic (Hill yield criteria to predict the onset of yielding and hardening behaviors during the course of deformation. Hill's criterion perfectly fitted with the test data in the S -direction, but slightly underestimated the yield strength in L -direction. The results indicated that the Hill yield criterion is the most suitable one to predict the onset of yielding and hardening behaviors for 2024T351 aluminum alloy in all directions.

  7. Elemental characterization of alloy composition by wavelength dispersive X-ray fluorescence spectrometer

    International Nuclear Information System (INIS)

    Khan, F.A.; Pandey, A.; Das, D.K.; Behere, P.G; Mohd Afzal

    2015-01-01

    Wave length Dispersive X-ray Fluorescence (WD-XRF) is a non-destructive well-established analytical technique widely used in industrial and research applications for materials characterization. In nuclear industry various types of alloys have been used as per their application and importance. Few of them like SS-304, SS-316 and SS-316L are being regularly used for manufacturing of glove boxes at AFFF SS-304 alloy has been used in glove boxes of production line of MOX fuel due to its corrosive resistance and SS-316L is being used in chemical quality control lab and microwave applicator due to its acidic resistivity. In view of this an endeavor has been taken up to characterize these alloy steel. The experiments were carried out using a Rigaku make 'supermini', WD-XRF spectrometer having 200W Pd X-ray tube, 12 sample holder position, scintillation and proportional counters as a detector. All the parameters such as kV, mA, collimator, crystal and detectors were selected and operated via computer as per the given programme except for the sample preparation. EZscan (Energy Atomic Number Scan) technique is applied for the analysis of the above samples and the results obtained were in close agreement with the standard values. The present paper describes the characterization of SS-304L and SS-316L which have got better corrosion resistance properties against acids due to its compositions and suited for glove box manufacturing. (author)

  8. Local magnetic moments in dilute Cr-Nb alloys: the effects of applied magnetic field and Nb concentration

    International Nuclear Information System (INIS)

    Souza, P E N de; Oliveira, L M de; Ortiz, W A; Camargo, P C de; Oliveira, A J A de

    2005-01-01

    In this work we present magnetic susceptibility results for Cr-x at.% Nb alloys (x = 0.2, 0.6, 0.7, 1.4, and 2.0), showing that a local short-range order spin-density wave (L-SDW) appears at a characteristic temperature (T loc ) above the Neel temperature. The evidence for L-SDW is based on a Curie-Weiss-like behaviour, which is suppressed when large magnetic fields are applied or for alloys with Nb concentration above x = 2.0 at.%

  9. Investigation on corrosion and wear behaviors of nanoparticles reinforced Ni-based composite alloying layer

    International Nuclear Information System (INIS)

    Xu Jiang; Tao Jie; Jiang Shuyun; Xu Zhong

    2008-01-01

    In order to investigate the role of amorphous SiO 2 particles in corrosion and wear resistance of Ni-based metal matrix composite alloying layer, the amorphous nano-SiO 2 particles reinforced Ni-based composite alloying layer has been prepared by double glow plasma alloying on AISI 316L stainless steel surface, where Ni/amorphous nano-SiO 2 was firstly predeposited by brush plating. The composition and microstructure of the nano-SiO 2 particles reinforced Ni-based composite alloying layer were analyzed by using SEM, TEM and XRD. The results indicated that the composite alloying layer consisted of γ-phase and amorphous nano-SiO 2 particles, and under alloying temperature (1000 deg. C) condition, the nano-SiO 2 particles were uniformly distributed in the alloying layer and still kept the amorphous structure. The corrosion resistance of composite alloying layer was investigated by an electrochemical method in 3.5%NaCl solution. Compared with single alloying layer, the amorphous nano-SiO 2 particles slightly decreased the corrosion resistance of the Ni-Cr-Mo-Cu alloying layer. X-ray photoelectron spectroscopy (XPS) revealed that the passive films formed on the composite alloying consisted of Cr 2 O 3 , MoO 3 , SiO 2 and metallic Ni and Mo. The dry wear test results showed that the composite alloying layer had excellent friction-reduced property, and the wear weight loss of composite alloying layer was less than 60% of that of Ni-Cr-Mo-Cu alloying layer

  10. Structure, activity, and stability of platinum alloys as catalysts for the oxygen reduction reaction

    DEFF Research Database (Denmark)

    Vej-Hansen, Ulrik Grønbjerg

    In this thesis I present our work on theoretical modelling of platinum alloys as catalysts for the Oxygen Reduction Reaction (ORR). The losses associated with the kinetics of the ORR is the main bottleneck in low-temperature fuel cells for transport applications, and more active catalysts...... are essential for wide-spread use of this technology. platinum alloys have shown great promise as more active catalysts, which are still stable under reaction conditions. We have investigated these systems on multiple scales, using either Density Functional Theory (DFT) or Effective Medium Theory (EMT......), depending on the length and time scales involved. Using DFT, we show how diffusion barriers in transition metal alloys in the L12 structure depend on the alloying energy, supporting the assumption that an intrinsically more stable alloy is also more stable towards diffusion-related degradation...

  11. 51Cr diffusion in Zr-Sn alloys

    International Nuclear Information System (INIS)

    Nicolai, L.I.; Migoni, R.L.; Hojvat de Tendler, Ruth

    1982-01-01

    The 51 Cr volume diffusion in Zr-Sn alloys is measured in polycrystals with big grains by the thin-film method. The Sn content in the alloys ranges from 0.39% at to 6.66 % at. In the beta-phase the analysed temperature range is 982 deg C-1240 deg C. The Sn dehances the 51 Cr diffusion in beta-Zr, the effect being small but well defined. Assuming the formation of Sn-Cr dimers, the linear dehancement coefficient b and the parameters for the variation of b with temperature were calculated. The parameters Q and D o were calculated for the more diluted alloys and, upon application of the Zener theory for D o , a negative contribution to the activation entropy is found. Three experiments at different temperatures were performed in the alpha-phase. 51 Cr diffuses very fast in alpha-Zr-Sn. No definite correlation is found between the 51 Cr diffusivity and the increasing Sn concentration, probably due to the anisotropy of the alfa-phase. (M.E.L.) [es

  12. On the recovery of neutron irradiation defects of some metals and alloys

    International Nuclear Information System (INIS)

    Mohamed, H.G.; Matta, M.K.

    2001-01-01

    This work deals with the recovery of mechanical properties of neutron irradiated material to the pre-irradiating values. Rate of migration of defects responsible for radiation hardening and those inducing radiation embrittlement is analyzed. Role of crystalline structure is also studied. Materials of FCC crystal structure used in these investigations are pure Cu, Cu-5 at. % , Al, Cu-5 at. % Si, some Ni base binary alloys and some austenitic stainless steels mainly of AISI types 304 and 316. Among materials of BCC crystalline structure Fe-6 wt % Cr alloy is used. Alloys with CPH structure used in the present investigations are Zr-l wt. % Nb and Mg - 4.8 wt % Li alloys. History of material is studied such as cold worked state and annealed condition. Character of alloying elements and their amounts were of interest in this study. The result showed that the higher the percentage radiation hardening, the slower is the migration of radiation defects. Irradiated pure metals recovered at a higher temperature than alloys. Cold work accelerated the migration of radiation defects. The amount of alloying elements had little effect on the recovery temperatures. Character of solute alloying elements (substitutional or interstitial) revealed sensitive effect on the migration of radiation defects. Rate of migration of defects causing hardening can be different from those causing embrittlement. (author)

  13. Light-weight alloys for aerospace applications II; Proceedings of the 2nd Symposium, New Orleans, LA, Feb. 17-21, 1991

    International Nuclear Information System (INIS)

    Lee, E.W.; Kim, N.J.

    1991-01-01

    The present symposium on applications of light-weight alloys for aerospace discusses Al-Li alloys, aluminum alloys, advanced composites, and light alloys. Attention is given to Al-Li alloy development for parts made from thick plates, the structure and properties of P/M-aluminum alloys, X-ray rocking curve analysis of aging and deformation characteristics in Al-Li alloys, and the transformation characteristics of the 2090 Al-Li alloy. Topics considered include microstructural development in a rapidly solidified Al-Fe-V-Si alloy, the structure and mechanical properties of rapidly solidified Al-Cr-Hf alloys, the deformation mechanisms in superplastic Al-Mg alloys by microtexture technique, and the design of powder metallurgy aluminum alloys. Also discussed are the mechanical properties of monolithic and particular composites of L1(2) forms of Al3Ti, in situ polymer fiber-reinforced hybrid materials, thermal cycling of Ti-1421/SiC metal matrix composites, and the fracture behavior of a Ti3-Al-Nb alloy

  14. In vitro study of nanostructured diopside coating on Mg alloy orthopedic implants

    International Nuclear Information System (INIS)

    Razavi, Mehdi; Fathi, Mohammadhossein; Savabi, Omid; Vashaee, Daryoosh; Tayebi, Lobat

    2014-01-01

    The high corrosion rate of Mg alloys has hindered their application in various areas, particularly for orthopedic applications. In order to decrease the corrosion rate and to improve the bioactivity, mechanical stability and cytocompatibility of the Mg alloy, nanostructured diopside (CaMgSi 2 O 6 ) has been coated on AZ91 Mg alloy using a combined micro arc oxidation (MAO) and electrophoretic deposition (EPD) method. The crystalline structure, the morphology and the composition of the samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and Fourier transform infrared spectroscopy (FTIR). Electrochemical corrosion test, immersion test, and compression test were used to evaluate the corrosion resistance, the in vitro bioactivity and the mechanical stability of the samples, respectively. The cytocompatibility of the samples was tested by the cell viability and the cell attachment of L-929 cells. The results confirmed that the diopside coating not only slows down the corrosion rate, but also enhances the in vitro bioactivity, mechanical stability and cytocompatibility of AZ91 Mg alloy. Therefore, Mg alloy coated with nanostructured diopside offers a promising approach for biodegradable bone implants. - Highlights: • The diopside coating was applied on Mg alloy using the combined MAO and EPD methods. • The corrosion resistance of the diopside coated Mg alloy was noticeably improved. • The in vitro bioactivity of the diopside coated Mg alloy was considerably increased. • The mechanical stability of biodegradable Mg alloy was enhanced by diopside coating. • The cytocompatibility of the Mg alloy was improved employing diopside coating

  15. In vitro study of nanostructured diopside coating on Mg alloy orthopedic implants

    Energy Technology Data Exchange (ETDEWEB)

    Razavi, Mehdi, E-mail: mehdi.razavi@okstate.edu [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Torabinejad Dental Research Center, School of Dentistry, Isfahan University of Medical Sciences, Isfahan 81746-73461 (Iran, Islamic Republic of); School of Materials Science and Engineering, Helmerich Advanced Technology Research Center, Oklahoma State University, Tulsa, OK 74106 (United States); School of Electrical and Computer Engineering, Helmerich Advanced Technology Research Center, Oklahoma State University, Tulsa, OK 74106 (United States); Fathi, Mohammadhossein [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Dental Materials Research Center, Isfahan University of Medical Sciences, Isfahan (Iran, Islamic Republic of); Savabi, Omid [Torabinejad Dental Research Center, School of Dentistry, Isfahan University of Medical Sciences, Isfahan 81746-73461 (Iran, Islamic Republic of); Vashaee, Daryoosh [School of Electrical and Computer Engineering, Helmerich Advanced Technology Research Center, Oklahoma State University, Tulsa, OK 74106 (United States); Tayebi, Lobat, E-mail: lobat.tayebi@okstate.edu [School of Materials Science and Engineering, Helmerich Advanced Technology Research Center, Oklahoma State University, Tulsa, OK 74106 (United States); School of Chemical Engineering, Oklahoma State University, Stillwater, OK 74078 (United States)

    2014-08-01

    The high corrosion rate of Mg alloys has hindered their application in various areas, particularly for orthopedic applications. In order to decrease the corrosion rate and to improve the bioactivity, mechanical stability and cytocompatibility of the Mg alloy, nanostructured diopside (CaMgSi{sub 2}O{sub 6}) has been coated on AZ91 Mg alloy using a combined micro arc oxidation (MAO) and electrophoretic deposition (EPD) method. The crystalline structure, the morphology and the composition of the samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and Fourier transform infrared spectroscopy (FTIR). Electrochemical corrosion test, immersion test, and compression test were used to evaluate the corrosion resistance, the in vitro bioactivity and the mechanical stability of the samples, respectively. The cytocompatibility of the samples was tested by the cell viability and the cell attachment of L-929 cells. The results confirmed that the diopside coating not only slows down the corrosion rate, but also enhances the in vitro bioactivity, mechanical stability and cytocompatibility of AZ91 Mg alloy. Therefore, Mg alloy coated with nanostructured diopside offers a promising approach for biodegradable bone implants. - Highlights: • The diopside coating was applied on Mg alloy using the combined MAO and EPD methods. • The corrosion resistance of the diopside coated Mg alloy was noticeably improved. • The in vitro bioactivity of the diopside coated Mg alloy was considerably increased. • The mechanical stability of biodegradable Mg alloy was enhanced by diopside coating. • The cytocompatibility of the Mg alloy was improved employing diopside coating.

  16. Structural characteristics and corrosion behavior of biodegradable Mg-Zn, Mg-Zn-Gd alloys.

    Science.gov (United States)

    Kubásek, J; Vojtěch, D

    2013-07-01

    In this research, binary Mg-Zn (up to 3 wt% Zn) and ternary Mg-Zn-Gd (up to 3 wt% Gd, 3 wt% Zn) alloys were prepared by induction melting in an argon atmosphere. The structures of these alloys were characterized using light and scanning electron microscopy, energy dispersive spectrometry, X-ray diffraction and X-ray fluorescence. In addition, Brinell hardness measurements were taken to supplement these studies. Corrosion behavior was evaluated by immersion tests and potentiodynamic measurements in a physiological solution (9 g/l NaCl). Depending on the composition, structures of the as-cast alloys contained α-Mg dendrites, MgZn, Mg5Gd and Mg3Gd2Zn3 phases. Compared to pure Mg, zinc improved the corrosion resistance of binary Mg-Zn. Gadolinium also improved the corrosion resistance in the case of Mg-1Zn-3Gd alloy. The highest corrosion rate was observed for Mg-3Zn-3Gd alloy. Our results improve the understanding of the relationships between the structure and corrosion behavior of our studied alloy systems.

  17. Correlation between diffusion barriers and alloying energy in binary alloys

    DEFF Research Database (Denmark)

    Vej-Hansen, Ulrik Grønbjerg; Rossmeisl, Jan; Stephens, Ifan

    2016-01-01

    In this paper, we explore the notion that a negative alloying energy may act as a descriptor for long term stability of Pt-alloys as cathode catalysts in low temperature fuel cells.......In this paper, we explore the notion that a negative alloying energy may act as a descriptor for long term stability of Pt-alloys as cathode catalysts in low temperature fuel cells....

  18. Concept of polymer alloy electrolytes: towards room temperature operation of lithium-polymer batteries

    International Nuclear Information System (INIS)

    Noda, Kazuhiro; Yasuda, Toshikazu; Nishi, Yoshio

    2004-01-01

    Polymer alloy technique is very powerful tool to tune the ionic conductivity and mechanical strength of polymer electrolyte. A semi-interpenetrating polymer network (semi-IPN) polymer alloy electrolyte, composed of non-cross-linkable siloxane-based polymer and cross-linked 3D network polymer, was prepared. Such polymer alloy electrolyte has quite high ionic conductivity (more than 10 -4 Scm -1 at 25 o C and 10 -5 Scm -1 at -10 o C) and mechanical strength as a separator film with a wide electrochemical stability window. A lithium metal/semi-IPN polymer alloy solid state electrolyte/LiCoO 2 cell demonstrated promising cycle performance with room temperature operation of the energy density of 300Wh/L and better rate performance than conventional PEO based lithium polymer battery ever reported

  19. Molecular basis of carcinogenicity of tungsten alloy particles

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Robert M.; Williams, Tim D.; Waring, Rosemary H.; Hodges, Nikolas J., E-mail: n.hodges@bham.ac.uk

    2015-03-15

    The tungsten alloy of 91% tungsten, 6% nickel and 3% cobalt (WNC 91–6–3) induces rhabdomyosarcoma when implanted into a rat thigh muscle. To investigate whether this effect is species-specific human HSkMc primary muscle cells were exposed to WNC 91–6–3 particles and responses were compared with those from a rat skeletal muscle cell line (L6-C11). Toxicity was assessed by the adenylate kinase assay and microscopy, DNA damage by the Comet assay. Caspase 3 enzyme activity was measured and oligonucleotide microarrays were used for transcriptional profiling. WNC 91–6–3 particles caused toxicity in cells adjacent to the particles and also increased DNA strand breaks. Inhibition of caspase 3 by WNC 91–6–3 occurred in rat but not in human cells. In both rat and human cells, the transcriptional response to WNC 91–6–3 showed repression of transcripts encoding muscle-specific proteins with induction of glycolysis, hypoxia, stress responses and transcripts associated with DNA damage and cell death. In human cells, genes encoding metallothioneins were also induced, together with genes related to angiogenesis, dysregulation of apoptosis and proliferation consistent with pre-neoplastic changes. An alloy containing iron, WNF 97–2–1, which is non-carcinogenic in vivo in rats, did not show these transcriptional changes in vitro in either species while the corresponding cobalt-containing alloy, WNC 97–2–1 elicited similar responses to WNC 91–6–3. Tungsten alloys containing both nickel and cobalt therefore have the potential to be carcinogenic in man and in vitro assays coupled with transcriptomics can be used to identify alloys, which may lead to tumour formation, by dysregulation of biochemical processes. - Highlights: • Use of transcriptomics to identify likely carcinogenic tungsten alloys in vitro • Cobalt containing alloys cause oxidative stress, DNA-damage and perturb apoptosis. • Presence of cobalt causes changes in gene expression

  20. Titanium alloys. Advances in alloys, processes, products and applications

    International Nuclear Information System (INIS)

    Blenkinsop, P.A.

    1993-01-01

    The last few years have been a period of consolidation of existing alloys and processes. While the aerospace industry remains the principal driving force for alloy development, the paper illustrates examples of new markets being established in 'older' alloys, by a combination of product/process development and a re-examination of engineering design parameters. Considerable attention is still being directed towards the titanium aluminide systems, but other more conventional alloy developments are underway aimed at specific engineering and process requirements, both in the aerospace and non-aerospace sectors. Both the advanced high temperature and conventional alloy developments are considered, before the paper goes on to assess the potential of new processes and products, like spray-forming, metal matrix composites and shaped-plate rolling. (orig.)

  1. High-temperature deformation of a mechanically alloyed niobium-yttria alloy

    International Nuclear Information System (INIS)

    Chou, I.; Koss, D.A.; Howell, P.R.; Ramani, A.S.

    1997-01-01

    Mechanical alloying (MA) and hot isostatic pressing have been used to process two Nb alloys containing yttria particles, Nb-2 vol.%Y 2 O 3 and Nb-10 vol.%Y 2 O 3 . Similar to some thermomechanically processed nickel-based alloys, both alloys exhibit partially recrystallized microstructures, consisting of a 'necklace' of small recrystallized grains surrounding much larger but isolated, unrecrystallized, cold-worked grains. Hot compression tests from 1049 to 1347 C (0.5-0.6T MP ) of the 10% Y 2 O 3 alloy show that MA material possesses a much higher yield and creep strength than its powder-blended, fully recrystallized counterpart. In fact, the density-compensated specific yield strength of the MA Nb-10Y 2 O 3 exceeds that of currently available commercial Nb alloys. (orig.)

  2. Atomic Structure of Au−Pd Bimetallic Alloyed Nanoparticles

    KAUST Repository

    Ding, Yong

    2010-09-08

    Using a two-step seed-mediated growth method, we synthesized bimetallic nanoparticles (NPs) having a gold octahedron core and a palladium epitaxial shell with controlled Pd-shell thickness. The mismatch-release mechanism between the Au core and Pd shell of the NPs was systematically investigated by high-resolution transmission electron microscopy. In the NPs coated with a single atomic layer of Pd, the strain between the surface Pd layer and the Au core is released by Shockley partial dislocations (SPDs) accompanied by the formation of stacking faults. For NPs coated with more Pd (>2 nm), the stacking faults still exist, but no SPDs are found. This may be due to the diffusion of Au atoms into the Pd shell layers to eliminate the SPDs. At the same time, a long-range ordered L11 AuPd alloy phase has been identified in the interface area, supporting the assumption of the diffusion of Au into Pd to release the interface mismatch. With increasing numbers of Pd shell layers, the shape of the Au-Pd NP changes, step by step, from truncated-octahedral to cubic. After the bimetallic NPs were annealed at 523 K for 10 min, the SPDs at the surface of the NPs coated with a single atomic layer of Pd disappeared due to diffusion of the Au atoms into the surface layer, while the stacking faults and the L11 Au-Pd alloyed structure remained. When the annealing temperature was increased to 800 K, electron diffraction patterns and diffraction contrast images revealed that the NPs became a uniform Au-Pd alloy, and most of the stacking faults disappeared as a result of the annealing. Even so, some clues still support the existence of the L11 phase, which suggests that the L11 phase is a stable, long-range ordered structure in Au-Pd bimetallic NPs. © 2010 American Chemical Society.

  3. Can gamma irradiation during radiotherapy influence the metal release process for biomedical CoCrMo and 316L alloys?

    Science.gov (United States)

    Wei, Zheng; Edin, Jonathan; Karlsson, Anna Emelie; Petrovic, Katarina; Soroka, Inna L; Odnevall Wallinder, Inger; Hedberg, Yolanda

    2018-02-09

    The extent of metal release from implant materials that are irradiated during radiotherapy may be influenced by irradiation-formed radicals. The influence of gamma irradiation, with a total dose of relevance for radiotherapy (e.g., for cancer treatments) on the extent of metal release from biomedical stainless steel AISI 316L and a cobalt-chromium alloy (CoCrMo) was investigated in physiological relevant solutions (phosphate buffered saline with and without 10 g/L bovine serum albumin) at pH 7.3. Directly after irradiation, the released amounts of metals were significantly higher for irradiated CoCrMo as compared to nonirradiated CoCrMo, resulting in an increased surface passivation (enhanced passive conditions) that hindered further release. A similar effect was observed for 316L showing lower nickel release after 1 h of initially irradiated samples as compared to nonirradiated samples. However, the effect of irradiation (total dose of 16.5 Gy) on metal release and surface oxide composition and thickness was generally small. Most metals were released initially (within seconds) upon immersion from CoCrMo but not from 316L. Albumin induced an increased amount of released metals from AISI 316L but not from CoCrMo. Albumin was not found to aggregate to any greater extent either upon gamma irradiation or in the presence of trace metal ions, as determined using different light scattering techniques. Further studies should elucidate the effect of repeated friction and fractionated low irradiation doses on the short- and long term metal release process of biomedical materials. © 2018 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 2018. © 2018 The Authors Journal of Biomedical Materials Research Part B: Applied Biomaterials Published by Wiley Periodicals, Inc.

  4. Iron-based amorphous alloys and methods of synthesizing iron-based amorphous alloys

    Science.gov (United States)

    Saw, Cheng Kiong; Bauer, William A.; Choi, Jor-Shan; Day, Dan; Farmer, Joseph C.

    2016-05-03

    A method according to one embodiment includes combining an amorphous iron-based alloy and at least one metal selected from a group consisting of molybdenum, chromium, tungsten, boron, gadolinium, nickel phosphorous, yttrium, and alloys thereof to form a mixture, wherein the at least one metal is present in the mixture from about 5 atomic percent (at %) to about 55 at %; and ball milling the mixture at least until an amorphous alloy of the iron-based alloy and the at least one metal is formed. Several amorphous iron-based metal alloys are also presented, including corrosion-resistant amorphous iron-based metal alloys and radiation-shielding amorphous iron-based metal alloys.

  5. Nanoscale characterization of martensite structures in copper based shape memory alloys

    Energy Technology Data Exchange (ETDEWEB)

    Adiguzel, O, E-mail: oadiguzel@firat.edu.t [Firat University Department of Physics, 23169 Elazig (Turkey)

    2010-11-01

    Martensitic transformations are first order displacive transitions and occur in the materials on cooling from high temperature. Shape memory effect is an unusual property exhibited by certain alloy systems, and leads to martensitic transition. Copper-based alloys exhibit this property in beta phase field which possess simple bcc- structures, austenite structure at high-temperatures. As temperature is lowered the austenite undergoes martensitic transition following two ordering reactions, and structural changes in nanoscale govern this transition. Atomic movements are also confined to interatomic lengths in sub-{mu}m or angstrom scale in martensitic transformation. The formation of the layered structures in copper based alloys consists of shears and shear mechanism. Martensitic transformations occur in a few steps with the cooperative movement of atoms less than interatomic distances by means of lattice invariant shears on a {l_brace}110{r_brace} - type plane of austenite matrix which is basal plane or stacking plane of martensite. The lattice invariant shears occurs, in two opposite directions, <110> -type directions on the {l_brace}110{r_brace}-type plane. These shears gives rise to the formation of layered structure.

  6. Voltammetric determination of Zn(II in Zn-Fe alloy electroplating baths using square-wave voltammetry

    Directory of Open Access Journals (Sweden)

    Favaron Regiane

    2001-01-01

    Full Text Available A routine analytical method for zinc (II determination in Zn-Fe alloy galvanic baths was developed employing square-wave voltammetry with the static mercury drop electrode (SMDE as working electrode. Real alloy bath samples were analyzed by the standard addition method and recovery tests were undertaken. The supporting electrolytes used in the analyses were 1.0 mol L-1 NH3 / 0.2 mol L-1 NH4Cl or 0.1 mol L-1 citric acid (pH=3, presenting peak potentials for zinc (II, respectively, at -1.30 V and -0.99 V vs. Ag|AgCl (saturated KCl. The proposed voltammetric method showed a linear response range at 25 °C between 1.0 x 10-5 and 2.2 x 10-4 mol L-1 for zinc (II, in both electrolytes studied. The interference levels for some metals, such as Cu (II, Pb (II, Cr (III and Mn (II, which could prejudice Zn-Fe alloy deposition, were evaluated. These ions did not present significant degrees of interference in the zinc (II determination. The zinc (II recovery tests for the proposed method exhibited a good agreement with the reference method, showing relative errors lower than 3.0%.

  7. l-Glutamic acid assisted eco-friendly one-pot synthesis of sheet-assembled platinum-palladium alloy networks for methanol oxidation and oxygen reduction reactions.

    Science.gov (United States)

    Shi, Ya-Cheng; Mei, Li-Ping; Wang, Ai-Jun; Yuan, Tao; Chen, Sai-Sai; Feng, Jiu-Ju

    2017-10-15

    In this work, bimetallic platinum-palladium sheet-assembled alloy networks (PtPd SAANs) were facilely synthesized by an eco-friendly one-pot aqueous approach under the guidance of l-glutamic acid at room temperature, without any additive, seed, toxic or organic solvent involved. l-Glutamic acid was served as the green shape-director and weak-stabilizing agent. A series of characterization techniques were employed to examine the morphology, structure and formation mechanism of the product. The architectures exhibited improved electrocatalytic activity and durable ability toward methanol oxidation reaction (MOR) and oxygen reduction reaction (ORR) in contrast with commercial Pt black and Pd black catalysts. This is ascribed to the unique structures of the obtained PtPd SAANs and the synergistic effects of the bimetals. These results demonstrate the potential application of the prepared catalyst in fuel cells. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. On the microstructural evolution and phase transformations in a high niobium containing γ-TiAl alloy

    International Nuclear Information System (INIS)

    Zhang Dezhi; Dehm, G.; Clemens, H.

    2000-01-01

    This paper summarizes our recent work on microstructure evolution and phase transformations in a high Nb containing γ-TiAl alloy with a low Al content. The microstructures of a Ti-42Al-8.5Nb-0.5(W,Si,B,Y) alloy (composition in at.%) in the as-cast condition and after various heat treatments have been examined by optical microscopy, scanning electron microscopy and transmission electron microscopy. Analysis of the alloy in the as-cast condition reveals the existence of a very fine lamellar microstructure (the colony grain size is about 40 μm and the lamellar spacing within the colonies is about 65 nm) with B2(β) phase along colony grain boundaries. Additionally, a B2 (β) → ω phase transformation has been observed. The microstructure of the cast alloy shows evidence of the following solidification and transformation pathway: LL + α → L + α + β → α + β + γ → lamellar (α + γ) + B2 (β) + γ → lamellar (α 2 + γ) + B2 (β)/ω + γ. After annealing for 2 h from 1250 C to 1450 C, which corresponds to heat treatments within the (β + α) and β phase fields as well as different cooling conditions, the colony size does not increase dramatically, and the lamellar spacing keeps fine upon air cooling or furnace cooling (lamellar spacing ∼ 120 nm). Additionally, the microstructure of the as-cast alloy is stable during long time aging at 900 C, and the colony size does not change remarkably during long time annealing at 1150 C. These results indicate that the material has a small tendency to grain growth, which is attributed to the high Nb content as well as complex alloying effects of W, Y, Si, and B. (orig.)

  9. Probing the random distribution of half-metallic Co2Mn1-xFexSi Heusler alloys

    NARCIS (Netherlands)

    Wurmehl, S.; Kohlhepp, J.T.; Swagten, H.J.M.; Koopmans, B.; Wójcik, M.; Balke, B.; Blum, C.G.F.; Ksenofontov, V.; Fecher, G.H.; Felser, C.

    2007-01-01

    Co2Mn1-xFexSi Heusler alloys crystallize in the L21 structure. This structure type requires random distribution of Mn and Fe in case of the mixed alloys. The spin echo nuclear magnetic resonance (NMR) technique probes the direct local environments of the active atoms and is thus able to resolve next

  10. Designing a New Ni-Mn-Sn Ferromagnetic Shape Memory Alloy with Excellent Performance by Cu Addition

    Directory of Open Access Journals (Sweden)

    Kun Zhang

    2018-02-01

    Full Text Available Both magnetic-field-induced reverse martensitic transformation (MFIRMT and a high working temperature are crucial for the application of Ni-Mn-Sn magnetic shape memory alloys. Here, by first-principles calculations, we demonstrate that the substitution of Cu for Sn is effective not only in enhancing the MFIRMT but also in increasing martensitic transformation, which is advantageous for its application. Large magnetization difference (ΔM in Ni-Mn-Sn alloy is achieved by Cu doping, which arises from the enhancement of magnetization of austenite due to the change of Mn-Mn interaction from anti-ferromagnetism to ferromagnetism. This directly leads to the enhancement of MFIRMT. Meanwhile, the martensitic transformation shifts to higher temperature, owing to the energy difference between the austenite L21 structure and the tetragonal martensite L10 structure increases by Cu doping. The results provide the theoretical data and the direction for developing a high temperature magnetic-field-induced shape memory alloy with large ΔM in the Ni-Mn-Sn Heusler alloy system.

  11. Analysis of four dental alloys following torch/centrifugal and induction/ vacuum-pressure casting procedures.

    Science.gov (United States)

    Thompson, Geoffrey A; Luo, Qing; Hefti, Arthur

    2013-12-01

    Previous studies have shown casting methodology to influence the as-cast properties of dental casting alloys. It is important to consider clinically important mechanical properties so that the influence of casting can be clarified. The purpose of this study was to evaluate how torch/centrifugal and inductively cast and vacuum-pressure casting machines may affect the castability, microhardness, chemical composition, and microstructure of 2 high noble, 1 noble, and 1 base metal dental casting alloys. Two commonly used methods for casting were selected for comparison: torch/centrifugal casting and inductively heated/ vacuum-pressure casting. One hundred and twenty castability patterns were fabricated and divided into 8 groups. Four groups were torch/centrifugally cast in Olympia (O), Jelenko O (JO), Genesis II (G), and Liberty (L) alloys. Similarly, 4 groups were cast in O, JO, G, and L by an inductively induction/vacuum-pressure casting machine. Each specimen was evaluated for casting completeness to determine a castability value, while porosity was determined by standard x-ray techniques. Each group was metallographically prepared for further evaluation that included chemical composition, Vickers microhardness, and grain analysis of microstructure. Two-way ANOVA was used to determine significant differences among the main effects. Statistically significant effects were examined further with the Tukey HSD procedure for multiple comparisons. Data obtained from the castability experiments were non-normal and the variances were unequal. They were analyzed statistically with the Kruskal-Wallis rank sum test. Significant results were further investigated statistically with the Steel-Dwass method for multiple comparisons (α=.05). The alloy type had a significant effect on surface microhardness (Pcasting did not affect the microhardness of the test specimen (P=.465). Similarly, the interaction between the alloy and casting technique was not significant (P=.119). A high

  12. PWSCC Preventive Maintenance Activities for Alloy 600 in Japanese PWR Plants

    International Nuclear Information System (INIS)

    Yamamoto, K.; Sugimoto, N.; Onishi, K.; Okimura, K.

    2012-01-01

    Because many nuclear plants have been in operation for ages, the importance of preventive maintenance technologies is getting higher. One conspicuous problem found in pressurized water reactor (PWR) plants is the primary water stress corrosion cracking (PWSCC) observed in Alloy 600 (a kind of high nickel based alloy) parts. Alloy 600 was used for butt welds between low alloy steel and stainless steel of nozzles of Reactor Vessel (RV), Steam Generator (SG), and Pressurizer (Pz). As PWSCC occurred at these parts may cause Loss of Coolant Accident (LOCA), preventive maintenance is necessary. PWSCC is considered to be caused by a mixture of three elements: high residual tensile stress on surface, material (Alloy 600) and environment. PWSCC can be prevented by improving one of the elements. MHI has been developing stress improvement methods, for example, Water Jet Peening (WJP), Shot Peening by Ultrasonic vibration (USP), and Laser Stress Improvement Process (L-SIP). According to the situation, appropriate method is applied for each part. WJP has been applied for RV nozzles of a lot of plants in Japan. However PWSCC was observed in RV nozzles during the inspection before WJP in recent years, MHI developed the Advanced INLAY system to improve the material from Alloy 600 to Alloy 690. Alloy 600 on the inner surface of the nozzles is removed and welding with Alloy 690 is performed. In addition, heat treatments for the nozzles are difficult for its structural situation, so ambient temperature temper bead welding technique for RV nozzles was developed to make the heat treatments unnecessary. This paper describes countermeasures against PWSCC and introduces the maintenance activities performed in Japan. (author)

  13. High strength alloys

    Science.gov (United States)

    Maziasz, Phillip James [Oak Ridge, TN; Shingledecker, John Paul [Knoxville, TN; Santella, Michael Leonard [Knoxville, TN; Schneibel, Joachim Hugo [Knoxville, TN; Sikka, Vinod Kumar [Oak Ridge, TN; Vinegar, Harold J [Bellaire, TX; John, Randy Carl [Houston, TX; Kim, Dong Sub [Sugar Land, TX

    2010-08-31

    High strength metal alloys are described herein. At least one composition of a metal alloy includes chromium, nickel, copper, manganese, silicon, niobium, tungsten and iron. System, methods, and heaters that include the high strength metal alloys are described herein. At least one heater system may include a canister at least partially made from material containing at least one of the metal alloys. At least one system for heating a subterranean formation may include a tubular that is at least partially made from a material containing at least one of the metal alloys.

  14. Fabrication of Fe-Cr-Mo powder metallurgy steel via a mechanical-alloying process

    Science.gov (United States)

    Park, Jooyoung; Jeong, Gowoon; Kang, Singon; Lee, Seok-Jae; Choi, Hyunjoo

    2015-11-01

    In this study, we employed a mechanical-alloying process to manufacture low-alloy CrL and CrM steel powders that have similar specifications to their water-atomized counterparts. X-ray diffraction showed that Mo and Cr are alloyed in Fe after four cycles of planetary milling for 1 h at 150 RPM with 15-min pauses between the cycles (designated as P2C4 process). Furthermore, the measured powder size was found to be similar to that of the water-atomized counterparts according to both scanning electron microscope images and laser particle size analysis. The samples were sintered at 1120 °C, after which the P2C4-milled CrL showed similar hardness to that of water-atomized CrL, whereas the P2C4-milled CrM showed about 45% lower hardness than that of its water-atomized counterpart. Water-atomized CrM consists of a well-developed lathtype microstructure (bainite or martensite), while a higher fraction of polygonal ferrite is observed in P2C4-milled CrM. This phase difference causes the reduction of hardness in the P2C4-milled CrM, implying that the phase transformation behavior of specimens produced via powder metallurgy is influenced by the powder fabrication method.

  15. Aluminum fin-stock alloys

    International Nuclear Information System (INIS)

    Gul, R.M.; Mutasher, F.

    2007-01-01

    Aluminum alloys have long been used in the production of heat exchanger fins. The comparative properties of the different alloys used for this purpose has not been an issue in the past, because of the significant thickness of the finstock material. However, in order to make fins lighter in weight, there is a growing demand for thinner finstock materials, which has emphasized the need for improved mechanical properties, thermal conductivity and corrosion resistance. The objective of this project is to determine the effect of iron, silicon and manganese percentage increment on the required mechanical properties for this application by analyzing four different aluminum alloys. The four selected aluminum alloys are 1100, 8011, 8079 and 8150, which are wrought non-heat treatable alloys with different amount of the above elements. Aluminum alloy 1100 serve as a control specimen, as it is commercially pure aluminum. The study also reports the effect of different annealing cycles on the mechanical properties of the selected alloys. Metallographic examination was also preformed to study the effect of annealing on the precipitate phases and the distribution of these phases for each alloy. The microstructure analysis of the aluminum alloys studied indicates that the precipitated phase in the case of aluminum alloys 1100 and 8079 is beta-FeAI3, while in 8011 it is a-alfa AIFeSi, and the aluminum alloy 8150 contains AI6(Mn,Fe) phase. The comparison of aluminum alloys 8011 and 8079 with aluminum alloy 1100 show that the addition of iron and silicon improves the percent elongation and reduces strength. The manganese addition increases the stability of mechanical properties along the annealing range as shown by the comparison of aluminum alloy 8150 with aluminum alloy 1100. Alloy 8150 show superior properties over the other alloys due to the reaction of iron and manganese, resulting in a preferable response to thermal treatment and improved mechanical properties. (author)

  16. Nickel alloys and high-alloyed special stainless steels. Properties, manufacturing, applications. 4. compl. rev. ed.

    International Nuclear Information System (INIS)

    Heubner, Ulrich; Kloewer, Jutta; Alves, Helena; Behrens, Rainer; Schindler, Claudius; Wahl, Volker; Wolf, Martin

    2012-01-01

    This book contains the following eight topics: 1. Nickel alloys and high-alloy special stainless steels - Material overview and metallurgical principles (U. Heubner); 2. Corrosion resistance of nickel alloys and high-alloy special stainless steels (U. Heubner); 3. Welding of nickel alloys and high-alloy special stainless steels (T. Hoffmann, M. Wolf); 4. High-temperature materials for industrial plant construction (J. Kloewer); 5. Nickel alloys and high-alloy special stainless steels as hot roll clad composites-a cost-effective alternative (C. Schindler); 6. Selected examples of the use of nickel alloys and high-alloy special stainless steels in chemical plants (H. Alves); 7. The use of nickel alloys and stainless steels in environmental engineering (V. Wahl); 8: Nickel alloys and high-alloy special stainless steels for the oil and gas industry (R. Behrens).

  17. Biocompatibility of dental alloys

    Energy Technology Data Exchange (ETDEWEB)

    Braemer, W. [Heraeus Kulzer GmbH and Co. KG, Hanau (Germany)

    2001-10-01

    Modern dental alloys have been used for 50 years to produce prosthetic dental restorations. Generally, the crowns and frames of a prosthesis are prepared in dental alloys, and then veneered by feldspar ceramics or composites. In use, the alloys are exposed to the corrosive influence of saliva and bacteria. Metallic dental materials can be classified as precious and non-precious alloys. Precious alloys consist of gold, platinum, and small amounts of non-precious components such as copper, tin, or zinc. The non-precious alloys are based on either nickel or cobalt, alloyed with chrome, molybdenum, manganese, etc. Titanium is used as Grade 2 quality for dental purposes. As well as the dental casting alloys, high purity electroplated gold (99.8 wt.-%) is used in dental technology. This review discusses the corrosion behavior of metallic dental materials with saliva in ''in vitro'' tests and the influence of alloy components on bacteria (Lactobacillus casei and Streptococcus mutans). The test results show that alloys with high gold content, cobalt-based alloys, titanium, and electroplated gold are suitable for use as dental materials. (orig.)

  18. Ferritic Alloys with Extreme Creep Resistance via Coherent Hierarchical Precipitates.

    Science.gov (United States)

    Song, Gian; Sun, Zhiqian; Li, Lin; Xu, Xiandong; Rawlings, Michael; Liebscher, Christian H; Clausen, Bjørn; Poplawsky, Jonathan; Leonard, Donovan N; Huang, Shenyan; Teng, Zhenke; Liu, Chain T; Asta, Mark D; Gao, Yanfei; Dunand, David C; Ghosh, Gautam; Chen, Mingwei; Fine, Morris E; Liaw, Peter K

    2015-11-09

    There have been numerous efforts to develop creep-resistant materials strengthened by incoherent particles at high temperatures and stresses in response to future energy needs for steam turbines in thermal-power plants. However, the microstructural instability of the incoherent-particle-strengthened ferritic steels limits their application to temperatures below 900 K. Here, we report a novel ferritic alloy with the excellent creep resistance enhanced by coherent hierarchical precipitates, using the integrated experimental (transmission-electron microscopy/scanning-transmission-electron microscopy, in-situ neutron diffraction, and atom-probe tomography) and theoretical (crystal-plasticity finite-element modeling) approaches. This alloy is strengthened by nano-scaled L21-Ni2TiAl (Heusler phase)-based precipitates, which themselves contain coherent nano-scaled B2 zones. These coherent hierarchical precipitates are uniformly distributed within the Fe matrix. Our hierarchical structure material exhibits the superior creep resistance at 973 K in terms of the minimal creep rate, which is four orders of magnitude lower than that of conventional ferritic steels. These results provide a new alloy-design strategy using the novel concept of hierarchical precipitates and the fundamental science for developing creep-resistant ferritic alloys. The present research will broaden the applications of ferritic alloys to higher temperatures.

  19. Electrochemical kinetic performances of electroplating Co–Ni on La–Mg–Ni-based hydrogen storage alloys

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yuan; Tao, Yang; Ke, Dandan; Ma, Yufei [Hebei Key Laboratory of Applied Chemistry, School of Environmental and Chemical Engineering, Yanshan University, Qinhuangdao 066004 (China); Han, Shumin, E-mail: hanshm@ysu.edu.cn [Hebei Key Laboratory of Applied Chemistry, School of Environmental and Chemical Engineering, Yanshan University, Qinhuangdao 066004 (China); State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China)

    2015-12-01

    Graphical abstract: - Highlights: • The Co–Ni composite coating was prepared by electroplating. • The alloy treated at 10 mA/cm{sup 2} has superior kinetic performances. • The Co–Ni layer accelerates the charge transfer rate on the surface of the alloy. - Abstract: Electroplating Co–Ni treatment was applied to the surface of the La{sub 0.75}Mg{sub 0.25}Ni{sub 3.48} alloy electrodes in order to improve the electrochemical and kinetic performances. The Scanning electron microscope-Energy dispersive spectroscopy and X-ray diffraction results showed that the electrodes were plated with a homogeneous Co–Ni alloy film. The alloy coating significantly improved the high rate dischargeability of the alloy electrode, and the HRD value increased to 57.5% at discharge current density 1875 mA/g after the Co–Ni-coating. The exchange current density I{sub 0}, the limiting current density I{sub L} and the oxidation peak current also increased for the coated alloy. The improvement of overall electrode performances was attributed to an enhancement in electro-catalytic activity and conductivity at the alloy surface, owing to the precipitation of the Co–Ni layer.

  20. Interphase thermodynamic bond in heterogeneous alloys: effects on alloy properties

    International Nuclear Information System (INIS)

    Savchenko, A.M.; Konovalov, Yu.V.; Yuferov, O.I.

    2005-01-01

    Inconsistency between a conventional thermodynamic description of alloys as a mechanical mixture of phases and a real alloys state as a common thermodynamic system in which there is a complicated physical-chemical phases interaction has been considered. It is supposed that in heterogeneous alloys (eutectic ones, for instance), so called interphase thermodynamic bond can become apparent due to a partial electron levels splitting under phase interaction. Thermodynamic description of phase equilibrium in alloys is proposed taking into account a thermodynamic bond for the system with phase diagram of eutectic type, and methods of the value of this bond estimation are presented. Experimental evidence (Al-Cu-Si, Al-Si-Mg-Cu, U-Mo + Al) of the effect of interphase thermodynamic bond on temperature and enthalpy of melting of alloys are produced as well as possibility of its effects on alloys electrical conduction, strength, heat and corrosion resistance is substantiated theoretically [ru

  1. In vitro metal ion release and biocompatibility of amorphous Mg{sub 67}Zn{sub 28}Ca{sub 5} alloy with/without gelatin coating

    Energy Technology Data Exchange (ETDEWEB)

    Chan, W.Y., E-mail: chan.wing.yue@sgh.com.sg [School of Mechanical and Aerospace Engineering, Nanyang Technological University (Singapore); Department of Plastic, Reconstructive and Aesthetic Surgery, Singapore General Hospital (Singapore); Chian, K.S.; Tan, M.J. [School of Mechanical and Aerospace Engineering, Nanyang Technological University (Singapore)

    2013-12-01

    Amorphous zinc-rich Mg–Zn–Ca alloys have exhibited good tissue compatibility and low hydrogen evolution in vivo. However, suboptimal cell–surface interaction on magnesium alloy surface observed in vitro could lead to reduced integration with host tissue for regenerative purpose. This study aims to improve cell–surface interaction of amorphous Mg{sub 67}Zn{sub 28}Ca{sub 5} alloy by coating a gelatin layer by electrospinning. Coated/uncoated alloys were immersed and extracted for 3 days under different CO{sub 2}. The immersion results showed that pH and metal ion release in the alloy extracts were affected by gelatin coating and CO{sub 2}, suggesting their roles in alloy biocorrosion and a mechanism has been proposed for the alloy–CO{sub 2} system with/without coating. Cytotoxicity results are evident that gelatin-coated alloy with 2-day crosslinking not only exhibited no indirect cytotoxicity, but also supported attachment of L929 and MG63 cell lines around/on the alloy with high viability. Therefore, amorphous Mg{sub 67}Zn{sub 28}Ca{sub 5} alloy coated with gelatin by electrospinning technique provides a useful method to improve alloy biocompatibility. - Highlights: • Electrospinning is a new method to coat amorphous Mg{sub 67}Zn{sub 28}Ca{sub 5} alloy with gelatin. • Gelatin-coated alloy has differential effect on pH and ion release at various CO{sub 2}. • L929 cell proliferation correlates with Mg{sup 2+} level in alloy extracts. • Biomimetic gelatin coating significantly improves cell–surface interaction.

  2. Irradiation-assisted stress corrosion cracking in HTH Alloy X-750 and Alloy 625

    International Nuclear Information System (INIS)

    Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.

    1995-01-01

    In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water to determine the irradiation-assisted stress corrosion cracking (IASCC) behavior of HTH Alloy X-750 and direct-aged Alloy 625. New data confirm previous results showing that high irradiation levels reduce SCC resistance in Alloy X-750. Heat-to-heat variability correlates with boron content, with low boron heats showing improved IASCC properties. Alloy 625 is resistant to IASCC, as no cracking was observed in any Alloy 625 specimens. Microstructural, microchemical and deformation studies were performed to characterize the mechanisms responsible for IASCC in Alloy X-750 and the lack of an effect in Alloy 625. The mechanisms under investigation are: boron transmutation effects, radiation-induced changes in microstructure and deformation characteristics, and radiation-induced segregation. Irradiation of Alloy X-750 caused significant strengthening and ductility loss that was associated with the formation of cavities and dislocation loops. High irradiation levels did not cause significant segregation of alloying or trace elements in Alloy X-750. Irradiation of Alloy 625 resulted in the formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to the loops and precipitates was apparently offset by a partial dissolution of γ double-prime precipitates, as Alloy 625 showed no irradiation-induced strengthening or ductility loss. In the nonirradiated condition, an IASCC susceptible HTH heat containing 28 ppm B showed grain boundary segregation of boron, whereas a nonsusceptible HTH heat containing 2 ppm B and Alloy 625 with 20 ppm B did not show significant boron segregation. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in Alloy X-750, and the absence of these two effects results in the superior IASCC resistance displayed by Alloy 625

  3. Fabrication of the superhydrophobic surface on aluminum alloy by anodizing and polymeric coating

    Science.gov (United States)

    Liu, Wenyong; Luo, Yuting; Sun, Linyu; Wu, Ruomei; Jiang, Haiyun; Liu, Yuejun

    2013-01-01

    We reported the preparation of the superhydrophobic surface on aluminum alloy via anodizing and polymeric coating. Both the different anodizing processes and different polymeric coatings of aluminum alloy were investigated. The effects of different anodizing conditions, such as electrolyte concentration, anodization time and current on the superhydrophobic surface were discussed. The results showed that a good superhydrophobic surface was facilely fabricated by polypropylene (PP) coating after anodizing. The optimum conditions for anodizing were determined by orthogonal experiments. When the concentration of oxalic acid was 10 g/L, the concentration of NaCl was 1.25 g/L, anodization time was 40 min, and anodization current was 0.4 A, the best superhydrophobic surface on aluminum alloy with the contact angle (CA) of 162° and the sliding angle of 2° was obtained. On the other hand, the different polymeric coatings, such as polystyrene (PS), polypropylene (PP) and polypropylene grafting maleic anhydride (PP-g-MAH) were used to coat the aluminum alloy surface after anodizing. The results showed that the superhydrophobicity was most excellent by coating PP, while the duration of the hydrophobic surface was poor. By modifying the surface with the silane coupling agent before PP coating, the duration of the superhydrophobic surface was improved. The morphologies of the superhydrophobic surface were further confirmed by optical microscope (OM) and scanning electron microscope (SEM). Combined with the material of PP with the low surface free energy, the micro/nano-structures of the surface resulted in the superhydrophobicity of the aluminum alloy surface.

  4. Filler metal alloy for welding cast nickel aluminide alloys

    Science.gov (United States)

    Santella, M.L.; Sikka, V.K.

    1998-03-10

    A filler metal alloy used as a filler for welding cast nickel aluminide alloys contains from about 15 to about 17 wt. % chromium, from about 4 to about 5 wt. % aluminum, equal to or less than about 1.5 wt. % molybdenum, from about 1 to about 4.5 wt. % zirconium, equal to or less than about 0.01 wt. % yttrium, equal to or less than about 0.01 wt. % boron and the balance nickel. The filler metal alloy is made by melting and casting techniques such as are melting the components of the filler metal alloy and cast in copper chill molds. 3 figs.

  5. Impact of dilution on the microstructure and properties of Ni-based 625 alloy coatings

    Directory of Open Access Journals (Sweden)

    Tiago Jose Antoszczyszyn

    2014-06-01

    Full Text Available Nickel-based alloy IN 625 is used to protect components of aircrafts, power generation and oil refinery due to an association of toughness and high corrosion resistance. These properties are associated with the chemical composition and microstructure of coatings which depend on the processing parameters and the composition of the component being protected. This paper assessed impact of dilution on the microstructure and properties of the Ni alloy IN 625 deposited by Plasma Transferred Arc (PTA on two substrates: carbon steel API 5L and stainless steel AISI 316L. Differences due to the interaction with the substrate were maximized analyzing single layer coatings, processed with three deposition current: 120, 150 and 180 A. Correlation with a cast Nickel-based alloy sample contributed to assess the impact of dilution on coatings. Dilution was determined by the area ratio and Vickers hardness measured on the transverse section of coatings. Scanning electron and Laser confocal microscopy and X-ray diffraction analysis were carried out to characterize the microstructure. Results indicated the increasing dilution with the deposition current was deeply influenced by the substrate. Dilution ranging from 5 to 29% was measured on coatings processed on the API 5L steel and from 22 to 51% on the low thermal conductivity AISI 316L steel substrate. Differences on the microstructure and properties of coatings can be associated with the interaction with each substrate. Higher fraction of carbides account for the higher coating hardness when processing on API 5L whereas the low thermal conductivity of AISI 316L and the higher Fe content in solid solution contributed to the lower hardness of coatings.

  6. The Evaluation of the Corrosion Resistance of the Al-Si Alloys Antimony Alloyed

    Directory of Open Access Journals (Sweden)

    Svobodova J.

    2014-06-01

    Full Text Available This paper deals with the evaluation of the corrosion resistance of the Al-Si alloys alloyed with the different amount of antimony. Specifically it goes about the alloy AlSi7Mg0,3 which is antimony alloyed in the concentrations 0; 0,001; 0,005; 0,01 a 0,05 wt. % of antimony. The introduction of the paper is dedicated to the theory of the aluminium alloys corrosion resistance, testing and evaluation of the corrosion resistance. The influence of the antimony to the Al-Si alloys properties is described further in the introduction. The experimental part describes the experimental samples which were prepared for the experiment and further they were exposed to the loading in the atmospheric conditions for a period of the 3 months. The experimental samples were evaluated macroscopically and microscopically. The results of the experiment were documented and the conclusions in terms of the antimony impact to the corrosion resistance of the Al-Si alloy were concluded. There was compared the corrosion resistance of the Al-Si alloy antimony alloyed (with the different antimony content with the results of the Al-Si alloy without the alloying after the corrosion load in the atmospheric conditions in the experiment.

  7. Fabrication of the superhydrophobic surface on aluminum alloy by anodizing and polymeric coating

    Energy Technology Data Exchange (ETDEWEB)

    Liu Wenyong, E-mail: lwy@iccas.ac.cn [Key Laboratory of Advanced Materials and Technology for Packaging, Hunan University of Technology, Zhuzhou 412007 (China); College of Packaging and Materials Engineering, Hunan University of Technology, Zhuzhou 412007 (China); Luo Yuting; Sun Linyu [College of Packaging and Materials Engineering, Hunan University of Technology, Zhuzhou 412007 (China); Wu Ruomei, E-mail: cailiaodian2004@126.com [College of Packaging and Materials Engineering, Hunan University of Technology, Zhuzhou 412007 (China); Jiang Haiyun [College of Packaging and Materials Engineering, Hunan University of Technology, Zhuzhou 412007 (China); Liu Yuejun [Key Laboratory of Advanced Materials and Technology for Packaging, Hunan University of Technology, Zhuzhou 412007 (China); College of Packaging and Materials Engineering, Hunan University of Technology, Zhuzhou 412007 (China)

    2013-01-01

    Graphical abstract: The hydrophobic surface on aluminum alloy fabricated by anodizing and polymeric coating. Highlights: Black-Right-Pointing-Pointer Anodizing and polymeric coating were used to prepare a superhydrophobic surface on aluminum alloy. Black-Right-Pointing-Pointer Superhydrophobic surfaces with a high water contact angle of 162 Degree-Sign and a low rolling angle of 2 Degree-Sign were obtained. Black-Right-Pointing-Pointer The method is facile, and the materials are inexpensive, and is expected to be used widely. - Abstract: We reported the preparation of the superhydrophobic surface on aluminum alloy via anodizing and polymeric coating. Both the different anodizing processes and different polymeric coatings of aluminum alloy were investigated. The effects of different anodizing conditions, such as electrolyte concentration, anodization time and current on the superhydrophobic surface were discussed. The results showed that a good superhydrophobic surface was facilely fabricated by polypropylene (PP) coating after anodizing. The optimum conditions for anodizing were determined by orthogonal experiments. When the concentration of oxalic acid was 10 g/L, the concentration of NaCl was 1.25 g/L, anodization time was 40 min, and anodization current was 0.4 A, the best superhydrophobic surface on aluminum alloy with the contact angle (CA) of 162 Degree-Sign and the sliding angle of 2 Degree-Sign was obtained. On the other hand, the different polymeric coatings, such as polystyrene (PS), polypropylene (PP) and polypropylene grafting maleic anhydride (PP-g-MAH) were used to coat the aluminum alloy surface after anodizing. The results showed that the superhydrophobicity was most excellent by coating PP, while the duration of the hydrophobic surface was poor. By modifying the surface with the silane coupling agent before PP coating, the duration of the superhydrophobic surface was improved. The morphologies of the superhydrophobic surface were further confirmed

  8. Fabrication of the superhydrophobic surface on aluminum alloy by anodizing and polymeric coating

    International Nuclear Information System (INIS)

    Liu Wenyong; Luo Yuting; Sun Linyu; Wu Ruomei; Jiang Haiyun; Liu Yuejun

    2013-01-01

    Graphical abstract: The hydrophobic surface on aluminum alloy fabricated by anodizing and polymeric coating. Highlights: ► Anodizing and polymeric coating were used to prepare a superhydrophobic surface on aluminum alloy. ► Superhydrophobic surfaces with a high water contact angle of 162° and a low rolling angle of 2° were obtained. ► The method is facile, and the materials are inexpensive, and is expected to be used widely. - Abstract: We reported the preparation of the superhydrophobic surface on aluminum alloy via anodizing and polymeric coating. Both the different anodizing processes and different polymeric coatings of aluminum alloy were investigated. The effects of different anodizing conditions, such as electrolyte concentration, anodization time and current on the superhydrophobic surface were discussed. The results showed that a good superhydrophobic surface was facilely fabricated by polypropylene (PP) coating after anodizing. The optimum conditions for anodizing were determined by orthogonal experiments. When the concentration of oxalic acid was 10 g/L, the concentration of NaCl was 1.25 g/L, anodization time was 40 min, and anodization current was 0.4 A, the best superhydrophobic surface on aluminum alloy with the contact angle (CA) of 162° and the sliding angle of 2° was obtained. On the other hand, the different polymeric coatings, such as polystyrene (PS), polypropylene (PP) and polypropylene grafting maleic anhydride (PP-g-MAH) were used to coat the aluminum alloy surface after anodizing. The results showed that the superhydrophobicity was most excellent by coating PP, while the duration of the hydrophobic surface was poor. By modifying the surface with the silane coupling agent before PP coating, the duration of the superhydrophobic surface was improved. The morphologies of the superhydrophobic surface were further confirmed by optical microscope (OM) and scanning electron microscope (SEM). Combined with the material of PP with the low

  9. VANADIUM ALLOYS

    Science.gov (United States)

    Smith, K.F.; Van Thyne, R.J.

    1959-05-12

    This patent deals with vanadium based ternary alloys useful as fuel element jackets. According to the invention the ternary vanadium alloys, prepared in an arc furnace, contain from 2.5 to 15% by weight titanium and from 0.5 to 10% by weight niobium. Characteristics of these alloys are good thermal conductivity, low neutron capture cross section, good corrosion resistance, good welding and fabricating properties, low expansion coefficient, and high strength.

  10. Hydrofluoric Acid Corrosion Study of High-Alloy Materials

    International Nuclear Information System (INIS)

    Osborne, P.E.

    2002-01-01

    A corrosion study involving high-alloy materials and concentrated hydrofluoric acid (HF) was conducted in support of the Molten Salt Reactor Experiment Conversion Project (CP). The purpose of the test was to obtain a greater understanding of the corrosion rates of materials of construction currently used in the CP vs those of proposed replacement parts. Results of the study will help formulate a change-out schedule for CP parts. The CP will convert slightly less than 40 kg of 233 U from a gas (UF 6 ) sorbed on sodium fluoride pellets to a more stable oxide (U 3 O 8 ). One by-product of the conversion is the formation of concentrated HF. Six moles of highly corrosive HF are produced for each mole of UF 6 converted. This acid is particularly corrosive to most metals, elastomers, and silica-containing materials. A common impurity found in 233 U is 232 U. This impurity isotope has several daughters that make the handling of the 233 U difficult. Traps of 233 U may have radiation fields of up to 400 R at contact, a situation that makes the process of changing valves or working on the CP more challenging. It is also for this reason that a comprehensive part change-out schedule must be established. Laboratory experiments involving the repeated transfer of HF through 1/2-in. metal tubing and valves have proven difficult due to the corrosivity of the HF upon contact with all wetted parts. Each batch of HF is approximately 1.5 L of 33 wt% HF and is transferred most often as a vapor under vacuum and at temperatures of up to 250 C. Materials used in the HF side of the CP include Hastelloy C-276 and Monel 400 tubing, Haynes 230 and alloy C-276 vessels, and alloy 400 valve bodies with Inconel (alloy 600) bellows. The chemical compositions of the metals discussed in this report are displayed in Table 1. Of particular concern are the almost 30 vendor-supplied UG valves that have the potential for exposure to HF. These valves have been proven to have a finite life due to failure

  11. Microstructural development of diffusion-brazed austenitic stainless steel to magnesium alloy using a nickel interlayer

    International Nuclear Information System (INIS)

    Elthalabawy, Waled M.; Khan, Tahir I.

    2010-01-01

    The differences in physical and metallurgical properties of stainless steels and magnesium alloys make them difficult to join using conventional fusion welding processes. Therefore, the diffusion brazing of 316L steel to magnesium alloy (AZ31) was performed using a double stage bonding process. To join these dissimilar alloys, the solid-state diffusion bonding of 316L steel to a Ni interlayer was carried out at 900 deg. C followed by diffusion brazing to AZ31 at 510 deg. C. Metallographic and compositional analyses show that a metallurgical bond was achieved with a shear strength of 54 MPa. However, during the diffusion brazing stage B 2 intermetallic compounds form within the joint and these intermetallics are pushed ahead of the solid/liquid interface during isothermal solidification of the joint. These intermetallics had a detrimental effect on joint strengths when the joint was held at the diffusion brazing temperature for longer than 20 min.

  12. To alloy or not to alloy? Cr modified Pt/C cathode catalysts for PEM fuel cells.

    Science.gov (United States)

    Wells, Peter P; Qian, Yangdong; King, Colin R; Wiltshire, Richard J K; Crabb, Eleanor M; Smart, Lesley E; Thompsett, David; Russell, Andrea E

    2008-01-01

    The cathode electrocatalysts for proton exchange membrane (PEM) fuel cells are commonly platinum and platinum based alloy nanoparticles dispersed on a carbon support. Control over the particle size and composition has, historically, been attained empirically, making systematic studies of the effects of various structural parameters difficult. The controlled surface modification methodology used in this work has enabled the controlled modification of carbon supported Pt nanoparticles by Cr so as to yield nanoalloy particles with defined compositions. Subsequent heat treatment in 5% H2 in N2 resulted in the formation of a distinct Pt3Cr alloy phase which was either restricted to the surface of the particles or present throughout the bulk of the particle structure. Measurement of the oxygen reduction activity of the catalysts was accomplished using the rotating thin film electrode method and the activities obtained were related to the structure of the nanoalloy catalyst particles, largely determined using Cr K edge and Pt L3 edge XAS.

  13. Crevice corrosion propagation on alloy 625 and alloy C276 in natural seawater

    International Nuclear Information System (INIS)

    McCafferty, E.; Bogar, F.D.; Thomas, E.D. II; Creegan, C.A.; Lucas, K.E.; Kaznoff, A.I.

    1997-01-01

    Chemical composition of the aqueous solution within crevices on two different Ni-Cr-Mo-Fe alloys immersed in natural seawater was determined using a semiquantitative thin-layer chromatographic method. Active crevices were found to contain concentrated amounts of dissolved Ni 2+ , Cr 3+ , Mo 3+ , and Fe 2+ ions. Propagation of crevice corrosion for the two alloys was determined from anodic polarization curves in model crevice solutions based upon stoichiometric dissolution or selective dissolution of alloy components. Both alloys 625 (UNS N06625) and C276 (UNS N10276) underwent crevice corrosion in the model crevice electrolytes. For the model crevice solution based upon selective dissolution of alloy constituents, the anodic dissolution rate for alloy 625 was higher than that for alloy C276. This trend was reversed for the model crevice solution based upon uniform dissolution of alloy constituents

  14. Corrosion of aluminum alloys as a function of alloy composition

    International Nuclear Information System (INIS)

    Johnson, A.B. Jr.

    1969-10-01

    A study was initiated which included nineteen aluminum alloys. Tests were conducted in high purity water at 360 0 C and flow tests (approx. 20 ft/sec) in reactor process water at 130 0 C (TF-18 loop tests). High-silicon alloys and AlSi failed completely in the 360 0 C tests. However, coupling of AlSi to 8001 aluminum suppressed the failure. The alloy compositions containing iron and nickel survived tht 360 0 C autoclave exposures. Corrosion rates varied widely as a function of alloy composition, but in directions which were predictable from previous high-temperature autoclave experience. In the TF-18 loop flow tests, corrosion penetrations were similar on all of the alloys and on high-purity aluminum after 105 days. However, certain alloys established relatively low linear corrosion rates: Al-0.9 Ni-0.5 Fe-0.1 Zr, Al-1.0 Ni-0.15 Fe-11.5 Si-0.8 Mg, Al-1.2 Ni-1.8 Fe, and Al-7.0 Ni-4.8 Fe. Electrical polarity measurements between AlSi and 8001 alloys in reactor process water at temperatures up to 150 0 C indicated that AlSi was anodic to 8001 in the static autoclave system above approx. 50 0 C

  15. Surface treatment of new type aluminum lithium alloy and fatigue crack behaviors of this alloy plate bonded with Ti–6Al–4V alloy strap

    International Nuclear Information System (INIS)

    Sun, Zhen-Qi; Huang, Ming-Hui; Hu, Guo-Huai

    2012-01-01

    Highlights: ► A new generation aluminum lithium alloy which special made for Chinese commercial plane was investigated. ► Pattern of aluminum lithium alloy and Ti alloy were shown after anodization. ► Crack propagation of samples bonded with different wide Ti straps were studied in this paper. -- Abstract: Samples consisting of new aluminum lithium alloy (Al–Li alloy) plate developed by the Aluminum Company of America and Ti–6Al–4V alloy (Ti alloy) plate were investigated. Plate of 400 mm × 140 mm × 2 mm with single edge notch was anodized in phosphoric solution and Ti alloy plate of 200 mm × 20 (40) mm × 2 mm was anodized in alkali solution. Patterns of two alloys were studied at original/anodized condition. And then, aluminum alloy and Ti alloy plates were assembled into a sample with FM 94 film adhesive. Fatigue crack behaviors of the sample were investigated under condition of nominal stress σ = 36 MPa and 54 MPa, stress ratio of 0.1. Testing results show that anodization treatment modifies alloys surface topography. Ti alloy bonding to Al–Li alloy plate effectively retards crack growth than that of Al–Li alloy plate. Fatigue life of sample bonded with Ti alloy strap improves about 62.5% than that of non-strap plate.

  16. The Properties of 7xxx Series Alloys Formed by Alloying Additions

    Directory of Open Access Journals (Sweden)

    Kwak Z.

    2015-06-01

    Full Text Available Currently there is a constant development in the field of aluminium alloys engineering. This results from, i.a., better understanding of the mechanisms that direct strengthening of these alloys and the role of microalloying. Now it is microalloying in aluminum alloys that is receiving a lot of attention. It affects substantially the macro- and microstructure and kinetics of phase transformation influencing the properties during production and its exploitation. 7xxx series aluminum alloys, based on the Al-Zn-Mg-Cu system, are high-strength alloys, moreover, the presence of Zr and Sr further increases their strength and improves resistance to cracking.

  17. Influence of cobalt content on the structure and hard magnetic properties of nanocomposite (Fe,Co)-Pt-B alloys

    Energy Technology Data Exchange (ETDEWEB)

    Grabias, A., E-mail: agnieszka.grabias@itme.edu.pl [Institute of Electronic Materials Technology, Wólczyńska 133, 01-919 Warsaw (Poland); Kopcewicz, M. [Institute of Electronic Materials Technology, Wólczyńska 133, 01-919 Warsaw (Poland); Latuch, J.; Oleszak, D. [Faculty of Materials Science and Engineering, Warsaw University of Technology, Wołoska 141, 02-507 Warsaw (Poland); Pękała, M. [Department of Chemistry, University of Warsaw, Al. Żwirki i Wigury 101, 02-089 Warsaw (Poland); Kowalczyk, M. [Faculty of Materials Science and Engineering, Warsaw University of Technology, Wołoska 141, 02-507 Warsaw (Poland)

    2017-07-15

    Highlights: • Nanocomposite alloys were formed by annealing of the rapidly quenched alloys. • Magnetically hard L1{sub 0} (Fe,Co)Pt and soft (Fe,Co){sub 2}B or (Fe,Co)B were formed. • Mössbauer spectra revealed Co substitution for Fe in L1{sub 0} FePt, FeB and Fe{sub 2}B phases. • Annealed alloys exhibit hard magnetic properties which depend on phase compositions. • Co addition was found to decrease the magnetization and the energy product. - Abstract: The influence of Co content on the structural and hard magnetic properties of two sets of nanocrystalline Fe{sub 52−x}Co{sub x}Pt{sub 28}B{sub 20} (x = 0–26) and Fe{sub 60−y}Co{sub y}Pt{sub 25}B{sub 15} (y = 0–40) alloys was studied. The alloys were prepared as ribbons by the rapid quenching technique. The nanocomposite structure in the alloys was obtained by annealing at 840–880 K for 30 min. Structural characterization of the samples was performed using the Mössbauer spectroscopy and X-ray diffraction. Magnetic properties of the samples were studied by the measurements of the hysteresis loops and of the magnetization at increasing temperatures. An amorphous phase prevailed in the as-quenched Fe{sub 52−x}Co{sub x}Pt{sub 28}B{sub 20} alloys while a disordered solid solution of fcc-(Fe,Co)Pt was a dominating phase in the Fe{sub 60−y}Co{sub y}Pt{sub 25}B{sub 15} ribbons. Differential scanning calorimetry measurements revealed one or two exothermic peaks at temperatures up to 993 K, depending on the composition of the alloys. Thermal treatment of the samples led to the formation of the magnetically hard ordered L1{sub 0} tetragonal (Fe,Co)Pt nanocrystallites and magnetically softer phases of (Fe,Co)B (for Fe{sub 52−x}Co{sub x}Pt{sub 28}B{sub 20}) or (Fe,Co){sub 2}B (for Fe{sub 60−y}Co{sub y}Pt{sub 25}B{sub 15}). Detailed Mössbauer spectroscopy studies revealed that cobalt substituted for iron in both the L1{sub 0} phase and in iron borides. The nanocomposite Fe{sub 60−y}Co{sub y

  18. High temperature steam oxidation of Al3Ti-based alloys for the oxidation-resistant surface layer on Zr fuel claddings

    International Nuclear Information System (INIS)

    Park, Jeong-Yong; Kim, Il-Hyun; Jung, Yang-Il; Kim, Hyun-Gil; Park, Dong-Jun; Choi, Byung-Kwon

    2013-01-01

    We investigated the feasibility to apply Al 3 Ti-based alloys as the surface layer for improving the oxidation resistance of Zr fuel claddings under accident conditions. Two types of Al 3 Ti-based alloys with the compositions of Al–25Ti–10Cr and Al–21Ti–23Cr in atomic percent were prepared by arc-melting followed by homogenization annealing at 1423 K for 48 h. Al–25Ti–10Cr alloy showed an L1 2 quasi-single phase microstructure with a lot of needle-shaped minor phase and pores. Al–21Ti–23Cr alloy consisted of an L1 2 matrix and Cr 2 Al as the second phase. Al 3 Ti-based alloys showed an extremely low oxidation rate in a 1473 K steam for up to 7200 s when compared to Zircaloy-4. Both alloys exhibited almost the same oxidation rate in the early stage of oxidation, but Al–25Ti–10Cr showed a little lower oxidation rate after 4000 s than Al–21Ti–23Cr. The difference in the oxidation rate between two types of Al 3 Ti-based alloys was too marginal to distinguish the oxidation behavior of each alloy. The resultant oxide exhibited almost the same characteristics in both alloys even though the microstructure was explicitly distinguished from each other. The crystal structure of the oxide formed up to 2000 s was identified as Al 2 O 3 in both alloys. The oxide morphology consisted of columnar grains whose length was almost identical to the average oxide thickness. On the basis of the results obtained, it is considered that Al 3 Ti-based alloy is one of the promising candidates for the oxidation-resistant surface layer on Zr fuel claddings

  19. Microstructural Characterization of Clad Interface in Welds of Ni-Cr-Mo High Strength Low Alloy Steel

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hong-Eun; Kim, Min-Chul; Lee, Ho-Jin; Kim, Keong-Ho [KAERI, Daejeon (Korea, Republic of); Lee, Ki-Hyoung [KAIST, Daejeon (Korea, Republic of); Lee, Chang-Hee [Hanyang Univ., Seoul (Korea, Republic of)

    2011-08-15

    SA508 Gr.4N Ni-Cr-Mo low alloy steel, in which Ni and Cr contents are higher than in commercial SA508 Gr.3 Mn-Mo-Ni low alloy steels, may be a candidate reactor pressure vessel (RPV) material with higher strength and toughness from its tempered martensitic microstructure. The inner surface of the RPV is weld-cladded with stainless steels to prevent corrosion. The goal of this study is to evaluate the microstructural properties of the clad interface between Ni-Cr-Mo low alloy steel and stainless weldment, and the effects of post weld heat treatment (PWHT) on the properties. The properties of the clad interface were compared with those of commercial Mn-Mo-Ni low alloy steel. Multi-layer welding of model alloys with ER308L and ER309L stainless steel by the SAW method was performed, and then PWHT was conducted at 610°C for 30 h. The microstructural changes of the clad interface were analyzed using OM, SEM and TEM, and micro-Vickers hardness tests were performed. Before PWHT, the heat affected zone (HAZ) showed higher hardness than base and weld metals due to formation of martensite after welding in both steels. In addition, the hardness of the HAZ in Ni-Cr-Mo low alloy steel was higher than that in Mn-Mo-Ni low alloy steel due to a comparatively high martensite fraction. The hardness of the HAZ decreased after PWHT in both steels, but the dark region was formed near the fusion line in which the hardness was locally high. In the case of Mn-Mo-Ni low alloy steel, formation of fine Cr-carbides in the weld region near the fusion line by diffusion of C from the base metal resulted in locally high hardness in the dark region. However, the precipitates of the region in the Ni-Cr-Mo low alloy steel were similar to that in the base metal, and the hardness in the region was not greatly different from that in the base metal.

  20. Microstructural Characterization of Clad Interface in Welds of Ni-Cr-Mo High Strength Low Alloy Steel

    International Nuclear Information System (INIS)

    Kim, Hong-Eun; Kim, Min-Chul; Lee, Ho-Jin; Kim, Keong-Ho; Lee, Ki-Hyoung; Lee, Chang-Hee

    2011-01-01

    SA508 Gr.4N Ni-Cr-Mo low alloy steel, in which Ni and Cr contents are higher than in commercial SA508 Gr.3 Mn-Mo-Ni low alloy steels, may be a candidate reactor pressure vessel (RPV) material with higher strength and toughness from its tempered martensitic microstructure. The inner surface of the RPV is weld-cladded with stainless steels to prevent corrosion. The goal of this study is to evaluate the microstructural properties of the clad interface between Ni-Cr-Mo low alloy steel and stainless weldment, and the effects of post weld heat treatment (PWHT) on the properties. The properties of the clad interface were compared with those of commercial Mn-Mo-Ni low alloy steel. Multi-layer welding of model alloys with ER308L and ER309L stainless steel by the SAW method was performed, and then PWHT was conducted at 610°C for 30 h. The microstructural changes of the clad interface were analyzed using OM, SEM and TEM, and micro-Vickers hardness tests were performed. Before PWHT, the heat affected zone (HAZ) showed higher hardness than base and weld metals due to formation of martensite after welding in both steels. In addition, the hardness of the HAZ in Ni-Cr-Mo low alloy steel was higher than that in Mn-Mo-Ni low alloy steel due to a comparatively high martensite fraction. The hardness of the HAZ decreased after PWHT in both steels, but the dark region was formed near the fusion line in which the hardness was locally high. In the case of Mn-Mo-Ni low alloy steel, formation of fine Cr-carbides in the weld region near the fusion line by diffusion of C from the base metal resulted in locally high hardness in the dark region. However, the precipitates of the region in the Ni-Cr-Mo low alloy steel were similar to that in the base metal, and the hardness in the region was not greatly different from that in the base metal.

  1. Reducing thermal conductivity of binary alloys below the alloy limit via chemical ordering

    International Nuclear Information System (INIS)

    Duda, John C; English, Timothy S; Jordan, Donald A; Norris, Pamela M; Soffa, William A

    2011-01-01

    Substitutional solid solutions that exist in both ordered and disordered states will exhibit markedly different physical properties depending on their exact crystallographic configuration. Many random substitutional solid solutions (alloys) will display a tendency to order given the appropriate kinetic and thermodynamic conditions. Such order-disorder transitions will result in major crystallographic reconfigurations, where the atomic basis, symmetry, and periodicity of the alloy change dramatically. Consequently, the dominant scattering mechanism in ordered alloys will be different than that in disordered alloys. In this study, we present a hypothesis that ordered alloys can exhibit lower thermal conductivities than their disordered counterparts at elevated temperatures. To validate this hypothesis, we investigate the phononic transport properties of disordered and ordered AB Lennard-Jones alloys via non-equilibrium molecular dynamics and harmonic lattice dynamics calculations. It is shown that the thermal conductivity of an ordered alloy is the same as the thermal conductivity of the disordered alloy at ∼0.6T melt and lower than that of the disordered alloy above 0.8T melt .

  2. Corrosion behavior of dissimilar weld joint of 316L and alloy 182 filler metal with different post-weld heat treatments in saline environments

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Joao H.N.; Santos, Neice F.; Esteves, Luiza; Campos, Wagner R.C.; Rabello, Emerson G., E-mail: joao.garcia@cdtn.br, E-mail: nfs@cdtn.br, E-mail: luiza.esteves@cdtn.br, E-mail: wrcc@cdtn.br, E-mail: egr@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (SEIES/CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Serviço de Integridade Estrutural

    2017-11-01

    Austenitic stainless steel and nickel alloys are widely used in nuclear reactors components and other plants of energy generation, chemical and petrochemical industries, due to their high corrosion resistance. These metals require post weld heat treatment (PWHT) to relieve stresses from the welding processes, although it can lead to a degradation of the weld microstructure. The aim of this work was to evaluate the influence of different PWHT on corrosion behavior of a dissimilar weld joint of two AISI 316L austenitic stainless steel plates with nickel alloy as filler material in saline environments. The material was submitted to heat treatments for three hours at 600, 700 and 800 °C. The weld joint was examined by optical microscopy to determine the effects of PWHT in the microstructure. The corrosion behavior of the samples before and after heat treatment was evaluated using cyclic potentiodynamic polarization (CPP) in sodium chloride solutions (19% v/v) and pH 4.0 at room temperature. Metallographic analyses showed that delta ferrite dissolute with PWHT temperature increase. CPP curves demonstrated an increase of pitting corrosion resistance as the PWHT temperature increases, although the pit size has been increased. The heat treated weld joint at 600 °C showed corrosion resistance close to the as welded material. (author)

  3. The wetting of cladding materials and other metals and alloys by sodium

    International Nuclear Information System (INIS)

    Hodkin, E.N.; Nicholas, M.G.

    1976-05-01

    The sessile drop technique has been used to investigate the wetting behaviour between sodium and various metals and alloys including FV548, 316L, M316 and PE16. Unoxidised smooth surfaces of these alloys were not wetted by sodium containing 20 ppm of oxygen at temperatures below 300 0 C but were well wetted with advancing contact angles of 20 0 or less at temperatures of 550 0 to 600 0 C. Cold working and surface roughness had little effect on wetting behaviour but other factors exercised significant influences. Chemically or electrolytically polished M316 and PE16 surfaces were less readily wetted than those which had been prepared by mechanical polishing. In general, preoxidation of the alloy surfaces and increased oxygen contamination of the sodium had detrimental effects on wetting behaviour. On the other hand, increasing the chromium content of the alloys, decreasing the oxygen content of the sodium or ion bombarding the alloy sample surfaces had beneficial effects. Auger spectroscopy studies revealed a correlation between the chromium/oxygen ratio of PE16 surfaces and their wettability. The implications of this and other factors on fast reactor coolant/clad wetting behaviour is discussed. (author)

  4. Lattice dynamic properties of Rh2XAl (X=Fe and Y) alloys

    Science.gov (United States)

    Al, Selgin; Arikan, Nihat; Demir, Süleyman; Iyigör, Ahmet

    2018-02-01

    The electronic band structure, elastic and vibrational spectra of Rh2FeAl and Rh2YAl alloys were computed in detail by employing an ab-initio pseudopotential method and a linear-response technique based on the density-functional theory (DFT) scheme within a generalized gradient approximation (GGA). Computed lattice constants, bulk modulus and elastic constants were compared. Rh2YAl exhibited higher ability to resist volume change than Rh2FeAl. The elastic constants, shear modulus, Young modulus, Poisson's ratio, B/G ratio electronic band structure, total and partial density of states, and total magnetic moment of alloys were also presented. Rh2FeAl showed spin up and spin down states whereas Rh2YAl showed none due to being non-magnetic. The calculated total densities of states for both materials suggest that both alloys are metallic in nature. Full phonon spectra of Rh2FeAl and Rh2YA1 alloys in the L21 phase were collected using the ab-initio linear response method. The obtained phonon frequencies were in the positive region indicating that both alloys are dynamically stable.

  5. High-Strength Ultra-Fine-Grained Hypereutectic Al-Si-Fe-X (X = Cr,Mn) Alloys Prepared by Short-Term Mechanical Alloying and Spark Plasma Sintering

    Czech Academy of Sciences Publication Activity Database

    Průša, F.; Bláhová, M.; Vojtěch, D.; Kučera, V.; Bernatiková, A.; Kubatík, Tomáš František; Michalcová, A.

    2016-01-01

    Roč. 9, č. 12 (2016), č. článku 973. ISSN 1996-1944 Institutional support: RVO:61389021 Keywords : mechanical alloying * spark plasma sintering * microstructure * mechanical properties Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.654, year: 2016 http://www.mdpi.com/1996-1944/9/12/973

  6. Effect of boron on the properties of ordered Ni-Mo alloys

    International Nuclear Information System (INIS)

    Tawancy, H.M.

    1994-01-01

    Ordered alloys and intermetallic compounds have long been known to possess a number of technologically useful properties, however, their structural applications is limited by relatively poor ductility. Efforts to improve the mechanical strength of these materials have led to the recognition that small additions of B improve the ductility of intermetallic compounds, based upon the L1 2 , superlattice such as Ni 3 Al and Ni 3 Si. Also it has been demonstrated that small additions of B improve the ductility of binary ordered Ni-Ni 4 Mo alloys. The objective of this study is to demonstrate that critical additions of B to selected Ni-Mo alloys could significantly improve their ductility and corrosion properties in the ordered state while maintaining a similar level of other properties, particularly, weldability. The effect of B on the ordered microstructure was emphasized

  7. Evolution of rapidly solidified NiAlCu(B) alloy microstructure.

    Science.gov (United States)

    Czeppe, Tomasz; Ochin, Patrick

    2006-10-01

    This study concerned phase transformations observed after rapid solidification and annealing at 500, 700 and 800 degrees C in 56.3 Ni-39.9 Al-3.8 Cu-0.06 B (E1) and 59.8 Ni-36.0 Al-4.3 Cu-0.06 B (E2) alloys (composition in at.%). Injection casting led to a homogeneous structure of very small, one-phase grains (2-4 microm in size). In both alloys, the phase observed at room temperature was martensite of L1(0) structure. The process of the formation of the Ni(5)Al(3) phase by atomic reordering proceeded at 285-394 degrees C in the case of E1 alloy and 450-550 degrees C in the case of E2 alloy. Further decomposition into NiAl (beta) and Ni(3)Al (gamma') phases, the microstructure and crystallography of the phases depended on the path of transformations, proceeding in the investigated case through the transformation of martensite crystallographic variants. This preserved precise crystallographic orientation between the subsequent phases, very stable plate-like morphology and very small beta + gamma' grains after annealing at 800 degrees C.

  8. Moessbauer effect studies of magnetic interactions in iron and dilute iron alloys

    International Nuclear Information System (INIS)

    Woude, F. van der; Schurer, P.J.; Sawatzky, G.A.

    1975-01-01

    A temperature-dependent Moessbauer study was conducted in FeX alloys, where X = Al, Si, Ti, V, Cr, Mn, Co, and Ni, aimed at solving the problem of 'what is localized and what is itinerant in iron ferromagnetism'. The experimental results are interpreted using a phenomenological model based on a modified Zener-Vonsovskij theory. Absorption spectra of FeX alloys were measured as a function of temperature. It was found that the 3d magnetic moments in iron were mainly localized while exchange coupling was provided by partly itinerant 3d electrons. (L.D.)

  9. Translating VDM to Alloy

    DEFF Research Database (Denmark)

    Lausdahl, Kenneth

    2013-01-01

    specifications. However, to take advantage of the automated analysis of Alloy, the model-oriented VDM specifications must be translated into a constraint-based Alloy specifications. We describe how a sub- set of VDM can be translated into Alloy and how assertions can be expressed in VDM and checked by the Alloy...

  10. Electron beam and laser surface alloying of Al-Si base alloys

    International Nuclear Information System (INIS)

    Vanhille, P.; Tosto, S.; Pelletier, J.M.; Issa, A.; Vannes, A.B.; Criqui, B.

    1992-01-01

    Surface alloying on aluminium-base alloys is achieved either by using an electron beam or a laser beam, in order to improve the mechanical properties of the near-surface region. A predeposit of nickel is first realized by plasma spraying. Melting of both the coating and part of the substrate produces a surface alloy with a fine, dendritic microstructure with a high hardness. Enhancement of this property requires an increase in the nickel content. Various problems occur during the formation of nickel-rich surface layers: incomplete homogenization owing to a progressive increase of the liquidus temperature, cracks owing to the brittleness of this hard suface alloy, formation of a plasma when experiments are carried out in a gaseous environment (laser surface alloying). Nevertheless, various kinds of surface layers may be achieved; for example very hard surface alloys (HV 0.2 =900), with a thickness of about 500-600 μm, or very thick surface alloys (e>2 mm), with a fairly good hardness (greater than 350 HV 0.2 ). Thus, it is possible to obtain a large variety of new materials by using high energy beams on aluminium substrates. (orig.)

  11. Combinatorial thin film materials science: From alloy discovery and optimization to alloy design

    Energy Technology Data Exchange (ETDEWEB)

    Gebhardt, Thomas, E-mail: gebhardt@mch.rwth-aachen.de; Music, Denis; Takahashi, Tetsuya; Schneider, Jochen M.

    2012-06-30

    This paper provides an overview of modern alloy development, from discovery and optimization towards alloy design, based on combinatorial thin film materials science. The combinatorial approach, combining combinatorial materials synthesis of thin film composition-spreads with high-throughput property characterization has proven to be a powerful tool to delineate composition-structure-property relationships, and hence to efficiently identify composition windows with enhanced properties. Furthermore, and most importantly for alloy design, theoretical models and hypotheses can be critically appraised. Examples for alloy discovery, optimization, and alloy design of functional as well as structural materials are presented. Using Fe-Mn based alloys as an example, we show that the combination of modern electronic-structure calculations with the highly efficient combinatorial thin film composition-spread method constitutes an effective tool for knowledge-based alloy design.

  12. Combinatorial thin film materials science: From alloy discovery and optimization to alloy design

    International Nuclear Information System (INIS)

    Gebhardt, Thomas; Music, Denis; Takahashi, Tetsuya; Schneider, Jochen M.

    2012-01-01

    This paper provides an overview of modern alloy development, from discovery and optimization towards alloy design, based on combinatorial thin film materials science. The combinatorial approach, combining combinatorial materials synthesis of thin film composition-spreads with high-throughput property characterization has proven to be a powerful tool to delineate composition–structure–property relationships, and hence to efficiently identify composition windows with enhanced properties. Furthermore, and most importantly for alloy design, theoretical models and hypotheses can be critically appraised. Examples for alloy discovery, optimization, and alloy design of functional as well as structural materials are presented. Using Fe-Mn based alloys as an example, we show that the combination of modern electronic-structure calculations with the highly efficient combinatorial thin film composition-spread method constitutes an effective tool for knowledge-based alloy design.

  13. Development and structural characterization of exchange-spring-like nanomagnets in (Fe,Co)-Pt bulk nanocrystalline alloys

    Energy Technology Data Exchange (ETDEWEB)

    Crisan, O.; Crisan, A.D.; Mercioniu, I. [National Institute for Materials Physics, P.O. Box MG-7, 077125 Magurele, Bucharest (Romania); Nicula, R. [Empa, Swiss Federal Laboratories for Materials Science and Technology, Advanced Materials Processing, Feuerwerkerstr. 39, CH-3602 Thun (Switzerland); Vasiliu, F., E-mail: fvasiliu@infim.ro [National Institute for Materials Physics, P.O. Box MG-7, 077125 Magurele, Bucharest (Romania)

    2016-03-01

    FePt-based alloys are currently under scrutiny for their possible use as materials for perpendicular magnetic recording. Another possible application is in the field of permanent magnets without rare-earths, magnets that may operate at higher temperatures than the classic Nd–Fe–B magnets. Within this study, FeCoPt alloys prepared by rapid solidification from the melt are structurally and magnetically characterized. In the as-cast FeCoPt ribbons, a three-phase structure comprising well-ordered CoFePt and CoPt L1{sub 0} phases embedded in a disordered fcc FePt matrix was evidenced by XRD, HREM and SAED. Extended transmission electron microscopy analysis demonstrates the incipient formation of ordered L1{sub 0} phases. X-ray diffraction was used to characterize the phase structure and to obtain the structural parameters of interest for L1{sub 0} ordering. In the as-cast state, the co-existence of hard magnetic CoFePt and CoPt L1{sub 0} tetragonal phases with the soft fcc FePt phase is obtained within a refined microstructure made of alternatively disposed grains (grain sizes from 1 to 7 nm). Following a thermal treatment of 1 h at 670 °C, the soft magnetic fcc matrix phase transforms to tetragonal L1{sub 0} phases (disorder–order transition). The resulting CoPt and CoFePt L1{sub 0} phases have grains of around 5–20 nm in size. In the as-cast state, magnetic measurements show a quite large remanence (0.75 T), close to the value of the parent L1{sub 0} FePt phase. Coercive fields of about 200 kA/m at 5 K were obtained, comparable with those reported for some FePt-based bulk alloys. Upon annealing both remanence and coercivity are increased and values of up to 254 kA/m at 300 K are obtained. The polycrystalline structure of the annealed FeCoPt samples, as well as the formation of multiple c-axis domains in different CoPt and CoFePt regions (which leads to a reduction of the magneto-crystalline anisotropy) may account for the observed coercive fields that are

  14. Shape memory alloys

    International Nuclear Information System (INIS)

    Kaszuwara, W.

    2004-01-01

    Shape memory alloys (SMA), when deformed, have the ability of returning, in certain circumstances, to their initial shape. Deformations related to this phenomenon are for polycrystals 1-8% and up to 15% for monocrystals. The deformation energy is in the range of 10 6 - 10 7 J/m 3 . The deformation is caused by martensitic transformation in the material. Shape memory alloys exhibit one directional or two directional shape memory effect as well as pseudoelastic effect. Shape change is activated by temperature change, which limits working frequency of SMA to 10 2 Hz. Other group of alloys exhibit magnetic shape memory effect. In these alloys martensitic transformation is triggered by magnetic field, thus their working frequency can be higher. Composites containing shape memory alloys can also be used as shape memory materials (applied in vibration damping devices). Another group of composite materials is called heterostructures, in which SMA alloys are incorporated in a form of thin layers The heterostructures can be used as microactuators in microelectromechanical systems (MEMS). Basic SMA comprise: Ni-Ti, Cu (Cu-Zn,Cu-Al, Cu-Sn) and Fe (Fe-Mn, Fe-Cr-Ni) alloys. Shape memory alloys find applications in such areas: automatics, safety and medical devices and many domestic appliances. Currently the most important appears to be research on magnetic shape memory materials and high temperature SMA. Vital from application point of view are composite materials especially those containing several intelligent materials. (author)

  15. Measurements and mechanisms of localized aqueous corrosion in aluminum-lithium-copper alloys

    Science.gov (United States)

    Wall, Douglas; Stoner, Glenn E.

    1991-01-01

    Summary information is included for electrochemical aspects of stress corrosion cracking in alloy 2090 and an introduction to the work to be initiated on the new X2095 (Weldalite) alloy system. Stress corrosion cracking (SCC) was studied in both S-T and L-T orientations in alloy 2090. A constant load TTF test was performed in several environments with a potentiostatically applied potential. In the same environments the electrochemical behavior of phases found along subgrain boundaries was assessed. It was found that rapid failure due to SCC occurred when the following criteria was met: E(sub BR,T1) is less than E(sub applied) is less than E(sub Br, matrix phase). Although the L-T orientation is usually considered more resistant to SCC, failures in this orientation occurred when the stated criteria was met. This may be due to the relatively isotropic geometry of the subgrains which measure approximately 12 to 25 microns in diameters. Initial studies of alloy X2095 includes electrochemical characterization of three compositional variations each at three temperatures. The role of T(sub 1) dissolution in SCC behavior is addressed using techniques similar to those used in the research of 2090 described. SCC susceptibility is also studied using alternate immersion facilities at Reynolds Metals Corporation. Pitting is investigated in terms of stability, role of precipitate phases and constituent particles, and as initiation sites for SCC. In all research endeavors, attempts are made to link electrochemistry to microstructure. Previous work on 2090 provides a convenient basis for comparison since both alloys contain T(sub 1) precipitates but with different distributions. In 2090 T(sub 1) forms preferentially on subgrain boundaries whereas in X2095 the microstructure appears to be more homogeneous with finer T(sub 1) particles. Another point for comparison is the delta prime strengthening phase found in 2090 but absent in X2095.

  16. Phase transition induced anelasticity in Fe–Ga alloys with 25 and 27%Ga

    Energy Technology Data Exchange (ETDEWEB)

    Golovin, I.S., E-mail: i.golovin@misis.ru [National University of Science and Technology “MISIS”, Leninsky ave. 4, 119049, Moscow (Russian Federation); Balagurov, A.M., E-mail: bala@nf.jinr.ru [Frank Laboratory of Neutron Physics, Joint Institute for Nuclear Research, 141980, Dubna (Russian Federation); Bobrikov, I.A. [Frank Laboratory of Neutron Physics, Joint Institute for Nuclear Research, 141980, Dubna (Russian Federation); Palacheva, V.V. [National University of Science and Technology “MISIS”, Leninsky ave. 4, 119049, Moscow (Russian Federation); Cifre, J. [Universitat de les Illes Balears, Ctra. De Valldemossa, km.7.5, E-07122, Palma de Mallorca (Spain)

    2016-08-05

    Neutron diffraction and mechanical spectroscopy techniques were applied to study phase transitions in Fe–Ga alloys with 25 and 27 at.% Ga. The following sequences of phase transitions at continuous heating and subsequent cooling in the 20–900 °C temperature range were recorded: D0{sub 3} → L1{sub 2} (limited amount) → A2(B2) was recorded at heating and A2(B2) → D0{sub 3} at cooling for Fe-24.8Ga alloy, and the D0{sub 3} → L1{sub 2} → D0{sub 19} → A2(B2) was recorded at heating and A2(B2) → L1{sub 2} at cooling for Fe-27.4Ga alloy. Thus, the difference in 2.6 at.%Ga between two studied compositions with D0{sub 3} structure leads to their different structures after heating to 900 °C. These transition sequences determine different temperature dependencies of elastic and anelastic properties. The D0{sub 3} → A2(B2) transition (in Fe-25Ga) does not lead to a well-pronounced anelastic effect, in contrast the D0{sub 3} → L1{sub 2} transition (in Fe-27Ga) generates internal stresses due to a different rate of an increase in the lattice parameter with temperature and leads to a well-pronounced transient internal friction effect. - Highlights: • Neutron diffraction technique is used to study in situ phase transitions in Fe-25 and 27 at.% Ga. • D0{sub 3} → L1{sub 2} → D0{sub 19} → A2/B2 transitions were recorded at instant heating in Fe-27 at.% Ga. • D0{sub 3} → L1{sub 2} (limited amount) → A2(B2) was recorded at instant heating in Fe-25 at.% Ga • The D0{sub 3} → L1{sub 2} transition generates internal stresses and leads to elastic and anelastic response.

  17. Collective effects of interface roughness and alloy disorder in InxGa1-xN/GaN multiple quantum wells

    International Nuclear Information System (INIS)

    Zeng, K.C.; Smith, M.; Lin, J.Y.; Jiang, H.X.

    1998-01-01

    The collective effects of alloy disorder and interface roughness on optical properties of In x Ga 1-x N/GaN multiple quantum wells (MQWs) have been studied. The results are compared with those of GaN/AlGaN MQWs and InGaN epilayers. In x Ga 1-x N/GaN MQWs emit a broad and asymmetrical photoluminescence (PL) band, while GaN/AlGaN MQWs and InGaN epilayers emit narrower and Gaussian-shaped PL bands. Furthermore, the decay of excitons at low temperatures in In x Ga 1-x N/GaN MQWs follows a nonexponential function even at the lower-energy side of the PL spectral peak, while those in GaN/AlGaN MQWs and in InGaN epilayers follow a single exponential function. Both alloy disorder and interface roughness have to be included in order to interpret the PL emission spectrum and the decay dynamics in In x Ga 1-x N/GaN MQWs. Important parameters of the In x Ga 1-x N/GaN MQWs, σ x ,σ L , and dτ/dL, denoting the alloy disorder, the interface roughness, and the rate of changing of the exciton decay lifetime with well width, respectively, have been deduced. The method developed here can be used to determine σ x ,σ L , and dτ/dL in any MQW systems with wells being alloy materials. copyright 1998 American Institute of Physics

  18. Grindability of dental magnetic alloys.

    Science.gov (United States)

    Hayashi, Eisei; Kikuchi, Masafumi; Okuno, Osamu; Kimura, Kohei

    2005-06-01

    In this study, the grindability of cast magnetic alloys (Fe-Pt-Nb magnetic alloy and magnetic stainless steel) was evaluated and compared with that of conventional dental casting alloys (Ag-Pd-Au alloy, Type 4 gold alloy, and cobalt-chromium alloy). Grindability was evaluated in terms of grinding rate (i.e., volume of metal removed per minute) and grinding ratio (i.e., volume ratio of metal removed compared to wheel material lost). Solution treated Fe-Pt-Nb magnetic alloy had a significantly higher grinding rate than the aged one at a grinding speed of 750-1500 m x min(-1). At 500 m x min(-1), there were no significant differences in grinding rate between solution treated and aged Fe-Pt-Nb magnetic alloys. At a lower speed of 500 m x min(-1) or 750 m x min(-1), it was found that the grinding rates of aged Fe-Pt-Nb magnetic alloy and stainless steel were higher than those of conventional casting alloys.

  19. The evaluation of dynamic cracking resistance of chosen casting alloys in the aspect of the impact bending test

    Directory of Open Access Journals (Sweden)

    J.Sadowski

    2008-10-01

    Full Text Available The increase of quality and durability of produced casting alloys can be evaluated on the base of material tests performed on a high level. One of such modern test methods are tests of the dynamic damage process of materials and the evaluation on the base of obtained courses F(f, F(t of parameters of dynamic cracking resistance KId, JId, performed with the usage of instrumented Charpy pendulums. In the paper there was presented the evaluation of dynamic cracking resistance parameters of casting alloys such as: AK12 aluminum alloy, L20G cast steel and spheroid cast iron. The methodology of the evaluation of that parameters was described and their change as well, for the AK12 alloy with the cold work different level, L20G cast steel cooled from different temperatures in the range +20oC -60oC, and for the spheroid cast iron in different stages of treatment i.e. raw state, after normalization, spheroid annealing and graphitizing annealing.Obtained parameters of dynamic cracking resistance KId, JId of tested casting alloys enabled to define the critical value of the ad defect that can be tolerated by tested castings in different work conditions with impact loadings.

  20. Alloying Solid Solution Strengthening of Fe-Ga Alloys: A First-Principle Study

    National Research Council Canada - National Science Library

    Chen, Kuiying; Cheng, Leon M

    2006-01-01

    ... and Co in cubic solid solution of Fe-Ga alloys. Mayer bond order "BO" values were used to evaluate the atomic bond strengths in the alloys, and were then used to assess the alloying strengthening characteristics...

  1. Hot Corrosion of Cobalt-Base Alloys

    Science.gov (United States)

    1975-06-01

    Alloys 20. ABSTRACT (Continue on revet -se tside lf necessary and identify by block number) ~ lThe sodium sulfate-induced hot corrosion of cobalt and...Figures 12 and 13. The Na2 SO 4 was observed to form puddles on the oxide-covered specimen surface. An oxide slag was usually suspended in the... slag (black arrows) were suspended (30 sees at 1000°C in air). b) After washing the Na2SO 4 from the specimen, the exposed oxide surface was highly

  2. The role of antiphase boundaries in the kinetic process of the L12→ D022 structural change of an Ni3Al0.45V0.50 alloy

    International Nuclear Information System (INIS)

    Tanimura, Makoto; Koyama, Yasumasa

    2006-01-01

    The influence of antiphase boundaries (APBs) on the kinetic process of the L1 2 → D0 22 structural change in an Ni 3 Al 0.45 V 0.50 alloy has been investigated by transmission electron microscopy. The structural change includes two kinetic factors, i.e., the periodic introduction of antiphase-shifted planes (APSPs) in the L1 2 structure and V diffusion in the L1 2 matrix. Our results revealed that APB migration was accompanied by V diffusion as if to sweep the V atoms out of the antiphase domains (APDs). It was also found that the APBs served as the nucleation sites of the D0 22 regions, because the combination of the migrated APBs produced the APSPs in the L1 2 structure. On this basis, it is proposed that the APBs bring together the two kinetic factors in the process of the L1 2 → D0 22 structural change, the physical origin of which is the variation in the charge density distribution of the APDs due to APB migration

  3. Bulk metallic glasses and high entropy alloys for reprocessing applications

    International Nuclear Information System (INIS)

    Kamachi Mudali, U.; Jayaraj, J.

    2016-01-01

    Recent breakthroughs in materials engineering have generated complex alloys that retain a glassy state in bulk form (bulk metallic glasses or BMGs) via ingot casting. High corrosion resistance is expected for BMGs (amorphous) as they are free from defects associated with the crystalline state such as grain boundaries, dislocations and stacking faults. Compared with conventional alloys containing one or two principal elements, the recently developed HEAs are usually composed of five or more elements with equimolar or near equimolar elemental fractions, which forms single solid solution phase. These HEAs exhibit excellent microstructural stability with better mechanical, wear and corrosion resistance properties as they are essentially single phase. Reprocessing of spent fuel from the fast breeder reactor involves the use of high concentration of (11.5 M) nitric acid under boiling conditions for the dissolution of the fuel. Conventional AISI type 304LSS and nitric acid grade 304L stainless steel would undergo inter-granular corrosion under these conditions and cannot be used for the fabrication of dissolver vessel. Currently titanium is used and zirconium alloys are proposed for future dissolver applications. Thus searching for newer materials with higher corrosion resistance suggests metallic glasses and HEAs for critical components of the dissolver application. Several Zr-based glassy alloys with different microstructural states and Ni-Nb based glassy alloys and TiZrHfNbTa HEA were cast and characterized for microstructure and corrosion resistance in nitric acid medium. From these studies, factors such as the corrosive environment (nitric acid, chloride and fluoride), and the presence of passivating elements in the alloy were emphasized for better corrosion resistance of BMGs and HEA. Attempts were also made to prepare coatings of Zr-and Ni-based glassy alloys on 304LSS by laser based deposition technique and their corrosion properties were evaluated. (author)

  4. Studies on neutron irradiation effects of iron alloys and nickel-base heat resistant alloys

    International Nuclear Information System (INIS)

    Watanabe, Katsutoshi

    1987-09-01

    The present paper describes the results of neutron irradiation effects on iron alloys and nickel-base heat resistant alloys. As for the iron alloys, irradiation hardening and embrittlement were investigated using internal friction measurement, electron microscopy and tensile testings. The role of alloying elements was also investigated to understand the irradiation behavior of iron alloys. The essential factors affecting irradiation hardening and embrittlement were thus clarified. On the other hand, postirradiation tensile and creep properties were measured of Hastelloy X alloy. Irradiation behavior at elevated temperatures is discussed. (author)

  5. 25 CFR 115.605 - What information will the BIA include in its notice of the decision to restrict your IIM account?

    Science.gov (United States)

    2010-04-01

    ...: Hearing Process for Restricting an IIM Account § 115.605 What information will the BIA include in its... notice of its decision to restrict your account, the only information the public notice will include is... 25 Indians 1 2010-04-01 2010-04-01 false What information will the BIA include in its notice of...

  6. Thermodynamic criteria for the removal of impurities from end-of-life magnesium alloys by evaporation and flux treatment

    Energy Technology Data Exchange (ETDEWEB)

    Hiraki, Takehito; Matsubae, Kazuyo; Nagasaka, Tetsuya [Graduate School of Environmental Studies, Tohoku University, Sendai 980-8578 (Japan); Takeda, Osamu [Graduate School of Engineering, Tohoku University, Sendai 980-8578 (Japan); Nakajima, Kenichi [Research Center for Material Cycles and Waste Management, National Institute for Environmental Studies, Tsukuba 305-8506 (Japan); Nakamura, Shinichiro, E-mail: hiraki@material.tohoku.ac.jp [Graduate School of Economics, Waseda University, Tokyo 169-8050 (Japan)

    2011-06-15

    In this paper, the possibility of removing impurities during magnesium recycling with pyrometallurgical techniques has been evaluated by using a thermodynamic analysis. For 25 different elements that are likely to be contained in industrial magnesium alloys, the equilibrium distribution ratios between the metal, slag and gas phases in the magnesium remelting process were calculated assuming binary systems of magnesium and an impurity element. It was found that calcium, gadolinium, lithium, ytterbium and yttrium can be removed from the remelted end-of-life (EoL) magnesium products by oxidization. Calcium, cerium, gadolinium, lanthanum, lithium, plutonium, sodium, strontium and yttrium can be removed by chlorination with a salt flux. However, the other elements contained in magnesium alloy scrap are scarcely removed and this may contribute toward future contamination problems. The third technological option for the recycling of EoL magnesium products is magnesium recovery by a distillation process. Based on thermodynamic considerations, it is predicted that high-purity magnesium can be recovered through distillation because of its high vapor pressure, yet there is a limit on recoverability that depends on the equilibrium vapor pressure of the alloying elements and the large energy consumption. Therefore, the sustainable recycling of EoL magnesium products should be an important consideration in the design of advanced magnesium alloys or the development of new refining processes.

  7. Thermodynamic criteria for the removal of impurities from end-of-life magnesium alloys by evaporation and flux treatment

    Directory of Open Access Journals (Sweden)

    Takehito Hiraki, Osamu Takeda, Kenichi Nakajima, Kazuyo Matsubae, Shinichiro Nakamura and Tetsuya Nagasaka

    2011-01-01

    Full Text Available In this paper, the possibility of removing impurities during magnesium recycling with pyrometallurgical techniques has been evaluated by using a thermodynamic analysis. For 25 different elements that are likely to be contained in industrial magnesium alloys, the equilibrium distribution ratios between the metal, slag and gas phases in the magnesium remelting process were calculated assuming binary systems of magnesium and an impurity element. It was found that calcium, gadolinium, lithium, ytterbium and yttrium can be removed from the remelted end-of-life (EoL magnesium products by oxidization. Calcium, cerium, gadolinium, lanthanum, lithium, plutonium, sodium, strontium and yttrium can be removed by chlorination with a salt flux. However, the other elements contained in magnesium alloy scrap are scarcely removed and this may contribute toward future contamination problems. The third technological option for the recycling of EoL magnesium products is magnesium recovery by a distillation process. Based on thermodynamic considerations, it is predicted that high-purity magnesium can be recovered through distillation because of its high vapor pressure, yet there is a limit on recoverability that depends on the equilibrium vapor pressure of the alloying elements and the large energy consumption. Therefore, the sustainable recycling of EoL magnesium products should be an important consideration in the design of advanced magnesium alloys or the development of new refining processes.

  8. Thermodynamic criteria for the removal of impurities from end-of-life magnesium alloys by evaporation and flux treatment

    International Nuclear Information System (INIS)

    Hiraki, Takehito; Matsubae, Kazuyo; Nagasaka, Tetsuya; Takeda, Osamu; Nakajima, Kenichi; Nakamura, Shinichiro

    2011-01-01

    In this paper, the possibility of removing impurities during magnesium recycling with pyrometallurgical techniques has been evaluated by using a thermodynamic analysis. For 25 different elements that are likely to be contained in industrial magnesium alloys, the equilibrium distribution ratios between the metal, slag and gas phases in the magnesium remelting process were calculated assuming binary systems of magnesium and an impurity element. It was found that calcium, gadolinium, lithium, ytterbium and yttrium can be removed from the remelted end-of-life (EoL) magnesium products by oxidization. Calcium, cerium, gadolinium, lanthanum, lithium, plutonium, sodium, strontium and yttrium can be removed by chlorination with a salt flux. However, the other elements contained in magnesium alloy scrap are scarcely removed and this may contribute toward future contamination problems. The third technological option for the recycling of EoL magnesium products is magnesium recovery by a distillation process. Based on thermodynamic considerations, it is predicted that high-purity magnesium can be recovered through distillation because of its high vapor pressure, yet there is a limit on recoverability that depends on the equilibrium vapor pressure of the alloying elements and the large energy consumption. Therefore, the sustainable recycling of EoL magnesium products should be an important consideration in the design of advanced magnesium alloys or the development of new refining processes.

  9. Multifunctional substrate of Al alloy based on general hierarchical micro/nanostructures: superamphiphobicity and enhanced corrosion resistance

    OpenAIRE

    Li, Xuewu; Shi, Tian; Liu, Cong; Zhang, Qiaoxin; Huang, Xingjiu

    2016-01-01

    Aluminum alloys are vulnerable to penetrating and peeling failures in seawater and preparing a barrier coating to isolate the substrate from corrosive medium is an effective anticorrosion method. Inspired by the lotus leaves effect, a wetting alloy surface with enhanced anticorrosion behavior has been prepared via etch, deposition, and low-surface-energy modification. Results indicate that excellent superamphiphobicity has been achieved after the modification of the constructed hierarchical l...

  10. Development and properties of Ti–In binary alloys as dental biomaterials

    International Nuclear Information System (INIS)

    Wang, Q.Y.; Wang, Y.B.; Lin, J.P.; Zheng, Y.F.

    2013-01-01

    The objective of this study is to investigate the effect of alloying element indium on the microstructure, mechanical properties, corrosion behavior and in vitro cytotoxicity of Ti–In binary alloys, with the addition of 1, 5, 10 and 15 at.% indium. The phase constitution was studied by optical microscopic observation and X-ray diffraction measurements. The mechanical properties were characterized by tension and microhardness tests. Potentiodynamic polarization measurements were employed to investigate the corrosion behavior in artificial saliva solutions with and without fluoride. In vitro cytotoxicity was conducted by using L929 and NIH 3T3 mouse fibroblast cell lines, with commercially pure Ti (CP–Ti, ASTM grade 2) as negative control. All of the binary Ti–In alloys investigated in this work were found to have higher strength and microhardness than CP–Ti. Electrochemical results showed that Ti–In alloys exhibited the same order of magnitude of passivation current densities with CP–Ti in artificial saliva solutions. With the presence of NaF, Ti–10In and Ti–15In showed transpassive behavior and lower current densities at high potentials. All experimental Ti–In alloys showed good cytocompatibility, at the same level as CP–Ti. The addition of indium to titanium was effective on increasing the strength and microhardness, without impairing its good corrosion resistance and cytocompatibility. - Highlights: ► The addition of In into Ti can increase the mechanical property. ► Ti-In alloys exhibited similar passivation behavior with CP-Ti. ► Ti-In alloys had good cytocompatibility comparable with CP-Ti. ► Ti-10In and Ti-15In showed transpassive baheviour with the addition of NaF

  11. Neutron-absorbing alloys

    International Nuclear Information System (INIS)

    Portnoi, K.I.; Arabei, L.B.; Gryaznov, G.M.; Levi, L.I.; Lunin, G.L.; Kozhukhov, V.M.; Markov, J.M.; Fedotov, M.E.

    1975-01-01

    A process is described for the production of an alloy consiting of 1 to 20% In, 0.5 to 15% Sm, and from 3 to 18% Hf, the balance being Ni. Such alloys show a good absorption capacity for thermal and intermediate neutrons, good neutron capture efficiency, and good corrosion resistance, and find application in nuclear reactor automatic control and safety systems. The Hf provides for the maintenance of a reasonably high order of neutron capture efficiency throughout the lifetime of a reactor. The alloys are formed in a vacuum furnace operating with an inert gas atmosphere at 280 to 300 mm.Hg. They have a corrosion resistance from 3 to 3.5 times that of the Ag-based alloys commonly employed, and a neutron capture efficiency about twice that of the Ag alloys. Castability and structural strength are good. (U.K.)

  12. Effect of mechanical alloying on FeCrC reinforced Ni alloys

    Energy Technology Data Exchange (ETDEWEB)

    Yilmaz, S. Osman [Univ. of Namik Kemal, Tekirdag (Turkey); Teker, Tanju [Adiyaman Univ. (Turkey). Dept. of Metallurgical and Materials Engineering; Demir, Fatih [Batman Univ. (Turkey)

    2016-05-01

    Mechanical alloying (MA) is a powder metallurgy processing technique involving cold welding, fracturing and rewelding of powder particles in a high-energy ball mill. In the present study, the intermetallic matrix composites (IMCs) of Ni-Al reinforced by M{sub 7}C{sub 3} were produced by powder metallurgical routes via solid state reaction of Ni, Al and M{sub 7}C{sub 3} particulates by mechanical alloying processes. Ni, Al and M{sub 7}C{sub 3} powders having 100 μm were mixed, mechanical alloyed and the compacts were combusted in a furnace. The mechanically alloyed (MAed) powders were investigated by X-ray diffraction (XRD), microhardness measurement, optic microscopy (OM), scanning electron microscopy (SEM) and energy dispersive spectrometry (EDS). The presence of the carbides depressed the formation of unwanted NiAl intermetallic phases. The mechanical alloyed M{sub 7}C{sub 3} particles were unstable and decomposed partially within the matrix during alloying and sintering, and the morphology of the composites changed with the dissolution ratio of M{sub 7}C{sub 3} and sintering temperature.

  13. The glass transition, crystallization and melting in Au-Pb-Sb alloys

    Science.gov (United States)

    Lee, M. C.; Allen, J. L.; Fecht, H. J.; Perepezko, J. H.; Ohsaka, K.

    1988-01-01

    The glass transition, crystallization and melting of Au(55)Pb(22.5)Sb(22.5) alloys have been studied by differential scanning calorimetry DSC. Crystallization on heating above the glass transition temperature Tg (45 C) begins at 64 C. Further crystallization events are observed at 172 C and 205 C. These events were found to correspond to the formation of the intermetallic compounds AuSb2, Au2Pb, and possibly AuPb2, respectively. Isothermal DSC scans of the glassy alloy above Tg were used to monitor the kinetics of crystallization. The solidification behavior and heat capacity in the glass-forming composition range were determined with droplet samples. An undercooling level of 0.3T(L) below the liquidus temperature T(L) was achieved, resulting in crystallization of different stable and metastable phases. The heat capacity C(P) of the undercooled liquid was measured over an undercooling range of 145 C.

  14. Materials for innovative lead alloy cooled nuclear systems: Overview

    International Nuclear Information System (INIS)

    Mueller, Georg; Weisenburger, Alfons; Fetzer, Renate; Heinzel, Annette; Jianu, Adrian

    2015-01-01

    One of the most challenging issues for all future innovative nuclear systems including Gen IV reactors are materials. The selection of the structural materials determines the design which has to consider the properties and the availability of the materials. Beside general requirements for material properties that are common for all fast reactor types specific issues arise from coolant compatibility. The high solubility of steel alloying elements in liquid Pb-alloys at reactor relevant temperatures is clearly detrimental. Therefore, all steels that are considered as structural materials have to be protected by dissolution barriers. The most common barriers for steels under consideration are oxide scales that form in situ during operation. However, increasing the temperature above 500 deg. C will result either in dissolution attack or in enhanced oxidation. For higher temperatures additional barriers like alumina forming surface alloys are discussed and investigated. Mechanical loads like creep stress and fretting will act on the steels. These mechanical loads will interact with the coolant and can increase the negative effects. For a LFR (Lead Fast Reactor) Demonstrator and MYHRRA (ADS) austenitic steels (316L) are selected for most in core components. The 15-15Ti is the choice for the fuel cladding of MYHRRA and a Pb cooled demonstrator. For an industrial LFR (Lead Fast Reactor) the ferritic martensitic steel T91 was selected as fuel clad material due to its improved irradiation resistance. T91 is in both designs the material to be used for the heat exchanger. Surface alloying with alumina forming alloys is considered to assure material functionality at higher temperatures and is therefore selected for fuel cladding of the ELFR and the heat exchanger tubes. This presentation will give an overview on the selected materials for innovative Pb alloy cooled nuclear systems considering, beside pure compatibility, the influence of mechanical interaction like creep and

  15. Hydrofluoric Acid Corrosion Study of High-Alloy Materials

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, P.E.

    2002-09-11

    A corrosion study involving high-alloy materials and concentrated hydrofluoric acid (HF) was conducted in support of the Molten Salt Reactor Experiment Conversion Project (CP). The purpose of the test was to obtain a greater understanding of the corrosion rates of materials of construction currently used in the CP vs those of proposed replacement parts. Results of the study will help formulate a change-out schedule for CP parts. The CP will convert slightly less than 40 kg of {sup 233}U from a gas (UF{sub 6}) sorbed on sodium fluoride pellets to a more stable oxide (U{sub 3}O{sub 8}). One by-product of the conversion is the formation of concentrated HF. Six moles of highly corrosive HF are produced for each mole of UF{sub 6} converted. This acid is particularly corrosive to most metals, elastomers, and silica-containing materials. A common impurity found in {sup 233}U is {sup 232}U. This impurity isotope has several daughters that make the handling of the {sup 233}U difficult. Traps of {sup 233}U may have radiation fields of up to 400 R at contact, a situation that makes the process of changing valves or working on the CP more challenging. It is also for this reason that a comprehensive part change-out schedule must be established. Laboratory experiments involving the repeated transfer of HF through 1/2-in. metal tubing and valves have proven difficult due to the corrosivity of the HF upon contact with all wetted parts. Each batch of HF is approximately 1.5 L of 33 wt% HF and is transferred most often as a vapor under vacuum and at temperatures of up to 250 C. Materials used in the HF side of the CP include Hastelloy C-276 and Monel 400 tubing, Haynes 230 and alloy C-276 vessels, and alloy 400 valve bodies with Inconel (alloy 600) bellows. The chemical compositions of the metals discussed in this report are displayed in Table 1. Of particular concern are the almost 30 vendor-supplied UG valves that have the potential for exposure to HF. These valves have been

  16. The solidification behavior of dilute aluminium-scandium alloys

    International Nuclear Information System (INIS)

    Norman, A.F.; Prangnell, P.B.; McEwen, R.S.

    1998-01-01

    The solidification behavior of dilute Sc containing Al alloys has been investigated. In binary Al-Sc alloys, Sc additions greater than the eutectic composition (0.55 wt%) were found to produce a remarkable refinement in the grain size of aluminum castings, of two orders of magnitude, due to the formation of the primary Al 3 Sc intermetallic phase during solidification. The refinement in grain size only occurred in hypereutectic compositions and was shown to be far greater than can be achieved by conventional Al grain refiners. Grain refinement by the addition of Sc is accompanied by a change in growth morphology from dendritic, in the large unrefined grains, to fine spherical grains with a divorced eutectic appearing on the grain boundaries in the refined castings. Similar levels of refinement were observed in Al-Sc-Zr and Al-Cu-Sc alloys. In the latter, a change in the segregation behavior of Cu was observed, from a strongly interdendritic segregation pattern to a more homogeneous distribution. The supersaturated Al-Sc solid solution can decompose via a discontinuous precipitation reaction to form coherent rod-like precipitates of the L1 2 Al 3 Sc phase

  17. Advances in titanium alloys

    International Nuclear Information System (INIS)

    Seagle, S.R.; Wood, J.R.

    1993-01-01

    As described above, new developments in the aerospace market are focusing on higher temperature alloys for jet engine components and higher strength/toughness alloys for airframe applications. Conventional alloys for engines have reached their maximum useful temperature of about 1000 F (540 C) because of oxidation resistance requirements. IMI 834 and Ti-1100 advanced alloys show some improvement, however, the major improvement appears to be in gamma titanium aluminides which could extend the maximum usage temperature to about 1500 F (815 C). This puts titanium alloys in a competitive position to replace nickel-base superalloys. Advanced airframe alloys such as Ti-6-22-22S, Beta C TM , Ti-15-333 and Ti-10-2-3 with higher strength than conventional Ti-6-4 are being utilized in significantly greater quantities, both in military and commercial applications. These alloys offer improved strength with little or no sacrifice in toughness and improved formability, in some cases. Advanced industrial alloys are being developed for improved corrosion resistance in more reducing and higher temperature environments such as those encountered in sour gas wells. Efforts are focused on small precious metal additions to optimize corrosion performance for specific applications at a modest increase in cost. As these applications develop, the usage of titanium alloys for industrial markets should steadily increase to approach that for aerospace applications. (orig.)

  18. High-Temperature Tensile Strength of Al10Co25Cr8Fe15Ni36Ti6 Compositionally Complex Alloy (High-Entropy Alloy)

    Science.gov (United States)

    Daoud, H. M.; Manzoni, A. M.; Wanderka, N.; Glatzel, U.

    2015-06-01

    Homogenizing at 1220°C for 20 h and subsequent aging at 900°C for 5 h and 50 h of a novel Al10Co25Cr8Fe15Ni36Ti6 compositionally complex alloy (high-entropy alloy) produces a microstructure consisting of an L12 ordered γ' phase embedded in a face-centered cubic solid-solution γ matrix together with needle-like B2 precipitates (NiAl). The volume fraction of γ' phase is ~46% and of needle-like B2 precipitates database; Thermo-Calc Software, Stockholm, Sweden). The high-temperature tensile tests were carried out at room temperature, 600°C, 700°C, 800°C, and 1000°C. The tensile strength as well as the elongation to failure of both heat-treated specimens is very high at all tested temperatures. The values of tensile strength has been compared with literature data of well-known Alloy 800H and Inconel 617, and is discussed in terms of the observed microstructure.

  19. Coercivity and nanostructure of melt-spun Ti-Fe-Co-B-based alloys

    Directory of Open Access Journals (Sweden)

    W. Y. Zhang

    2016-05-01

    Full Text Available Nanocrystalline Ti-Fe-Co-B-based alloys, prepared by melt spinning and subsequent annealing, have been characterized structurally and magnetically. X-ray diffraction and thermomagnetic measurements show that the ribbons consist of tetragonal Ti3(Fe,Co5B2, FeCo-rich bcc, and NiAl-rich L21 phases; Ti3(Fe,Co5B2, is a new substitutional alloy series whose end members Ti3Co5B2 and Ti3Fe5B2 have never been investigated magnetically and may not even exist, respectively. Two compositions are considered, namely Ti11+xFe37.5-0.5xCo37.5−0.5xB14 (x = 0, 4 and alnico-like Ti11Fe26Co26Ni10Al11Cu2B14, the latter also containing an L21-type alloy. The volume fraction of the Ti3(Fe,Co5B2 phase increases with x, which leads to a coercivity increase from 221 Oe for x = 0 to 452 Oe for x = 4. Since the grains are nearly equiaxed, there is little or no shape anisotropy, and the coercivity is largely due to the magnetocrystalline anisotropy of the tetragonal Ti3(Fe,Co5B2 phase. The alloy containing Ni, Al, and Cu exhibits a magnetization of 10.6 kG and a remanence ratio of 0.59. Our results indicate that magnetocrystalline anisotropy can be introduced in alnico-like magnets, adding to shape anisotropy that may be induced by field annealing.

  20. Ultrafast demagnetization in rare-earth alloys: the role of spin-orbit coupling

    Energy Technology Data Exchange (ETDEWEB)

    Le Guyader, Loic; Solopow, Sergej; Radu, Florin; Holldack, Karsten; Mitzner, Rolf; Kachel, Torsten; Pontius, Niko; Foehlisch, Alexander; Radu, Ilie [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Berlin (Germany); Abrudan, Radu [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Berlin (Germany); Institut fuer Experimentalphysik/Festkoerperphysik, Ruhr-Universitaet Bochum (Germany)

    2015-07-01

    Understanding the ultrafast demagnetization occurring upon femtosecond laser excitation of a magnetic material is a fundamental problem of modern magnetism and its microscopic origin remains highly elusive and intensely debated. Particularly, the spin-orbit coupling mediating the spin-lattice interaction is one of the key ingredients. An intriguing case of tunable parallel to anti-parallel LS coupling can be realized in rare-earth (RE) alloys. For instance, Gd60Sm40 and Gd60Dy40 alloys have similar absolute S and L, but exhibit opposite LS coupling while displaying the same ferromagnetic ordering temperature of 250 K. They constitute thus an ideal case to investigate the particular role of the LS coupling on the ultrafast demagnetization. Here we report on the properties of such RE thin film alloys using X-ray Magnetic Circular Dichroism (XMCD) with the spin and orbit sum rules at M5,4 edges. Femtosecond time-resolved transmission XMCD measurements performed at the slicing beamline reveal the element-specific demagnetization time constant in these alloys. Funding from European Union through FEMTOSPIN is gratefully acknowledged.

  1. Enhanced Hydrogen Storage Kinetics of Nanocrystalline and Amorphous Mg₂Ni-type Alloy by Melt Spinning.

    Science.gov (United States)

    Zhang, Yang-Huan; Li, Bao-Wei; Ren, Hui-Ping; Li, Xia; Qi, Yan; Zhao, Dong-Liang

    2011-01-18

    Mg₂Ni-type Mg₂Ni 1-x Co x (x = 0, 0.1, 0.2, 0.3, 0.4) alloys were fabricated by melt spinning technique. The structures of the as-spun alloys were characterized by X-ray diffraction (XRD) and transmission electron microscopy (TEM). The hydrogen absorption and desorption kinetics of the alloys were measured by an automatically controlled Sieverts apparatus. The electrochemical hydrogen storage kinetics of the as-spun alloys was tested by an automatic galvanostatic system. The results show that the as-spun (x = 0.1) alloy exhibits a typical nanocrystalline structure, while the as-spun (x = 0.4) alloy displays a nanocrystalline and amorphous structure, confirming that the substitution of Co for Ni notably intensifies the glass forming ability of the Mg₂Ni-type alloy. The melt spinning treatment notably improves the hydriding and dehydriding kinetics as well as the high rate discharge ability (HRD) of the alloys. With an increase in the spinning rate from 0 (as-cast is defined as spinning rate of 0 m/s) to 30 m/s, the hydrogen absorption saturation ratio () of the (x = 0.4) alloy increases from 77.1 to 93.5%, the hydrogen desorption ratio () from 54.5 to 70.2%, the hydrogen diffusion coefficient (D) from 0.75 × 10 - 11 to 3.88 × 10 - 11 cm²/s and the limiting current density I L from 150.9 to 887.4 mA/g.

  2. Effect of the 718 alloy metallurgical status on hydrogen embrittlement; Effet de l'etat metallurgique de l'alliage 718 sur la fragilisation par l'hydrogene

    Energy Technology Data Exchange (ETDEWEB)

    Galvano, F.; Andrieu, E.; Blanc, Ch.; Odemer, G.; Ter-Ovanessian, B.; Cocheteau, N.; Holstein, A.; Reboul, Ch. [Universite de Toulouse, CIRIMAT, UPS/CNRS/INPT, 31 - Toulouse (France); Clouez, J.M. [AREVA NP 69 - Lyon (France)

    2010-03-15

    The Inconel 718 is a nickel superalloy which is widely used in the nuclear industry, but is sensitive to hydrogen embrittlement induced by corrosion and stress corrosion cracking phenomena, and by the presence of dissolved hydrogen in pressurized water reactor environments. As this alloy is hardened by precipitation of different intermetallic phases, it appeared that the presence of these precipitates has a strong influence on the hydrogen embrittlement. The authors report the study of the nature and effect of the different traps (intermetallic phases, carbides or their interfaces) on the hydrogen embrittlement susceptibility of the 718 alloy, and more particularly on the observed failure modes. Experiments are performed on tensile samples in which hydrogen content can be measured. The type and grain size of the observed microstructures are given with respect with the thermal treatment, as well as the mechanical properties with or without hydrogen loading

  3. Progressive degradation of alloy 690 and the development of a significant improvement in alloy 800CR

    International Nuclear Information System (INIS)

    Staehle, Roger W.; Arioka, Koji; Tapping, Robert

    2015-01-01

    The present most widely used alloys for tubing in steam generators and structural materials in water cooled reactors are Alloy 690 and Alloy 800. However, both alloys, while improved over Alloy 600 may not meet the needs of longer range applications in the range of 80-100 years. Alloy 690 sustains damage resulting from the formation of cavities at grain boundaries which eventually cover about 50% of the area of the grain boundaries with the remainder covering being covered with carbides. The cavities seem to nucleate on the carbides leaving the grain boundaries a structure of cavities and carbides. Such a structure will lead the Alloy 690 to fail completely. Normal Alloy 800 does not produce such cavities and probably retains a large amount of its corrosion resistance but does sustain progressive SCC at low rate. A new alloy, 800CR, has been developed in a collaboration among Arioka, Tapping, and Staehle. This alloy is based on a Cr composition of 23.5-27% with the remainder retaining the previous Alloy 800 composition. 800CR sustains a crack velocity about 100 times less than Alloy 690 and a negligible rate of initiation. The 800CR, alloy is now seeking a patent. (authors)

  4. Nonswelling alloy

    Science.gov (United States)

    Harkness, S.D.

    1975-12-23

    An aluminum alloy containing one weight percent copper has been found to be resistant to void formation and thus is useful in all nuclear applications which currently use aluminum or other aluminum alloys in reactor positions which are subjected to high neutron doses.

  5. Nonswelling alloy

    International Nuclear Information System (INIS)

    Harkness, S.D.

    1975-01-01

    An aluminum alloy containing one weight percent copper has been found to be resistant to void formation and thus is useful in all nuclear applications which currently use aluminum or other aluminum alloys in reactor positions which are subjected to high neutron doses

  6. Effect of Annealing on the Pitting Corrosion Resistance of Anodized Aluminum-Magnesium Alloy Processed by Equal Channel Angular Pressing

    Energy Technology Data Exchange (ETDEWEB)

    Son, In Joon; Nakano, Hiroaki; Oue, Satoshi; Fukushima, Hisaaki; Horita, Zenji [Kyushu University, Fukuoka (Japan); Kobayashi, Shigeo [Kyushu Sangyo University, Fukuoka (Japan)

    2007-12-15

    The effect of annealing on the pitting corrosion resistance of anodized Al-Mg alloy (AA5052) processed by equal-channel angular pressing (ECAP) was investigated by electrochemical techniques in a solution containing 0.2 mol/L of AlCl{sub 3} and also by surface analysis. The Al-Mg alloy was annealed at a fixed temperature between 473 and 573 K for 120 min in air after ECAP. Anodizing was conducted for 40 min at 100-400 A/m{sup 2} at 293 K in a solution containing 1.53 mol/L of H{sub 2}SO{sub 4} and 0.0185 mol/L of Al{sub 2}(SO{sub 4}){sub 3}. The internal stress generated in anodic oxide films during anodization was measured with a strain gauge to clarify the effect of ECAP on the pitting corrosion resistance of anodized Al-Mg alloy. The time required to initiate the pitting corrosion of anodized Al-Mg alloy was shorter in samples subjected to ECAP, indicating that ECAP decreased the pitting corrosion resistance. however, the pitting corrosion resistance was greatly improved by annealing after ECAP. The time required to initiate pitting corrosion increased with increasing annealing temperature. The strain gauge attached to Al-Mg alloy revealed that the internal stress present in the anodic oxide films was compressive stress, and that the stress was larger with ECAP than without. The compressive internal stress gradually decreased with increasing annealing temperature. Scanning electron microscopy showed that cracks occurred in the anodic oxide film on Al-Mg alloy during initial corrosion and that the cracks were larger with ECAP than without. The ECAP process of severe plastic deformation produces large internal stresses in the Al-Mg alloy: the stresses remain in the anodic oxide films, increasing the likelihood of cracks. it is assumed that the pitting corrosion is promoted by these cracks as a result of the higher internal stress resulting from ECAP. The improvement in the pitting corrosion resistance of anodized AlMg alloy as a result of annealing appears to be

  7. Effect of Annealing on the Pitting Corrosion Resistance of Anodized Aluminum-Magnesium Alloy Processed by Equal Channel Angular Pressing

    International Nuclear Information System (INIS)

    Son, In Joon; Nakano, Hiroaki; Oue, Satoshi; Fukushima, Hisaaki; Horita, Zenji; Kobayashi, Shigeo

    2007-01-01

    The effect of annealing on the pitting corrosion resistance of anodized Al-Mg alloy (AA5052) processed by equal-channel angular pressing (ECAP) was investigated by electrochemical techniques in a solution containing 0.2 mol/L of AlCl 3 and also by surface analysis. The Al-Mg alloy was annealed at a fixed temperature between 473 and 573 K for 120 min in air after ECAP. Anodizing was conducted for 40 min at 100-400 A/m 2 at 293 K in a solution containing 1.53 mol/L of H 2 SO 4 and 0.0185 mol/L of Al 2 (SO 4 ) 3 . The internal stress generated in anodic oxide films during anodization was measured with a strain gauge to clarify the effect of ECAP on the pitting corrosion resistance of anodized Al-Mg alloy. The time required to initiate the pitting corrosion of anodized Al-Mg alloy was shorter in samples subjected to ECAP, indicating that ECAP decreased the pitting corrosion resistance. however, the pitting corrosion resistance was greatly improved by annealing after ECAP. The time required to initiate pitting corrosion increased with increasing annealing temperature. The strain gauge attached to Al-Mg alloy revealed that the internal stress present in the anodic oxide films was compressive stress, and that the stress was larger with ECAP than without. The compressive internal stress gradually decreased with increasing annealing temperature. Scanning electron microscopy showed that cracks occurred in the anodic oxide film on Al-Mg alloy during initial corrosion and that the cracks were larger with ECAP than without. The ECAP process of severe plastic deformation produces large internal stresses in the Al-Mg alloy: the stresses remain in the anodic oxide films, increasing the likelihood of cracks. it is assumed that the pitting corrosion is promoted by these cracks as a result of the higher internal stress resulting from ECAP. The improvement in the pitting corrosion resistance of anodized AlMg alloy as a result of annealing appears to be attributable to a decrease in

  8. Part of the hydrogen in the intergranular crack by stress corrosion in primary circuit for the 600 and 690 nickel base alloys; Role de l'hydrogene dans le mecanisme de fissuration intergranulaire par corrosion sous contrainte en milieu primaire des alliages base nickel 600 et 690

    Energy Technology Data Exchange (ETDEWEB)

    Odemer, G.; Coudurier, A.; Jambon, F.; Chene, J. [CEA Saclay, Dept. de Physico-Chimie (DPC/SCCME/LECA), 91 - Gif sur Yvette (France); Odemer, G.; Coudurier, A.; Chene, J. [Evry Univ., UMR 8587 CNRS / CEA, LAMBE, 91 (France)

    2007-07-01

    The aim of this study is, in a first part, to characterize the hydrogen embrittlement sensitivity of the 600 and 690 based alloys in order to better understand the hydrogen role in the stress corrosion mechanism which appears in theses alloys in the primary circuit of the PWR type reactors. The authors studies how the hydrogen embrittlement is resulting from an interaction between the hydrogen and the plastic deformation. (A.L.B.)

  9. Electronic structure of metallic alloys through Auger and photoemission spectroscopy

    International Nuclear Information System (INIS)

    Kleiman, G.G.; Rogers, J.D.; Sundaram, V.S.

    1981-01-01

    A review is presented of experimental results of electron spectroscopy studies for various series of transition metal alloys as well as a model for their interpretation which leads to the possibility for the first time to determine independently relative variations in the dipole barrier and Fermi energy contributions to the work function. (L.C.) [pt

  10. PLUTONIUM-ZIRCONIUM ALLOYS

    Science.gov (United States)

    Schonfeld, F.W.; Waber, J.T.

    1960-08-30

    A series of nuclear reactor fuel alloys consisting of from about 5 to about 50 at.% zirconium (or higher zirconium alloys such as Zircaloy), balance plutonium, and having the structural composition of a plutonium are described. Zirconium is a satisfactory diluent because it alloys readily with plutonium and has desirable nuclear properties. Additional advantages are corrosion resistance, excellent fabrication propenties, an isotropie structure, and initial softness.

  11. Effect of high-temperature quenching on the magnetostructural transformations and the long-range atomic order of Ni–Mn–Sn and Ni–Mn–Sb metamagnetic shape memory alloys

    International Nuclear Information System (INIS)

    Sánchez-Alarcos, V.; Pérez-Landazábal, J.I.; Recarte, V.; Lucia, I.; Vélez, J.; Rodríguez-Velamazán, J.A.

    2013-01-01

    The influence of high-temperature thermal treatments on the martensitic transformation and the magnetic properties of Ni–Mn–Sn and Ni–Mn–Sb metamagnetic shape memory alloys have been investigated by calorimetric and magnetic measurements. Contrary to Ni–Mn–Ga and Ni–Mn–In systems, the martensitic transformation and Curie temperatures of Ni–Mn–Sn and Ni–Mn–Sb alloys are found to be unaffected by the increasing quenching temperature. Neutron diffraction measurements confirm the null effect of quenching on the next-nearest-neighbors atomic order due to the negligible L2 1 atomic disorder achieved with high-temperature annealings. The analysis of long-range order also suggests that no L2 1 –B2 ordering transition takes place in the studied alloys, thus indicating an unusually high stability of the L2 1 structure. The obtained results show that the magnetostructural properties of Ni–Mn–Sn and Ni–Mn–Sb alloys cannot be properly tuned by means of standard thermal treatments

  12. Contribution to the Study of the Relation between Microstructure and Electrochemical Behavior of Iron-Based FeCoC Ternary Alloys

    Directory of Open Access Journals (Sweden)

    Farida Benhalla-Haddad

    2012-01-01

    Full Text Available This work deals with the relation between microstructure and electrochemical behavior of four iron-based FeCoC ternary alloys. First, the arc-melted studied alloys were characterized using differential thermal analyses and scanning electron microscopy. The established solidification sequences of these alloys show the presence of two primary crystallization phases (δ(Fe and graphite as well as two univariante lines : peritectic L+(Fe↔(Fe and eutectic L↔(Fe+Cgraphite. The ternary alloys were thereafter studied in nondeaerated solution of 10−3 M NaHCO3 + 10−3 M Na2SO4, at 25°C, by means of the potentiodynamic technique. The results indicate that the corrosion resistance of the FeCoC alloys depends on the carbon amount and the morphology of the phases present in the studied alloys.

  13. Ultrahigh temperature intermetallic alloys

    Energy Technology Data Exchange (ETDEWEB)

    Brady, M.P.; Zhu, J.H.; Liu, C.T.; Tortorelli, P.F.; Wright, J.L.; Carmichael, C.A.; Walker, L.R. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.

    1997-12-01

    A new family of Cr-Cr{sub 2}X based alloys with fabricability, mechanical properties, and oxidation resistance superior to previously developed Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys has been identified. The new alloys can be arc-melted/cast without cracking, and exhibit excellent room temperature and high-temperature tensile strengths. Preliminary evaluation of oxidation behavior at 1100 C in air indicates that the new Cr-Cr{sub 2}X based alloys form an adherent chromia-based scale. Under similar conditions, Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys suffer from extensive scale spallation.

  14. Enhancing elevated temperature strength of copper containing aluminium alloys by forming L12 Al3Zr precipitates and nucleating θ″ precipitates on them.

    Science.gov (United States)

    Kumar Makineni, Surendra; Sugathan, Sandeep; Meher, Subhashish; Banerjee, Rajarshi; Bhattacharya, Saswata; Kumar, Subodh; Chattopadhyay, Kamanio

    2017-09-11

    Strengthening by precipitation of second phase is the guiding principle for the development of a host of high strength structural alloys, in particular, aluminium alloys for transportation sector. Higher efficiency and lower emission demands use of alloys at higher operating temperatures (200 °C-250 °C) and stresses, especially in applications for engine parts. Unfortunately, most of the precipitation hardened aluminium alloys that are currently available can withstand maximum temperatures ranging from 150-200 °C. This limit is set by the onset of the rapid coarsening of the precipitates and consequent loss of mechanical properties. In this communication, we present a new approach in designing an Al-based alloy through solid state precipitation route that provides a synergistic coupling of two different types of precipitates that has enabled us to develop coarsening resistant high-temperature alloys that are stable in the temperature range of 250-300 °C with strength in excess of 260 MPa at 250 °C.

  15. Composition-dependent properties and phase stability of Fe-Pd ferromagnetic shape memory alloys: A first-principles study

    Science.gov (United States)

    Li, Chun-Mei; Hu, Yan-Fei

    2017-12-01

    The composition-dependent properties and their correlation with the phase stability of Fe75+xPd25-x (- 10.0 ≤x ≤10.0 ) alloys are systematically investigated by using first-principles exact muffin-tin orbitals (EMTO)-coherent potential approximation (CPA) calculations. It is shown that the martensitic transformation (MT) from L 12 to body-centered-tetragonal (bct) occurs in the ordered alloys with about -5.0 ≤x ≤10.0 . In both the L 12 and bct phases, the evaluated a and c/a agree well with the available experimental data; the average magnetic moment per atom increases whereas the local magnetic moments of Fe atoms, dependent on both their positions and the structure of the alloy, decrease with increasing x. The tetragonal shear elastic constant of the L 12 phase ( C ' ) decreases whereas that of the bct phase (Cs) increases with x. The tetragonality of the martensite ( |1 -c /a | ) increases whereas its energy relative to the austenite with a negative value decreases with Fe addition. All these effects account for the increase of MT temperature (TM) with x. The MT from L 12 to bct is finally confirmed originating from the splitting of Fe 3d Eg and T2 g bands upon tetragonal distortion due to the Jahn-Teller effect.

  16. Electronic structure of alloys

    International Nuclear Information System (INIS)

    Ehrenreich, H.; Schwartz, L.M.

    1976-01-01

    The description of electronic properties of binary substitutional alloys within the single particle approximation is reviewed. Emphasis is placed on a didactic exposition of the equilibrium properties of the transport and magnetic properties of such alloys. Topics covered include: multiple scattering theory; the single band alloy; formal extensions of the theory; the alloy potential; realistic model state densities; the s-d model; and the muffin tin model. 43 figures, 3 tables, 151 references

  17. Monitoring alloy formation during mechanical alloying process by x-ray diffraction techniques

    International Nuclear Information System (INIS)

    Abdul Kadir Masrom; Noraizam Md Diah; Mazli Mustapha

    2002-01-01

    Monitoring alloying (MA) is a novel processing technique that use high energy impact ball mill to produce alloys with enhanced properties and microscopically homogeneous materials starting from various powder mixtures. Mechanical alloying process was originally developed to produce oxide dispersion strengthened nickel superalloys. In principal, in high-energy ball milling process, alloy is formed by the result of repeated welding, fracturing and rewelding of powder particles in a high energy ball mill. In this process a powder mixture in a ball mill is subjected to high-energy collisions among balls. MA has been shown to be capable of synthesizing a variety of materials. It is known to be capable to prepare equilibrium and non-equilibrium phases starting from blended elemental or prealloyed powders. The process ability to produce highly metastable materials such as amorphous alloys and nanostructured materials has made this process attractive and it has been considered as a promising material processing technique that could be used to produce many advanced materials at low cost. The present study explores the conditions under which aluminum alloys formation occurs by ball milling of blended aluminum and its alloying elements powders. In this work, attempt was made in producing aluminum 2024 alloys by milling of blended elemental aluminum powder of 2024 composition in a stainless steel container under argon atmosphere for up to 210 minutes. X-ray diffraction together with thermal analysis techniques has been used to monitor phase changes in the milled powder. Results indicate that, using our predetermined milling parameters, alloys were formed after 120 minutes milling. The thermal analysis data was also presented in this report. (Author)

  18. Effect of ternary alloying elements on the shape memory behavior of Ti-Ta alloys

    International Nuclear Information System (INIS)

    Buenconsejo, Pio John S.; Kim, Hee Young; Miyazaki, Shuichi

    2009-01-01

    The effect of ternary alloying elements (X = V, Cr, Fe, Zr, Hf, Mo, Sn, Al) on the shape memory behavior of Ti-30Ta-X alloys was investigated. All the alloying elements decreased the martensitic transformation temperatures. The decrease in the martensitic transformation start (M s ) temperature due to alloying was affected by the atomic size and number of valence electrons of the alloying element. A larger number of valence electrons and a smaller atomic radius of an alloying element decreased the M s more strongly. The effect of the alloying elements on suppressing the aging effect on the shape memory behavior was also investigated. It was found that the additions of Sn and Al to Ti-Ta were effective in suppressing the effect of aging on the shape memory behavior, since they strongly suppress the formation of ω phase during aging treatment. For this reason the Ti-30Ta-1Al and Ti-30Ta-1Sn alloys exhibited a stable high-temperature shape memory effect during thermal cycling.

  19. Microstructural evolution during dry wear test in magnesium and Mg-Y alloy

    Energy Technology Data Exchange (ETDEWEB)

    Somekawa, Hidetoshi, E-mail: SOMEKAWA.Hidetoshi@nims.go.jp [Research Center for Strategic Materials, National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan); Maeda, Shunsuke; Hirayama, Tomoko; Matsuoka, Takashi [Department of Mechanical Engineering, Doshisha University, 1-3 Miyakodani, Tatara, Kyotanabe 610-0321 (Japan); Inoue, Tadanobu [Research Center for Strategic Materials, National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan); Mukai, Toshiji [Department of Mechanical Engineering, Kobe University, 1-1 Rokkodai, Kobe, 657-8501 (Japan)

    2013-01-20

    The friction and wear properties of pure magnesium and the Mg-Y alloy were investigated using the pin-on-disk configuration. The friction and wear resistance of the Mg-Y alloy was superior to those of pure magnesium. The wear mechanism was abrasion under all the conditions. The deformed microstructural evolutions near the surface region were observed by transmission electron microscopy and electron backscatter diffraction. The stress and strain states were also evaluated by finite element analysis (FEA). The deformed microstructures of both alloys consisted of the {l_brace}10-12{r_brace} twinning formation and the FEA results showed the occurrence of plastic deformation even at the beginning of the test. The formation of low angle grain boundaries was also confirmed with an increase in the applied load in the Mg-Y alloy. On the other hand, grain refinement due to dynamic recrystallization was observed in pure magnesium as the wear test progressed. The different microstructures resulted from difference in the surface temperature during the wear test, which was estimated to be around 393 K and 363 K for pure magnesium and the Mg-Y alloy, respectively. The high increment temperature in the fine-grained alloys brought about the occurrence of grain boundary sliding, i.e., material softening, which led to a decrease in the friction and wear properties. The present results indicated that one of the methods for enhancing the friction and wear properties is to increase the dynamic recrystallization temperature.

  20. Resonant Ni and Fe KLL Auger spectra photoexcited from NiFe alloys

    International Nuclear Information System (INIS)

    Koever, L.; Cserny, I.; Berenyi, Z.; Egri, S.; Novak, M.

    2005-01-01

    Complete text of publication follows. KLL Auger spectra of 3d transition metal atoms in solid environment, measured using high energy resolution, give an insight into the details of the local electronic structure surrounding the particular atoms emitting the signal Auger electrons. Fine tuning the energy of the exciting monochromatic photons across the K-absorption edge, features characteristic to resonant phenomena can be identified in the spectra. The shapes of the resonantly photoexcited KLL Auger spectra induced from 3d transition metals and alloys are well interpreted by the single step model of the Auger process, based on the resonant scattering theory. The peak shapes are strongly influenced by the 4p partial density of unoccupied electronic states around the excited atom. High energy resolution studies of KLL Auger spectra of 3d transition metals using laboratory X-ray sources, however, request very demanding experiments and yield spectra of limited statistical quality making the evaluation of the fine details in the spectra difficult. The Tunable High Energy XPS (THE- XPS) instrument at BW2 offers optimum photon x and energy resolution for spectroscopy of deep core Auger transitions. For the present measurements high purity polycrystalline Ni and Fe sheets as well as NiFe alloy samples of different compositions (Ni 80 Fe 20 , Ni 50 Fe 50 , Ni 20 Fe 80 ) were used. The surfaces of the samples were cleaned by in-situ argon ion sputtering. The measurements of the Ni and Fe KL 23 L 23 Auger spectra of the metal and alloy samples were performed with the THE-XPS instrument using high electron energy resolution (0.2 eV). In Fig.1, the measured Fe KL 23 L 23 spectrum, photoexcited at the Fe K absorption edge from Fe metal, is compared with the respective spectrum excited from a Ni 50 Fe 50 alloy. A significant broadening of the 1 D 2 peak and an enhancement of the spectral intensity at the low energy loss part of this peak observed in the alloy sample, while the

  1. The suppression of dissolution for alloy 690 in high temperature and high pressure water with chromium ion implantation

    International Nuclear Information System (INIS)

    Shibata, Toshio; Fujimoto, Shinji; Ohtani, Saburou; Watanabe, Masanori; Hirao, Kyozo; Okumoto, Masaru; Shibaike, Hiroyuki.

    1994-01-01

    As the material of heat exchanger tubes for PWRs, the nickel alloys such as alloy 690 and alloy 600 have been used, but 58 Ni and 60 Co contained as an impurity elute in primary cooling water, and are radioactivated, in this way, they become the cause of radiation exposure. By increasing chromium concentration, the corrosion resistance of nickel alloys is improved, and for modern heat exchangers, the alloy 690, of which the chromium content is increased up to 30%, has been adopted, and excellent results have been obtained. In this research, aiming at the further reduction of radiation exposure, by increasing the chromium concentration in surface layer using ion implantation technology, the change of the corrosion behavior of alloy 690 in high temperature, high pressure water was investigated. The chemical composition of the alloy 690 used, and the making of plate specimens are shown. The polarization behavior of alloy 690 in 0.1 mol/l sulfuric acid deaerated at normal temperature is reported, and the effect of suppressing dissolution was remarkable in the specimens with much implantation. The electrochemical behavior of alloy 690 in simulated cooling water was investigated. Immobile case has high chromium content and is thin. (K.I.)

  2. NSV 11749, AN ELDER SIBLING OF THE BORN-AGAIN STARS V605 Aql AND V4334 Sgr?

    Energy Technology Data Exchange (ETDEWEB)

    Miller Bertolami, M. M.; Althaus, L. G. [Facultad de Ciencias Astronomicas y Geofisicas, Universidad Nacional de La Plata, Paseo del Bosque s/n, 1900 La Plata (Argentina); Rohrmann, R. D. [Instituto de Ciencias Astronomicas, de la Tierra y del Espacio, CONICET, Av. de Espana 1512 (Sur) CC 49, 5400 San Juan (Argentina); Granada, A., E-mail: mmiller@fcaglp.unlp.edu.ar [Observatoire Astronomique de l' Universite de Geneve 51, Chemin des Maillettes, CH-1290, Sauverny (Switzerland)

    2011-12-20

    We argue that NSV 11749, an eruption observed in the early twentieth century, was a rare event known as 'very late thermal pulse' (VLTP). To support our argument we compare the light curve of NSV 11749 with those of the two bona fide VLTP objects known to date, V4334 Sgr and V605 Aql, and with those predicted by state-of-the-art stellar evolution models. Next, we explore the INT Photometric H-Alpha Survey (IPHAS) and Two Micron All Sky Survey (2MASS) catalogs for possible counterparts of the eruption. Our analysis shows that the VLTP scenario outperforms all other proposed scenarios as an explanation of NSV 11749. We identify an IPHAS/2MASS source at the eruption location of NSV 11749. The derived colors suggest that the object is not enshrouded in a thick dust shell as V605 Aql and V4334 Sgr. Also, the absence of an apparent planetary nebula at the eruption location suggests differences with known VLTP objects which might be linked to the intensity of the eruption and the mass of the object. Further exploration of this source and scenario seems desirable. If NSV 11749 was a born-again star, it would be the third event of its kind to have been observed and will strongly help us to increase our understanding of the later stages of stellar evolution and violent reactive convective burning.

  3. NSV 11749, AN ELDER SIBLING OF THE BORN-AGAIN STARS V605 Aql AND V4334 Sgr?

    International Nuclear Information System (INIS)

    Miller Bertolami, M. M.; Althaus, L. G.; Rohrmann, R. D.; Granada, A.

    2011-01-01

    We argue that NSV 11749, an eruption observed in the early twentieth century, was a rare event known as 'very late thermal pulse' (VLTP). To support our argument we compare the light curve of NSV 11749 with those of the two bona fide VLTP objects known to date, V4334 Sgr and V605 Aql, and with those predicted by state-of-the-art stellar evolution models. Next, we explore the INT Photometric H-Alpha Survey (IPHAS) and Two Micron All Sky Survey (2MASS) catalogs for possible counterparts of the eruption. Our analysis shows that the VLTP scenario outperforms all other proposed scenarios as an explanation of NSV 11749. We identify an IPHAS/2MASS source at the eruption location of NSV 11749. The derived colors suggest that the object is not enshrouded in a thick dust shell as V605 Aql and V4334 Sgr. Also, the absence of an apparent planetary nebula at the eruption location suggests differences with known VLTP objects which might be linked to the intensity of the eruption and the mass of the object. Further exploration of this source and scenario seems desirable. If NSV 11749 was a born-again star, it would be the third event of its kind to have been observed and will strongly help us to increase our understanding of the later stages of stellar evolution and violent reactive convective burning.

  4. Ballistic Characterization of the Scalability of Magnesium Alloy AMX602

    Science.gov (United States)

    2015-07-01

    Magnesium Alloy AMX602 by Tyrone L Jones Weapons and Materials Research Directorate, ARL Katsuyoshi Kondoh Joining and Welding Research...formed a collaborative partnership with Osaka University Joining and Welding Research Institute (JWRI), Taber Extrusions, Epson Atmix, Pacific Sowa...Powder Metallurgy 4 5. Fabrication Procedure 4 6. Mechanical Property Analysis 5 7. Ballistic Experimental Procedures 6 8. Ballistic Experimental

  5. INVESTIGATION OF MAGNESIUM ALLOYS MACHINABILITY

    Directory of Open Access Journals (Sweden)

    Berat Barıs BULDUM

    2013-01-01

    Full Text Available Magnesium is the lightest structural metal. Magnesium alloys have a hexagonal lattice structure, which affects the fundamental properties of these alloys. Plastic deformation of the hexagonal lattice is more complicated than in cubic latticed metals like aluminum, copper and steel. Magnesium alloy developments have traditionally been driven by industry requirements for lightweight materials to operate under increasingly demanding conditions. Magnesium alloys have always been attractive to designers due to their low density, only two thirds that of aluminium and its alloys [1]. The element and its alloys take a big part of modern industry needs. Especially nowadays magnesium alloys are used in automotive and mechanical (trains and wagons manufacture, because of its lightness and other features. Magnesium and magnesium alloys are the easiest of all metals to machine, allowing machining operations at extremely high speed. All standard machining operations such as turning, drilling, milling, are commonly performed on magnesium parts.

  6. Characteristics of Film Formed on Alloy 600 and Alloy 690 in Water Containing lead

    International Nuclear Information System (INIS)

    Hwang Seong Sik; Lee, Deok Hyun; Kim, Hong Pyo; Kim, Joung Soo; Kim, Ju Yup

    1999-01-01

    Anodic polarization behaviors of Alloy 600 and Alloy 690 have been studied as a function of lead content in the solution of pH 4 and 10 at 90 .deg. C. As the amount of lead in the solution increased, critical current densities and passive current densities of Alloy 600 and Alloy 690 increased, while the breakdown potential of the alloys decreased. The high critical current density in the high lead solution was thought to come from the combination of an enhanced dissolution of constituents on the surface of the alloys by the lead and an anodic dissolution of metallic lead deposited on the surface of the specimens. The morphology of lead precipitated on the specimen after the anodic scan changed with the pH of solution: small irregular particles were precipitated on the surface of the specimen in the solution of pH 4, while the high density of regular sized particles was formed on it in the solution of pH 10.Pb was observed to enhance Cr depletion from the outer surface of Alloy 600 and Alloy 690 and also to increase the ratio of O 2- /OH - in the surface film formed in the high lead solution. The SCC resistance of Alloy 600 and Alloy 690 may have decreased due to the poor quality of the passive film formed and the enhanced oxygen evolution in the solution containing lead

  7. Grain refining mechanism of Al-containing Mg alloys with the addition of Mn-Al alloys

    International Nuclear Information System (INIS)

    Qin, Gaowu W.; Ren Yuping; Huang Wei; Li Song; Pei Wenli

    2010-01-01

    Graphical abstract: Display Omitted Research highlights: The ε-AlMn phase acts as the heterogeneous nucleus of α-Mg phase during the solidification of the AZ31 Mg alloy, not the γ-Al 8 Mn 5 phase. The grain refinement effect is very clear with the addition of only 0.5 wt% Mn-28Al alloy (pure ε-AlMn). The grain refinement does not deteriorate up to the holding time of 60 min at 740 o C. - Abstract: The effect of manganese on grain refinement of Al-containing AZ31 Mg alloy has been investigated by designing a series of Mn-Al alloys composed of either pure ε-AlMn, γ 2 -Al 8 Mn 5 or both of them using optical microscopy and X-ray diffraction. It is experimentally clarified that the grain refinement of the AZ31 Mg alloy is due to the existence of the ε-AlMn phase in the Mn-Al alloys, not the γ 2 -Al 8 Mn 5 phase. The grain size of AZ31 Mg alloy is about 91 μm without any addition of Mn-Al alloys, but remarkably decreases to ∼55 μm with the addition of either Mn-34 wt% Al or Mn-28 wt% Al. With a minor addition of 0.5 wt% Mn-28Al alloy, the grain size of AZ31 alloy decreases to ∼53 μm, and the Mn-28Al alloy can be active as grain refiner for holding time up to 60 min for the melt AZ31 alloy at 750 o C.

  8. Spatial Bimetallic Castings Manufactured from Iron Alloys

    Directory of Open Access Journals (Sweden)

    M. Cholewa

    2007-07-01

    Full Text Available In this paper a conception for manufacturing method of skeleton castings with composite features was shown. Main application of such castings are the working organs of machines subjected to intensive abrasive and erosive wear. Skeleton geometry was based on three-dimensional cubic net consisting of circular connectors and nodes joining 6 connectors according to Cartesian co-ordinate system. Dimension of an elementary cell was equal to 10 mm and diameter of single connector was equal to 5 mm. For bimetallic castings preparation two Fe based alloys were used: L25SHMN cast steel for skeleton substrate and ZlCr15NiMo cast iron for working part of the casting. In presented work obtained structure was analyzed with indication of characteristic regions. Authors described phenomena occurring at the alloys interface and phases in transition zone. A thesis was formulated concerning localization of transition zone at the cast iron matrix – cast steel reinforcement interface. Direction of further studies were indicated.

  9. Synthesis of Amorphous Powders of Ni-Si and Co-Si Alloys by Mechanical Alloying

    Science.gov (United States)

    Omuro, Keisuke; Miura, Harumatsu

    1991-05-01

    Amorphous powders of the Ni-Si and Co-Si alloys are synthesized by mechanical alloying (MA) from crystalline elemental powders using a high energy ball mill. The alloying and amorphization process is examined by X-ray diffraction, differential scanning calorimetry (DSC), and scanning electron microscopy. For the Ni-Si alloy, it is confirmed that the crystallization temperature of the MA powder, measured by DSC, is in good agreement with that of the powder sample prepared by mechanical grinding from the cast alloy ingot products of the same composition.

  10. Radiation damage simulation studies of selected austenitic and ferritic/martensitic alloys for fusion reactor structural applications

    International Nuclear Information System (INIS)

    Mazey, D.J.; Walters, G.P.; Buckley, S.N.; Bullough, R.; Hanks, W.; Bolster, D.E.J.; Sowden, B.C.; Lurcook, D.; Murphy, S.M.

    1985-03-01

    Results are given of an investigation of the radiation damage stability of selected austenitic and ferritic alloys following ion bombardment in the Harwell VEC to simulate fusion-reactor exposures up to 110 dpa at temperatures from 425 deg to 625 deg C. Gas production rates appropriate to CTR conditions were simulated using a mixed beam of (4 MeV He + 2 MeV H 2 ) in the ratio 1:4 He:H. A beam of 46 MeV Ni or 20 MeV Cr ions was used in sequence with the mixed gas beam to provide a gas/damage ratio of 13 appm He/dpa at a damage rate of approx. 1 dpa/hr. The materials were investigated using TEM and comprised three austenitic alloys: European reference 316L, 316-Ti, 316-Nb; four high-nickel alloys: Fe/25 Ni/8Cr, Inconel 625, Inconel 706 and Nimonic PE16, and four ferritic/martensitic alloys: FV 448, FV 607, CRM 12 and FI. Some data were obtained for a non-magnetic structural alloy Nonmagne-30. The swelling behaviour is reported. The overall results of the study indicate that on a comparative basis the ferritic alloys are the most swelling-resistant, whilst the high-nickel alloys have an acceptable low swelling response up to 110 dpa. The 316 alloys tested have shown an unfavourable swelling response. (author)

  11. Structure, mechanical properties, corrosion behavior and cytotoxicity of biodegradable Mg-X (X=Sn, Ga, In) alloys.

    Science.gov (United States)

    Kubásek, J; Vojtěch, D; Lipov, J; Ruml, T

    2013-05-01

    As-cast Mg-Sn, Mg-Ga and Mg-In alloys containing 1-7 wt.% of alloying elements were studied in this work. Structural and chemical analysis of the alloys was performed by using light and scanning electron microscopy, energy dispersive spectrometry, x-ray diffraction, x-ray photoelectron spectroscopy and glow discharge spectrometry. Mechanical properties were determined by Vickers hardness measurements and tensile testing. Corrosion behavior in a simulated physiological solution (9 g/l NaCl) was studied by immersion tests and potentiodynamic measurements. The cytotoxicity effect of the alloys on human osteosarcoma cells (U-2 OS) was determined by an indirect contact assay. Structural investigation revealed the dendritic morphology of the as-cast alloys with the presence of secondary eutectic phases in the Mg-Sn and Mg-Ga alloys. All the alloying elements showed hardening and strengthening effects on magnesium. This effect was the most pronounced in the case of Ga. All the alloying elements at low concentrations of approximately 1 wt.% were also shown to positively affect the corrosion resistance of Mg. But at higher concentrations of Ga and Sn the corrosion resistance worsened due to galvanic effects of secondary phases. Cytotoxicity tests indicated that Ga had the lowest toxicity, followed by Sn. The most severe toxicity was observed in the case of In. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Formation and characterization of Al–Ti–Nb alloys by electron-beam surface alloying

    Energy Technology Data Exchange (ETDEWEB)

    Valkov, S., E-mail: stsvalkov@gmail.com [Institute of Electronics, Bulgarian Academy of Science, 72 Tzarigradsko Chaussee blvd., 1784 Sofia (Bulgaria); Petrov, P. [Institute of Electronics, Bulgarian Academy of Science, 72 Tzarigradsko Chaussee blvd., 1784 Sofia (Bulgaria); Lazarova, R. [Institute of Metal Science, Equipment and Technologies with Hydro and Aerodynamics Center, Bulgarian Academy of Science, 67 Shipchenski Prohod blvd., 1574 Sofia (Bulgaria); Bezdushnyi, R. [Department of Solid State Physics and Microelectronics, Faculty of Physics, Sofia University “St. Kliment Ohridsky”, 1164 Sofia (Bulgaria); Dechev, D. [Institute of Electronics, Bulgarian Academy of Science, 72 Tzarigradsko Chaussee blvd., 1784 Sofia (Bulgaria)

    2016-12-15

    Highlights: • Al–Ti–Nb surface alloys have been successfully obtained by electron-beam surface alloying technology. • The alloys consist of (Ti,Nb)Al{sub 3} fractions, distributed in the biphasic structure of (Ti,Nb)Al{sub 3} particles dispersed in α-Al. • The alloying speed does not affect the lattice parameters of (Ti,Nb)Al{sub 3} and, does not form additional stresses, strains etc. • It was found that lower velocity of the specimen motion during the alloying process develops more homogeneous structures. • The measured hardness of (Ti,Nb)Al{sub 3} compound reaches 775 HV[kg/cm{sup 2}] which is much greater than the values of NbAl{sub 3}. - Abstract: The combination of attractive mechanical properties, light weight and resistance to corrosion makes Ti-Al based alloys applicable in many industrial branches, like aircraft and automotive industries etc. It is known that the incorporation of Nb improves the high temperature performance and mechanical properties. In the present study on Al substrate Ti and Nb layers were deposited by DC (Direct Current) magnetron sputtering, followed by electron-beam alloying with scanning electron beam. It was chosen two speeds of the specimen motion during the alloying process: V{sub 1} = 0.5 cm/s and V{sub 2} = 1 cm/s. The alloying process was realized in circular sweep mode in order to maintain the melt pool further. The obtained results demonstrate a formation of (Ti,Nb)Al{sub 3} fractions randomly distributed in biphasic structure of intermetallic (Ti,Nb)Al{sub 3} particles, dispersed in α-Al solid solution. The evaluated (Ti,Nb)Al{sub 3} lattice parameters are independent of the speed of the specimen motion and therefore the alloying speed does not affect the lattice parameters and thus, does not form additional residual stresses, strains etc. It was found that lower velocity of the specimen motion during the alloying process develops more homogeneous structures. The metallographic analyses demonstrate a

  13. Study of the reaction D(p,π+)T at T/sub p/ = 410, 605, and 809 MeV

    International Nuclear Information System (INIS)

    Aslanides, E.; Bertini, R.; Bing, O.; Brochard, F.; Gorodetzky, P.; Hibou, F.; Bauer, T.S.; Beurtey, R.; Boudard, A.; Bruge, G.; Catz, H.; Chaumeaux, A.; Couvert, P.; Duhm, H.H.; Garreta, D.; Igo, G.; Lugol, J.C.; Matoba, M.; Terrien, Y.; Bimbot, L.; Le Bornec, Y.; Tatischeff, B.

    1977-01-01

    Pion production on a CD 2 target has been measured using the high-resolution magnetic spectrometer SPES I. Differential cross section for the reaction D(p,π + )T have been determined at T/sub p/ = 410, 605, and 809 MeV. The present data, together with previous results establish a complete angular distribution of the reaction D(p,π + )T at approx. 600 MeV and energy dependence of the differential cross section for this reaction at several constant momentum transfers

  14. Effects of alloying elements on thermal desorption of helium in Ni alloys

    International Nuclear Information System (INIS)

    Xu, Q.; Cao, X.Z.; Sato, K.; Yoshiie, T.

    2012-01-01

    It is well known that the minor elements Si and Sn can suppress the formation of voids in Ni alloys. In the present study, to investigate the effects of Si and Sn on the retention of helium in Ni alloys, Ni, Ni–Si, and Ni–Sn alloys were irradiated by 5 keV He ions at 723 K. Thermal desorption spectroscopy (TDS) was performed at up to 1520 K, and microstructural observations were carried out to identify the helium trapping sites during the TDS analysis. Two peaks, at 1350 and 1457 K, appeared in the TDS spectrum of Ni. On the basis of the microstructural observations, the former peak was attributed to the release of trapped helium from small cavities and the latter to its release from large cavities. Small-cavity helium trapping sites were also found in the Ni–Si and Ni–Sn alloys, but no large cavities were observed in these alloys. In addition, it was found that the oversized element Sn could trap He atoms in the Ni–Sn alloy.

  15. Effects of alloying elements on thermal desorption of helium in Ni alloys

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Q., E-mail: xu@rri.kyoto-u.ac.jp [Research Reactor Institute, Kyoto University, Osaka 590-0494 (Japan); Cao, X.Z.; Sato, K.; Yoshiie, T. [Research Reactor Institute, Kyoto University, Osaka 590-0494 (Japan)

    2012-12-15

    It is well known that the minor elements Si and Sn can suppress the formation of voids in Ni alloys. In the present study, to investigate the effects of Si and Sn on the retention of helium in Ni alloys, Ni, Ni-Si, and Ni-Sn alloys were irradiated by 5 keV He ions at 723 K. Thermal desorption spectroscopy (TDS) was performed at up to 1520 K, and microstructural observations were carried out to identify the helium trapping sites during the TDS analysis. Two peaks, at 1350 and 1457 K, appeared in the TDS spectrum of Ni. On the basis of the microstructural observations, the former peak was attributed to the release of trapped helium from small cavities and the latter to its release from large cavities. Small-cavity helium trapping sites were also found in the Ni-Si and Ni-Sn alloys, but no large cavities were observed in these alloys. In addition, it was found that the oversized element Sn could trap He atoms in the Ni-Sn alloy.

  16. Effects of alloying elements on thermal desorption of helium in Ni alloys

    Science.gov (United States)

    Xu, Q.; Cao, X. Z.; Sato, K.; Yoshiie, T.

    2012-12-01

    It is well known that the minor elements Si and Sn can suppress the formation of voids in Ni alloys. In the present study, to investigate the effects of Si and Sn on the retention of helium in Ni alloys, Ni, Ni-Si, and Ni-Sn alloys were irradiated by 5 keV He ions at 723 K. Thermal desorption spectroscopy (TDS) was performed at up to 1520 K, and microstructural observations were carried out to identify the helium trapping sites during the TDS analysis. Two peaks, at 1350 and 1457 K, appeared in the TDS spectrum of Ni. On the basis of the microstructural observations, the former peak was attributed to the release of trapped helium from small cavities and the latter to its release from large cavities. Small-cavity helium trapping sites were also found in the Ni-Si and Ni-Sn alloys, but no large cavities were observed in these alloys. In addition, it was found that the oversized element Sn could trap He atoms in the Ni-Sn alloy.

  17. Characterization of Microstructure and Mechanical Properties of Mg-Y-Zn Alloys with Respect to Different Content of LPSO Phase

    Czech Academy of Sciences Publication Activity Database

    Horváth, Klaudia; Drozdenko, D.; Daniš, S.; Garces, G.; Máthis, K.; Kim, S.; Dobroň, P.

    2018-01-01

    Roč. 20, č. 1 (2018), č. článku 1700396. ISSN 1438-1656 R&D Projects: GA MŠk EF16_013/0001794 Institutional support: RVO:61389005 Keywords : acoustic emission * alloying elements * LPSO phase * magnesium alloys * mechanical properties Subject RIV: JJ - Other Materials OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.319, year: 2016

  18. High-Strength Low-Alloy (HSLA) Mg-Zn-Ca Alloys with Excellent Biodegradation Performance

    Science.gov (United States)

    Hofstetter, J.; Becker, M.; Martinelli, E.; Weinberg, A. M.; Mingler, B.; Kilian, H.; Pogatscher, S.; Uggowitzer, P. J.; Löffler, J. F.

    2014-04-01

    This article deals with the development of fine-grained high-strength low-alloy (HSLA) magnesium alloys intended for use as biodegradable implant material. The alloys contain solely low amounts of Zn and Ca as alloying elements. We illustrate the development path starting from the high-Zn-containing ZX50 (MgZn5Ca0.25) alloy with conventional purity, to an ultrahigh-purity ZX50 modification, and further to the ultrahigh-purity Zn-lean alloy ZX10 (MgZn1Ca0.3). It is shown that alloys with high Zn-content are prone to biocorrosion in various environments, most probably because of the presence of the intermetallic phase Mg6Zn3Ca2. A reduction of the Zn content results in (Mg,Zn)2Ca phase formation. This phase is less noble than the Mg-matrix and therefore, in contrast to Mg6Zn3Ca2, does not act as cathodic site. A fine-grained microstructure is achieved by the controlled formation of fine and homogeneously distributed (Mg,Zn)2Ca precipitates, which influence dynamic recrystallization and grain growth during hot forming. Such design scheme is comparable to that of HSLA steels, where low amounts of alloying elements are intended to produce a very fine dispersion of particles to increase the material's strength by refining the grain size. Consequently our new, ultrapure ZX10 alloy exhibits high strength (yield strength R p = 240 MPa, ultimate tensile strength R m = 255 MPa) and simultaneously high ductility (elongation to fracture A = 27%), as well as low mechanical anisotropy. Because of the anodic nature of the (Mg,Zn)2Ca particles used in the HSLA concept, the in vivo degradation in a rat femur implantation study is very slow and homogeneous without clinically observable hydrogen evolution, making the ZX10 alloy a promising material for biodegradable implants.

  19. The influence of alloy composition on residual stresses in heat treated aluminium alloys

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, J.S., E-mail: jeremy.robinson@ul.ie [Department of Mechanical, Aeronautical and Biomedical Engineering, University of Limerick (Ireland); Redington, W. [Materials and Surface Science Institute, University of Limerick (Ireland)

    2015-07-15

    The as quenched properties of eight different heat treatable aluminium alloys are related to residual stress magnitudes with the objective being to establish if there is a relationship between the residual stress and the as quenched alloy hardness and strength. Near surface residual stresses were assessed with X-ray diffraction using both the established sin{sup 2}ψ method and the more recent cos α technique. Through thickness residual stresses were also characterised using neutron diffraction. The alloys were chosen to encompass a wide range of strengths. The low to medium strength alloys were 6060 and 6082, medium to high strength 2618A, 2014A, 7075, 7010 and two variants of 7449, while the very high strength alloy was the powder metallurgy alloy N707. To assess the as quenched strength, dynamic hardness and tensile properties were determined from samples tested immediately after quenching to minimise the influence of precipitation hardening by natural aging. In addition, hot hardness measurements were made in situ on samples cooled to simulate quench paths. Within the experimental constraints of the investigation, the distribution of residual stress through the thickness was found to follow the same pattern for all the alloys investigated, varying from tensile in the interior to surface compression. The influence of alloy strength was manifested as a change in the observed residual stress magnitudes, and surface residual stresses were found to vary linearly with as quenched hardness and strength. - Highlights: • As quenched aluminium alloys contain high magnitude residual stresses. • Surface is compressive balance by a tensile core. • As quenched surface residual stress is linear function of alloy strength. • In situ hot hardness demonstrates rapid change in intrinsic hardness during rapid cooling.

  20. WC-3015 alloy (high-temperature alloy)

    International Nuclear Information System (INIS)

    Anon.

    1974-01-01

    WC-3015 Nb alloy containing 28 to 30 Hf, 1 to 2 Zr, 13 to 16 W, 0 to 4 Ta, 0 to 5 Ti, 0.07 to 0.33 C, less than or equal to 0.02 N, less than or equal to 0.03 O, less than or equal to 0.001 H was developed for use at high temperature in oxidizing environments. Its composition can be tailored to meet specific requirements. When WC-3015 is exposed to O at elevated temperature, Hf and Nb oxidized preferentially and HfO 2 dissolves in Nb 2 O 5 to form 6HfO-Nb 2 O 5 . This complex oxide has a tight cubic lattice which resists the diffusion of O into the substrate. During 24-h exposure to air at 2400 0 F, the alloy oxidizes to a depth of approximately 0.035 in. with a surface recession of 0 to 0.004 in. Oxidation resistance of WC-3015 welds and base material can be further enhanced greatly by applying silicide coatings. WC-3015 alloy can be machined by conventional and electrical-discharge methods. It can be hot worked readily by extrusion, forging or rolling. Cold working can be used at room or elevated temperature. It can be welded by the electron-beam or Tig processes. Physical constants, typical mechanical properties at 75 to 2400 0 F, and effects of composition and heat treatment on tensile and stress-rupture properties of the alloy are tabulated

  1. Effect of cerium addition on the corrosion behaviour of carbon-alloyed iron aluminides

    International Nuclear Information System (INIS)

    Sriram, S.; Balasubramaniam, R.; Mungole, M.N.; Bharagava, S.; Baligidad, R.G.

    2006-01-01

    The effect of Ce addition on the microstructure and corrosion behavior of carbon-alloyed iron aluminides Fe-20.0Al-2.0C, Fe-18.5Al-3.6C and Fe-19.2Al-3.3C-0.07Ce (in at.%) has been studied. The potentiodynamic polarization behaviour of the alloys was evaluated in freely aerated 0.25 mol/l H 2 SO 4 . A 0.05% C steel was used for comparison purposes. All the alloys exhibited active-passive behaviour in the acidic solution. The addition of Ce destroyed passivity as indicated by lower breakdown potentials in polarization studies. This has been related to the finer distribution of the carbides in the microstructure. Corrosion rates were evaluated by immersion testing. The iron aluminide with Ce addition exhibited a lower corrosion rate compared to the aluminides without Ce addition. This has been attributed to modifications in surface film with Ce addition. Scanning electron microscopy of corroded surfaces indicated that the carbon-alloyed intermetallics were susceptible to localized galvanic corrosion due to the presence of carbides in the microstructure

  2. A sulfidation-resistant nickel-base alloy

    International Nuclear Information System (INIS)

    Lai, G.Y.

    1989-01-01

    For applications in mildly to moderately sulfidizing environments, stainless steels, Fe-Ni-Cr alloys (e.g., alloys 800 and 330), and more recently Fe-Ni-Cr-Co alloys (e.g., alloy 556) are frequently used for construction of process equipment. However, for many highly sulfidizing environments, few existing commercial alloys have adequate performance. Thus, a new nickel-based alloy containing 27 wt.% Co, 28 wt.% Cr, 4 wt.% Fe, 2.75 wt.% Si, 0.5 wt.% Mn and 0.05 wt.% C (Haynes alloy HR-160) was developed

  3. Irradiation assisted stress corrosion cracking of HTH Alloy X-750 and Alloy 625

    International Nuclear Information System (INIS)

    Mills, W.J.; Lebo, M.R.; Bajaj, R.; Kearns, J.J.; Hoffman, R.C.; Korinko, J.J.

    1994-01-01

    In-reactor testing of bolt-loaded precracked compact tension specimens was performed in 360 degree C water to determine effect of irradiation on the SCC behavior of HTH Alloy X-750 and direct aged Alloy 625. Out-of-flux and autoclave control specimens provided baseline data. Primary test variables were stress intensity factor, fluence, chemistry, processing history, prestrain. Results for the first series of experiments were presented at a previous conference. Data from two more recent experiments are compared with previous results; they confirm that high irradiation levels significantly reduce SCC resistance in HTH Alloy X-750. Heat-to-heat differences in IASCC were related to differences in boron content, with low boron heats showing improved SCC resistance. The in-reactor SCC performance of Alloy 625 was superior to that for Alloy X-750, as no cracking was observed in any Alloy 625 specimens even though they were tested at very high K 1 and fluence levels. A preliminary SCC usage model developed for Alloy X-750 indicates that in-reactor creep processes, which relax stresses but also increase crack tip strain rates, and radiolysis effects accelerate SCC. Hence, in-reactor SCC damage under high flux conditions may be more severe than that associated with postirradiation tests. In addition, preliminary mechanism studies were performed to determine the cause of IASCC In Alloy X-750

  4. Improvement of magnetocaloric properties of Gd-Ge-Si alloys by alloying with iron

    Directory of Open Access Journals (Sweden)

    Erenc-Sędziak T.

    2013-01-01

    Full Text Available The influence of annealing of Gd5Ge2Si2Fex alloys at 1200°C and of alloying with various amount of iron on structure as well as thermal and magnetocaloric properties is investigated. It was found that annealing for 1 to 10 hours improves the entropy change, but reduces the temperature of maximum magnetocaloric effect by up to 50 K. Prolonged annealing of the Gd5Ge2Si2 alloy results in the decrease of entropy change due to the reduction of Gd5Ge2Si2 phase content. Addition of iron to the ternary alloy enhances the magnetocaloric effect, if x = 0.4 – 0.6, especially if alloying is combined with annealing at 1200°C: the peak value of the isothermal entropy change from 0 to 2 T increases from 3.5 to 11 J/kgK. Simultaneously, the temperature of maximum magnetocaloric effect drops to 250 K. The changes in magnetocaloric properties are related to the change in phase transformation from the second order for arc molten ternary alloy to first order in the case of annealed and/or alloyed with iron. The results of this study indicate that the minor addition of iron and heat treatment to Gd-Ge-Si alloys may be useful in improving the materials’ magnetocaloric properties..

  5. Formation of vacancies in thermal equilibrium in α-range alloys

    International Nuclear Information System (INIS)

    Hehenkamp, Th.

    1982-01-01

    A model for aggregates (complexes) between vacancies and one or more impurity atoms is described for nearest neighbor interactions. Binding enthalpies in the different complexes have been unambigeously derived therefrom employing a variety of experimental techniques for the determination of vacancy concentrations as function of composition and temperature, (resistivity, positron annihilation, calorimetry, dl/l - da/a techniques), for some noble metals alloys. Solvent diffusion in these alloys has been found to be essentially governed by the increase of vacancy concentrations as function of these variables. Approximation for changes in the migration and correlation permits one to obtain the different binding enthalpies from measurements of solvent diffusion enhancement in an independent fashion and gives comparable results to the former techniques. (author)

  6. Non-equiatomic high entropy alloys: Approach towards rapid alloy screening and property-oriented design

    Energy Technology Data Exchange (ETDEWEB)

    Pradeep, K.G. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Materials Chemistry, RWTH Aachen University, Kopernikusstr.10, 52074 Aachen (Germany); Tasan, C.C., E-mail: c.tasan@mpie.de [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Yao, M.J. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Deng, Y. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Department of Engineering Design and Materials, Norwegian University of Science and Technology, No-7491 Trondheim (Norway); Springer, H. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Raabe, D., E-mail: d.raabe@mpie.de [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany)

    2015-11-11

    The high entropy alloy (HEA) concept has triggered a renewed interest in alloy design, even though some aspects of the underlying thermodynamic concepts are still under debate. This study addresses the short-comings of this alloy design strategy with the aim to open up new directions of HEA research targeting specifically non-equiatomic yet massively alloyed compositions. We propose that a wide range of massive single phase solid solutions could be designed by including non-equiatomic variants. It is demonstrated by introducing a set of novel non-equiatomic multi-component CoCrFeMnNi alloys produced by metallurgical rapid alloy prototyping. Despite the reduced configurational entropy, detailed characterization of these materials reveals a strong resemblance to the well-studied equiatomic single phase HEA: The microstructure of these novel alloys exhibits a random distribution of alloying elements (confirmed by Energy-Dispersive Spectroscopy and Atom Probe Tomography) in a single face-centered-cubic phase (confirmed by X-ray Diffraction and Electron Backscatter Diffraction), which deforms through planar slip (confirmed by Electron-Channeling Contrast Imaging) and leads to excellent ductility (confirmed by uniaxial tensile tests). This approach widens the field of HEAs to non-equiatomic multi-component alloys since the concept enables to tailor the stacking fault energy and associated transformation phenomena which act as main mechanisms to design useful strain hardening behavior.

  7. Non-equiatomic high entropy alloys: Approach towards rapid alloy screening and property-oriented design

    International Nuclear Information System (INIS)

    Pradeep, K.G.; Tasan, C.C.; Yao, M.J.; Deng, Y.; Springer, H.; Raabe, D.

    2015-01-01

    The high entropy alloy (HEA) concept has triggered a renewed interest in alloy design, even though some aspects of the underlying thermodynamic concepts are still under debate. This study addresses the short-comings of this alloy design strategy with the aim to open up new directions of HEA research targeting specifically non-equiatomic yet massively alloyed compositions. We propose that a wide range of massive single phase solid solutions could be designed by including non-equiatomic variants. It is demonstrated by introducing a set of novel non-equiatomic multi-component CoCrFeMnNi alloys produced by metallurgical rapid alloy prototyping. Despite the reduced configurational entropy, detailed characterization of these materials reveals a strong resemblance to the well-studied equiatomic single phase HEA: The microstructure of these novel alloys exhibits a random distribution of alloying elements (confirmed by Energy-Dispersive Spectroscopy and Atom Probe Tomography) in a single face-centered-cubic phase (confirmed by X-ray Diffraction and Electron Backscatter Diffraction), which deforms through planar slip (confirmed by Electron-Channeling Contrast Imaging) and leads to excellent ductility (confirmed by uniaxial tensile tests). This approach widens the field of HEAs to non-equiatomic multi-component alloys since the concept enables to tailor the stacking fault energy and associated transformation phenomena which act as main mechanisms to design useful strain hardening behavior.

  8. Alloy Fabrication Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — At NETL’s Alloy Fabrication Facility in Albany, OR, researchers conduct DOE research projects to produce new alloys suited to a variety of applications, from gas...

  9. Grain refining mechanism of Al-containing Mg alloys with the addition of Mn-Al alloys

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Gaowu W., E-mail: qingw@smm.neu.edu.c [Key Laboratory for Anisotropy and Texture of Materials (Ministry of Education), Northeastern University, Wenhu Road 3-11, Heping District, Shenyang 110004, Liaoning Province (China); Ren Yuping; Huang Wei; Li Song; Pei Wenli [Key Laboratory for Anisotropy and Texture of Materials (Ministry of Education), Northeastern University, Wenhu Road 3-11, Heping District, Shenyang 110004, Liaoning Province (China)

    2010-10-08

    Graphical abstract: Display Omitted Research highlights: The {epsilon}-AlMn phase acts as the heterogeneous nucleus of {alpha}-Mg phase during the solidification of the AZ31 Mg alloy, not the {gamma}-Al{sub 8}Mn{sub 5} phase. The grain refinement effect is very clear with the addition of only 0.5 wt% Mn-28Al alloy (pure {epsilon}-AlMn). The grain refinement does not deteriorate up to the holding time of 60 min at 740 {sup o}C. - Abstract: The effect of manganese on grain refinement of Al-containing AZ31 Mg alloy has been investigated by designing a series of Mn-Al alloys composed of either pure {epsilon}-AlMn, {gamma}{sub 2}-Al{sub 8}Mn{sub 5} or both of them using optical microscopy and X-ray diffraction. It is experimentally clarified that the grain refinement of the AZ31 Mg alloy is due to the existence of the {epsilon}-AlMn phase in the Mn-Al alloys, not the {gamma}{sub 2}-Al{sub 8}Mn{sub 5} phase. The grain size of AZ31 Mg alloy is about 91 {mu}m without any addition of Mn-Al alloys, but remarkably decreases to {approx}55 {mu}m with the addition of either Mn-34 wt% Al or Mn-28 wt% Al. With a minor addition of 0.5 wt% Mn-28Al alloy, the grain size of AZ31 alloy decreases to {approx}53 {mu}m, and the Mn-28Al alloy can be active as grain refiner for holding time up to 60 min for the melt AZ31 alloy at 750 {sup o}C.

  10. Ni-Cr based dental alloys; Ni release, corrosion and biological evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Reclaru, L., E-mail: lucien.reclaru@pxgroup.com [PX Holding S.A., Dep R and D Corrosion and Biocompatibility Group, Bd. des Eplatures 42, CH-2304 La Chaux-de-Fonds (Switzerland); Unger, R.E.; Kirkpatrick, C.J. [Institute for Pathology, REPAIR Lab, University Medical Center, Johannes Gutenberg University Mainz, Langenbeckstr.1, D-55101 Mainz (Germany); Susz, C.; Eschler, P.-Y.; Zuercher, M.-H. [PX Holding S.A., Dep R and D Corrosion and Biocompatibility Group, Bd. des Eplatures 42, CH-2304 La Chaux-de-Fonds (Switzerland); Antoniac, I. [Materials Science and Engineering Faculty, Politehnica of Bucharest, 060042 Bucharest (Romania); Luethy, H. [Institute of Dental Materials Science and Technology, University of Basel, Hebelstrasse 3, CH-4056 Basel (Switzerland)

    2012-08-01

    In the last years the dental alloy market has undergone dramatic changes for reasons of economy and biocompatibility. Nickel based alloys have become widely used substitute for the much more expensive precious metal alloys. In Europe the prevalence of nickel allergy is 10-15% for female adults and 1-3% for male adults. Despite the restrictions imposed by the EU for the protection of the general population in contact dermatitis, the use of Ni-Cr dental alloys is on the increase. Some questions have to be faced regarding the safety risk of nickel contained in dental alloys. We have collected based on many EU markets, 8 Ni-Cr dental alloys. Microstructure characterization, corrosion resistance (generalized, crevice and pitting) in saliva and the quantities of cations released in particular nickel and CrVI have been evaluated. We have applied non parametric classification tests (Kendall rank correlation) for all chemical results. Also cytotoxicity tests and an evaluation specific to TNF-alpha have been conducted. According to the obtained results, it was found that their behavior to corrosion was weak but that nickel release was high. The quantities of nickel released are higher than the limits imposed in the EU concerning contact with the skin or piercing. Surprisingly the biological tests did not show any cytotoxic effect on Hela and L929 cells or any change in TNF-alpha expression in monocytic cells. The alloys did not show any proinflammatory response in endothelial cells as demonstrated by the absence of ICAM-1 induction. We note therefore that there is really no direct relationship between the in vitro biological evaluation tests and the physico-chemical characterization of these dental alloys. Clinical and epidemiological studies are required to clarify these aspects. - Highlights: Black-Right-Pointing-Pointer Nickel released was higher than the limits imposed in EU in contact with the skin. Black-Right-Pointing-Pointer No direct relationship between the

  11. High performance corrosion and wear resistant composite titanium nitride layers produced on the AZ91D magnesium alloy by a hybrid method

    Directory of Open Access Journals (Sweden)

    Michał Tacikowski

    2014-09-01

    Full Text Available Composite, diffusive titanium nitride layers formed on a titanium and aluminum sub-layer were produced on the AZ91D magnesium alloy. The layers were obtained using a hybrid method which combined the PVD processes with the final sealing by a hydrothermal treatment. The microstructure, resistance to corrosion, mechanical damage, and frictional wear of the layers were examined. The properties of the AZ91D alloy covered with these layers were compared with those of the untreated alloy and of some engineering materials such as 316L stainless steel, 100Cr6 bearing steel, and the AZ91D alloy subjected to commercial anodizing. It has been found that the composite diffusive nitride layer produced on the AZ91D alloy and then sealed by the hydrothermal treatment ensures the corrosion resistance comparable with that of 316L stainless steel. The layers are characterized by higher electrochemical durability which is due to the surface being overbuilt with the titanium oxides formed, as shown by the XPS examinations, from titanium nitride during the hydrothermal treatment. The composite titanium nitride layers exhibit high resistance to mechanical damage and wear, including frictional wear which is comparable with that of 100Cr6 bearing steel. The performance properties of the AZ91D magnesium alloy covered with the composite titanium nitride coating are substantially superior to those of the alloy subjected to commercial anodizing which is the dominant technique employed in industrial practice.

  12. Corrosion-electrochemical and mechanical properties of aluminium-berylium alloys alloyed by rare-earth metals

    International Nuclear Information System (INIS)

    Safarov, A.M.; Odinaev, Kh.E.; Shukroev, M.Sh.; Saidov, R.Kh.

    1997-01-01

    In order to study influence of rare earth metals on corrosion-electrochemical and mechanical properties of aluminium-berylium alloys the alloys contain 1 mass % beryllium and different amount of rare earth metals were obtained.-electrochemical and mechanical properties of aluminium-berylium alloys. The electrochemical characteristics of obtained alloys, including stationary potential, potentials of passivation beginning and full passivation, potentials of pitting formation and re passivation were defined.

  13. Microstructural and wear characteristics of cobalt free, nickel base intermetallic alloy deposited by laser cladding

    International Nuclear Information System (INIS)

    Awasthi, Reena; Kumar, Santosh; Viswanadham, C.S.; Srivastava, D.; Dey, G.K.; Limaye, P.K.

    2011-01-01

    This paper describes the microstructural and wear characteristics of Ni base intermetallic hardfacing alloy (Tribaloy-700) deposited on stainless steel-316 L substrate by laser cladding technique. Cobalt base hardfacing alloys have been most commonly used hardfacing alloys for application involving wear, corrosion and high temperature resistance. However, the high cost and scarcity of cobalt led to the development of cobalt free hardfacing alloys. Further, in the nuclear industry, the use of cobalt base alloys is limited due to the induced activity of long lived radioisotope 60 Co formed. These difficulties led to the development of various nickel and iron base alloys to replace cobalt base hardfacing alloys. In the present study Ni base intermetallic alloy, free of Cobalt was deposited on stainless steel- 316 L substrate by laser cladding technique. Traditionally, welding and thermal spraying are the most commonly employed hardfacing techniques. Laser cladding has been explored for the deposition of less diluted and fusion-bonded Nickel base clad layer on stainless steel substrate with a low heat input. The laser cladding parameters (Laser power density: 200 W/mm 2 , scanning speed: 430 mm/min, and powder feed rate: 14 gm/min) resulted in defect free clad with minimal dilution of the substrate. The microstructure of the clad layer was examined by Optical microscopy, Scanning electron microscopy, with energy dispersive spectroscopy. The phase analysis was performed by X-ray diffraction technique. The clad layer exhibited sharp substrate/clad interface in the order of planar, cellular, and dendritic from the interface upwards. Dilution of clad with Fe from substrate was very low passing from ∼ 15% at the interface (∼ 40 μm) to ∼ 6% in the clad layer. The clad layer was characterized by the presence of hexagonal closed packed (hcp, MgZn 2 type) intermetallic Laves phase dispersed in the eutectic of Laves and face centered cubic (fcc) gamma solid solution. The

  14. Role of alloying additions on the properties of Cu–Al–Mn shape memory alloys

    Energy Technology Data Exchange (ETDEWEB)

    Dasgupta, Rupa, E-mail: rupadasgupta@ampri.res.in; Jain, Ashish Kumar; Kumar, Pravir; Hussain, Shahadat; Pandey, Abhishek

    2015-01-25

    Highlights: • Cu based SMAs with high transition temperature could be made using LM route. • The properties depend on alloying composition. • Property characterisation establishes feasibility of making SMAs. - Abstract: The effect of alloying seven different elements [Zn, Si, Fe, Ni, Mg, Cr and Ti] on the microstructure, hardness, phase precipitation and transformation temperature in a Cu–12.5Al–5Mn alloy with a view to possible improvements as a result of these additions is the focus of the reported study. The base alloy has been chosen keeping in mind its ability to exhibit shape memory properties and improved ductility over other Cu-based SMAs. The objective was to ascertain changes or improvements attained due to the individual tertiary additions. The samples were prepared through liquid metallurgy route using pure copper, aluminum, manganese and the respective quaternary alloying elements in right quantities to weigh 1000 g of the alloy in total and were melted together. Samples from the cast alloys were subject to homogenisation treatment at 200 °C for 2 h in a muffle furnace and furnace cooled. Samples from the homogenised alloys were heated and held for 2 h at 920 °C followed by ice quenching to obtain the desired martensitic structure for shape memory behaviour. The alloys in the cast, homogenised and quenched conditions were metallographically polished to observe the martensitic phase formation mainly in quenched samples which is a pre requisite for exhibiting shape memory properties in these alloys. X-ray Diffraction studies were carried out on the cast and quenched samples using Cu Kα target; and the phases identified indicate martensitic phase precipitation; however in some cases the precipitation is incomplete. Differential Scanning Calorimetric [DSC] studies were carried out on quenched samples from room temperature to 600 °C maintaining a constant rate of 10 °C/min. Results indicate clear transformation peaks in all the samples which

  15. Role of alloying additions on the properties of Cu–Al–Mn shape memory alloys

    International Nuclear Information System (INIS)

    Dasgupta, Rupa; Jain, Ashish Kumar; Kumar, Pravir; Hussain, Shahadat; Pandey, Abhishek

    2015-01-01

    Highlights: • Cu based SMAs with high transition temperature could be made using LM route. • The properties depend on alloying composition. • Property characterisation establishes feasibility of making SMAs. - Abstract: The effect of alloying seven different elements [Zn, Si, Fe, Ni, Mg, Cr and Ti] on the microstructure, hardness, phase precipitation and transformation temperature in a Cu–12.5Al–5Mn alloy with a view to possible improvements as a result of these additions is the focus of the reported study. The base alloy has been chosen keeping in mind its ability to exhibit shape memory properties and improved ductility over other Cu-based SMAs. The objective was to ascertain changes or improvements attained due to the individual tertiary additions. The samples were prepared through liquid metallurgy route using pure copper, aluminum, manganese and the respective quaternary alloying elements in right quantities to weigh 1000 g of the alloy in total and were melted together. Samples from the cast alloys were subject to homogenisation treatment at 200 °C for 2 h in a muffle furnace and furnace cooled. Samples from the homogenised alloys were heated and held for 2 h at 920 °C followed by ice quenching to obtain the desired martensitic structure for shape memory behaviour. The alloys in the cast, homogenised and quenched conditions were metallographically polished to observe the martensitic phase formation mainly in quenched samples which is a pre requisite for exhibiting shape memory properties in these alloys. X-ray Diffraction studies were carried out on the cast and quenched samples using Cu Kα target; and the phases identified indicate martensitic phase precipitation; however in some cases the precipitation is incomplete. Differential Scanning Calorimetric [DSC] studies were carried out on quenched samples from room temperature to 600 °C maintaining a constant rate of 10 °C/min. Results indicate clear transformation peaks in all the samples which

  16. Dissolution and oxidation behaviour of various austenitic steels and Ni rich alloys in lead-bismuth eutectic at 520 °C

    Energy Technology Data Exchange (ETDEWEB)

    Roy, Marion, E-mail: marion.roy@cea.fr [CEA, DEN, DPC, SCCME, Laboratoire d’Etude de la Corrosion Non Aqueuse, F-91191 Gif-sur-Yvette (France); Martinelli, Laure, E-mail: laure.martinelli@cea.fr [CEA, DEN, DPC, SCCME, Laboratoire d’Etude de la Corrosion Non Aqueuse, F-91191 Gif-sur-Yvette (France); Ginestar, Kevin, E-mail: kevin.ginestar@cea.fr [CEA, DEN, DPC, SCCME, Laboratoire d’Etude de la Corrosion Non Aqueuse, F-91191 Gif-sur-Yvette (France); Favergeon, Jérôme, E-mail: jerome.favergeon@utc.fr [Laboratoire Roberval, UMR 7337, Université de Technologie de Compiègne, Centre de Recherche de Royallieu, CS 60319, 60203 Compiègne Cedex (France); Moulin, Gérard [Laboratoire Roberval, UMR 7337, Université de Technologie de Compiègne, Centre de Recherche de Royallieu, CS 60319, 60203 Compiègne Cedex (France)

    2016-01-15

    Ten austenitic steels and Ni rich alloys were tested in static lead-bismuth eutectic (LBE) at 520 °C in order to obtain a selection of austenitic steels having promising corrosion behaviour in LBE. A test of 1850 h was carried out with a dissolved oxygen concentration between 10{sup −9} and 5 10{sup −4} g kg{sup −1}. The combination of thermodynamic of the studied system and literature results leads to the determination of an expression of the dissolved oxygen content in LBE as a function of temperature: RT(K)ln[O](wt%) = −57584/T(K) −55.876T(K) + 254546 (R is the gas constant in J mol{sup −1} K{sup −1}). This relation can be considered as a threshold of oxygen content above which only oxidation is observed on the AISI 316L and AISI 304L austenitic alloys in static LBE between 400 °C and 600 °C. The oxygen content during the test leads to both dissolution and oxidation of the samples during the first 190 h and leads to pure oxidation for the rest of the test. Results of mixed oxidation and dissolution test showed that only four types of corrosion behaviour were observed: usual austenitic steels and Ni rich alloys behaviour including the reference alloy 17Cr-12Ni-2.5Mo (AISI 316LN), the 20Cr-31Ni alloy one, the Si containing alloy one and the Al containing alloy one. According to the proposed criteria of oxidation and dissolution kinetics, silicon rich alloys and aluminum rich alloy presented a promising corrosion behaviour. - Highlights: • 10 austenitic steels and Ni rich alloys were tested in LBE at 520 °C with dissolved oxygen content between 10{sup -9} and 5 10{sup -4} wt%. • It is shown that only thermodynamics cannot explain the Ni rich alloys corrosion behaviour in LBE. • The role of oxygen on corrosion behaviour in LBE was highlighted. • An equilibrium line was defined above which only oxidation has occurred on 316L: RTln[O](wt%) = -57584/T(K)-55.876T(K)+254546. • 18Cr-15Ni-3.7Si, 21Cr-11Ni-1.6Si and 14Cr-25Ni-3.5Al

  17. Fracture of Shape Memory Alloys

    OpenAIRE

    Miyazaki, Shuichi; Otsuka, Kazuhiro

    1981-01-01

    The initiation and the propagation of cracks during both quenching and deformation in polycrystalline Cu-Al-Ni alloys have been investigated under various conditions. The fracture surfaces of Ti-Ni and Cu-Al-Ni alloys were also observed by a scanning electron microscope. From these results, it was concluded that the brittleness of Cu-Al-Ni alloy and other β phase alloys are due to large elastic anisotropy and large grain sizes, while that the large ductility in Ti-Ni alloy being due to the sm...

  18. Enhancement of High Temperature Strength of 2219 Alloys Through Small Additions of Nb and Zr and a Novel Heat Treatment

    Science.gov (United States)

    Mondol, S.; Makineni, S. K.; Kumar, S.; Chattopadhyay, K.

    2018-05-01

    This paper presents a detailed investigation on the effect of small amount of Nb and Zr additions to 2219 Al alloy coupled with a novel three-stage heat treatment process. The main aim of the work is to increase the high temperature strength of 2219 alloy by introducing thermally stable L12 type ordered precipitates in the matrix as well as by reducing the coarsening of metastable strengthening θ″ and θ' precipitates. To achieve this, small amounts of Nb and Zr are added to 2219 alloy melt and retained in solid solution by suction casting in a water-cooled copper mould having a cooling rate of 102 to 103 K/s. The suction cast alloy is directly aged at 673 K (400 °C) to form L12 type ordered coherent Al3Zr precipitates. Subsequently, the alloy is solution treated at 808 K (535 °C) for 30 minutes to get supersaturation of Cu in the matrix without significantly affecting the Al3Zr precipitates. Finally, the alloy is aged at 473 K (200 °C), which results in the precipitation of θ″ and θ'. Microstructural characterization reveals that θ″ and θ' are heterogeneously precipitated on pre-existing uniformly distributed Al3Zr precipitates, which leads to a higher number density of these precipitates. This results in a significant increase in strength at room temperature as well as at 473 K (200 °C) as compared to the 2219 alloy. Furthermore, the alloy remains thermally stable after prolonged exposure at 473 K (200 °C), which is attributed to the elastic strain energy minimization by the conjoint Al3Zr/θ' or Al3Zr/θ″ precipitates, and the high Zr and Nb solute-vacancy binding energy, retarding the growth and coarsening of θ″ and θ' precipitates.

  19. Alloy development for cladding and duct applications

    International Nuclear Information System (INIS)

    Straalsund, J.L.; Johnson, G.D.

    1981-01-01

    Three general classes of materials under development for cladding and ducts are listed. Solid solution strengthened, or austenitic, alloys are Type 316 stainless steel and D9. Precipitation hardened (also austenitic) alloys consist of D21, D66 and D68. These alloys are similar to such commercial alloys as M-813, Inconel 706, Inconel 718 and Nimonic PE-16. The third general class of alloys is composed of ferritic alloys, with current emphasis being placed on HT-9, a tempered martensitic alloy, and D67, a delta-ferritic steel. The program is comprised of three parallel paths. The current reference, or first generation alloy, is 20% cold worked Type 316 stainless steel. Second generation alloys for near-term applications include D9 and HT-9. Third generation materials consist of the precipitation strengthened steels and ferritic alloys, and are being considered for implementation at a later time than the first and second generation alloys. The development of second and third generation materials was initiated in 1974 with the selection of 35 alloys. This program has proceeded to today where there are six advanced alloys being evaluated. These alloys are the developmental alloys D9, D21, D57, D66 and D68, together with the commerical alloy, HT-9. The status of development of these alloys is summarized

  20. Magnesium alloys: predicting in vivo corrosion with in vitro immersion testing.

    Science.gov (United States)

    Walker, Jemimah; Shadanbaz, Shaylin; Kirkland, Nicholas T; Stace, Edward; Woodfield, Tim; Staiger, Mark P; Dias, George J

    2012-05-01

    Magnesium (Mg) and its alloys have been proposed as degradable replacements to commonly used orthopedic biomaterials such as titanium alloys and stainless steel. However, the corrosion of Mg in a physiological environment remains a difficult characteristic to accurately assess with in vitro methods. The aim of this study was to identify a simple in vitro immersion test that could provide corrosion rates similar to those observed in vivo. Pure Mg and five alloys (AZ31, Mg-0.8Ca, Mg-1Zn, Mg-1Mn, Mg-1.34Ca-3Zn) were immersed in either Earle's balanced salt solution (EBSS), minimum essential medium (MEM), or MEM-containing 40 g/L bovine serum albumin (MEMp) for 7, 14, or 21 days before removal and assessment of corrosion by weight loss. This in vitro data was compared to in vivo corrosion rates of the same materials implanted in a subcutaneous environment in Lewis rats for equivalent time points. The results suggested that, for the alloys investigated, the EBSS buffered with sodium bicarbonate provides a rate of degradation comparable to those observed in vivo. In contrast, the addition of components such as (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid) (HEPES), vitamins, amino acids, and albumin significantly increased corrosion rates. Based on these findings, it is proposed that with this in vitro protocol, immersion of Mg alloys in EBSS can be used as a predictor of in vivo corrosion. Copyright © 2012 Wiley Periodicals, Inc.

  1. ZIRCONIUM-TITANIUM-BERYLLIUM BRAZING ALLOY

    Science.gov (United States)

    Gilliland, R.G.; Patriarca, P.; Slaughter, G.M.; Williams, L.C.

    1962-06-12

    A new and improved ternary alloy is described which is of particular utility in braze-bonding parts made of a refractory metal selected from Group IV, V, and VI of the periodic table and alloys containing said metal as a predominating alloying ingredient. The brazing alloy contains, by weight, 40 to 50 per cent zirconium, 40 to 50 per cent titanium, and the balance beryllium in amounts ranging from 1 to 20 per cent, said alloy having a melting point in the range 950 to 1400 deg C. (AEC)

  2. Borated aluminum alloy manufacturing technology

    International Nuclear Information System (INIS)

    Shimojo, Jun; Taniuchi, Hiroaki; Kajihara, Katsura; Aruga, Yasuhiro

    2003-01-01

    Borated aluminum alloy is used as the basket material of cask because of its light weight, thermal conductivity and superior neutron absorbing abilities. Kobe Steel has developed a unique manufacturing process for borated aluminum alloy using a vacuum induction melting method. In this process, aluminum alloy is melted and agitated at higher temperatures than common aluminum alloy fabrication methods. It is then cast into a mold in a vacuum atmosphere. The result is a high quality aluminum alloy which has a uniform boron distribution and no impurities. (author)

  3. Stacking fault energy measurements in solid solution strengthened Ni-Cr-Fe alloys using synchrotron radiation

    Energy Technology Data Exchange (ETDEWEB)

    Unfried-Silgado, Jimy [Metals Characterization and Processing Laboratory, Brazilian Nanothecnology National Laboratory - CNPEM/ABTLuS, Caixa Postal 6192, CEP 13083-970, Campinas, Sao Paulo (Brazil); Universidade Estadual de Campinas UNICAMP, Faculdade de Engenharia Mecanica FEM, Campinas (Brazil); Universidad Autonoma del Caribe, Grupo IMTEF, Ingenieria Mecanica, Barranquilla (Colombia); Wu, Leonardo [Metals Characterization and Processing Laboratory, Brazilian Nanothecnology National Laboratory - CNPEM/ABTLuS, Caixa Postal 6192, CEP 13083-970, Campinas, Sao Paulo (Brazil); Furlan Ferreira, Fabio [Universidade Federal do ABC, Centro de Ciencias Naturais e Humanas (CCNH), Sao Paulo (Brazil); Mario Garzon, Carlos [Universidad Nacional de Colombia, Departamento de Fisica, Bogota (Colombia); Ramirez, Antonio J, E-mail: antonio.ramirez@lnnano.org.br [Metals Characterization and Processing Laboratory, Brazilian Nanothecnology National Laboratory - CNPEM/ABTLuS, Caixa Postal 6192, CEP 13083-970, Campinas, Sao Paulo (Brazil)

    2012-12-15

    The stacking fault energy (SFE) in a set of experimental Ni-Cr-Fe alloys was determined using line profile analysis on synchrotron X-ray diffraction measurements. The methodology used here is supported by the Warren-Averbach calculations and the relationships among the stacking fault probability ({alpha}) and the mean-square microstrain (<{epsilon}{sup 2}{sub L}>). These parameters were obtained experimentally from cold-worked and annealed specimens extracted from the set of studied Ni-alloys. The obtained results show that the SFE in these alloys is strongly influenced by the kind and quantity of addition elements. Different effects due to the action of carbide-forming elements and the solid solution hardening elements on the SFE are discussed here. The simultaneous addition of Nb, Hf, and, Mo, in the studied Ni-Cr-Fe alloys have generated the stronger decreasing of the SFE. The relationships between SFE and the contributions on electronic structure from each element of additions were established.

  4. Grain refinement of an AZ63B magnesium alloy by an Al-1C master alloy

    Energy Technology Data Exchange (ETDEWEB)

    Yichuan Pan; Xiangfa Liu; Hua Yang [The Key Lab. of Liquid Structure and Heredity of Materials, Shandong Univ., Jinan (China)

    2005-12-01

    In order to develop a refiner of Mg-Al alloys, an Al-1C (in wt.%) master alloy was synthesized using a casting method. The microstructure and grain-refining performance of the Al-1C master alloy were investigated using X-ray diffraction (XRD), electron probe microanalysis (EPMA) and a grain-refining test. The microstructure of the Al-1C master alloy is composed of {alpha}-Al solid solution, Al{sub 4}C{sub 3} particles, and graphite phases. After grain refinement of AZ63B alloy by the Al-1C master alloy, the mean grain size reached a limit when 2 wt.% Al-C master alloy was added at 800 C and held for 20 min in the melt before casting. The minimum mean grain size is approximately 48 {mu}m at the one-half radius of the ingot and is about 17% of that of the unrefined alloy. The Al-1C master alloy results in better grain refinement than C{sub 2}Cl{sub 6} and MgCO{sub 3} carbon-containing refiners. (orig.)

  5. Dual structural transition in small nanoparticles of Cu-Au alloy

    Science.gov (United States)

    Gafner, Yuri; Gafner, Svetlana; Redel, Larisa; Zamulin, Ivan

    2018-02-01

    Cu-Au alloy nanoparticles are known to be widely used in the catalysis of various chemical reactions as it was experimentally defined that in many cases the partial substitution of copper with gold increases catalytic activity. However, providing the reaction capacity of alloy nanoparticles the surface electronic structure strongly depends on their atomic ordering. Therefore, to theoretically determine catalytic properties, one needs to use a most real structural model complying with Cu-Au nanoparticles under various external influences. So, thermal stability limits were studied for the initial L12 phase in Cu3Au nanoalloy clusters up to 8.0 nm and Cu-Au clusters up to 3.0 nm at various degrees of Au atom concentration, with molecular dynamics method using a modified tight-binding TB-SMA potential. Dual structural transition L12 → FCC and further FCC → Ih is shown to be possible under the thermal factor in Cu3Au and Cu-Au clusters with the diameter up to 3.0 nm. The temperature of the structural transition FCC → Ih is established to decrease for small particles of Cu-Au alloy under the increase of Au atom concentration. For clusters with this structural transition, the melting point is found to be a linear increasing function of concentration, and for clusters without FCC → Ih structural transition, the melting point is a linear decreasing function of Au content. Thus, the article shows that doping Cu nanoclusters with Au atoms allows to control the forming structure as well as the melting point.

  6. Oxidation behavior of steels and Alloy 800 in supercritical water

    International Nuclear Information System (INIS)

    Olmedo, A.M.; Bordoni, R.; Dominguez, G.; Alvarez, M.G.

    2011-01-01

    The oxidation behavior of a ferritic-martensitic steel T91 and a martensitic steel AISI 403 up to 750 h, and of AISI 316L and Alloy 800 up to 336 h in deaerated supercritical water, 450ºC-25 MPa, was investigated in this paper. After exposure up to 750 h, the weight gain data, for steels T91 and AISI 403, was fitted by ∆W=k t n , were n are similar for both steels and k is a little higher for T91. The oxide films grown in the steels were characterized using gravimetry, scanning electron microscopy/energy dispersive X-ray spectroscopy (SEM/EDS) and X-ray diffraction. The films were adherent and exhibited a low porosity. For this low oxygen content supercritical water exposure, the oxide scale exhibited a typical duplex structure, in which the scale is composed of an outer iron oxide layer of magnetite (Fe 3 O 4 ) and an inner iron/chromium oxide layer of a non-stoichiometric iron chromite (Fe,Cr) 3 O 4 . Preliminary results, with AISI 316L and Alloy 800, for two exposure periods (168 and 336 h), are also reported. The morphology shown for the oxide films grown on both materials up to 336 h of oxidation in supercritical water, resembles that of a duplex layer film like that shown by stainless steels and Alloy 800 oxide films grown in a in a high temperature and pressure (220-350ºC) of a primary or secondary coolant of a plant. (author) [es

  7. Influence of 8-hydroxyquinoline on properties of anodic coatings obtained by micro arc oxidation on AZ91 magnesium alloys

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, R.F. [Jiangxi Key Laboratory of Surface Engineering, Jiangxi Science and Technology Normal University, Nanchang 330013 (China); School of Material Science and Engineering, Jiangxi Science and Technology Normal University, Nanchang 330013 (China); Zhang, S.F., E-mail: zhangshufang790314@sina.com [Jiangxi Key Laboratory of Surface Engineering, Jiangxi Science and Technology Normal University, Nanchang 330013 (China); School of Material Science and Engineering, Jiangxi Science and Technology Normal University, Nanchang 330013 (China); Yang, N.; Yao, L.J.; He, F.X.; Zhou, Y.P.; Xu, X.; Chang, L.; Bai, S.J. [School of Material Science and Engineering, Jiangxi Science and Technology Normal University, Nanchang 330013 (China)

    2012-10-25

    Highlights: Black-Right-Pointing-Pointer 8-HQ can promote the coating formation and change the coating color. Black-Right-Pointing-Pointer 8-HQ can increase the coating thickness and decrease the pore size. Black-Right-Pointing-Pointer Insoluble Mg(HQ){sub 2} is formed in anodic coatings in an alkaline solution with 8-HQ. Black-Right-Pointing-Pointer 8-HQ improves the corrosion resistance of the anodized magnesium alloys. - Abstract: The influence of 8-hydroxyquinoline (8-HQ) on formation and properties of anodic coatings obtained by micro arc oxidation (MAO) on AZ91 magnesium alloys was studied by scanning electron microscope (SEM), energy dispersive spectrometry (EDS), Fourier transform infrared (FT-IR) spectroscopy and potentiodynamic polarization tests. The results demonstrate that 8-HQ can decrease the solution conductivity, take part in the coating formation and change the coating color. By developing anodic coatings with increasing thickness, insoluble Mg(HQ){sub 2} and small pore size, 8-HQ improves the corrosion resistance of the anodized magnesium alloys. The coating shows the best corrosion resistance in the solution of 10 g/L NaOH and 18 g/L Na{sub 2}SiO{sub 3} with 2 g/L 8-HQ.

  8. Hydrogen storage in metallic hydrides: the hydrides of magnesium-nickel alloys

    International Nuclear Information System (INIS)

    Silva, E.P. da.

    1981-01-01

    The massive and common use of hydrogen as an energy carrier requires an adequate solution to the problem of storing it. High pressure or low temperatures are not entirely satisfactory, having each a limited range of applications. Reversible metal hydrides cover a range of applications intermediate to high pressure gas and low temperature liquid hydrogen, retaining very favorable safety and energy density characteristics, both for mobile and stationary applications. This work demonstrates the technical viability of storing hydrogen in metal hydrides of magnesium-nickel alloys. Also, it shows that technology, a product of science, can be generated within an academic environment, of the goal is clear, the demand outstanding and the means available. We review briefly theoretical models relating to metal hydride properties, specially the thermodynamics properties relevant to this work. We report our experimental results on hydrides of magnesium-nickel alloys of various compositions including data on structure, hydrogen storage capacities, reaction kinetics, pressure-composition isotherms. We selected a promising alloy for mass production, built and tested a modular storage tank based on the hydrides of the alloy, with a capacity for storing 10 Nm sup(3) of hydrogen of 1 atm and 20 sup(0)C. The tank weighs 46,3 Kg and has a volume of 21 l. (author)

  9. A study on alkaline heat treated Mg-Ca alloy for the control of the biocorrosion rate.

    Science.gov (United States)

    Gu, X N; Zheng, W; Cheng, Y; Zheng, Y F

    2009-09-01

    To reduce the biocorrosion rate by surface modification, Mg-Ca alloy (1.4wt.% Ca content) was soaked in three alkaline solutions (Na(2)HPO(4), Na(2)CO(3) and NaHCO(3)) for 24h, respectively, and subsequently heat treated at 773K for 12h. Scanning electron microscopy and energy-dispersive spectroscopy results revealed that magnesium oxide layers with the thickness of about 13, 9 and 26microm were formed on the surfaces of Mg-Ca alloy after the above different alkaline heat treatments. Atomic force microscopy showed that the surfaces of Mg-Ca alloy samples became rough after three alkaline heat treatments. The in vitro corrosion tests in simulated body fluid indicated that the corrosion rates of Mg-Ca alloy were effectively decreased after alkaline heat treatments, with the following sequence: NaHCO(3) heatedalloy samples induced toxicity to L-929 cells during 7days culture.

  10. The physical metallurgy of mechanically-alloyed, dispersion-strengthened Al-Li-Mg and Al-Li-Cu alloys

    Science.gov (United States)

    Gilman, P. S.

    1984-01-01

    Powder processing of Al-Li-Mg and Al-Li-Cu alloys by mechanical alloying (MA) is described, with a discussion of physical and mechanical properties of early experimental alloys of these compositions. The experimental samples were mechanically alloyed in a Szegvari attritor, extruded at 343 and 427 C, and some were solution-treated at 520 and 566 C and naturally, as well as artificially, aged at 170, 190, and 210 C for times of up to 1000 hours. All alloys exhibited maximum hardness after being aged at 170 C; lower hardness corresponds to the solution treatment at 566 C than to that at 520 C. A comparison with ingot metallurgy alloys of the same composition shows the MA material to be stronger and more ductile. It is also noted that properly aged MA alloys can develop a better combination of yield strength and notched toughness at lower alloying levels.

  11. De-alloyed platinum nanoparticles

    Science.gov (United States)

    Strasser, Peter [Houston, TX; Koh, Shirlaine [Houston, TX; Mani, Prasanna [Houston, TX; Ratndeep, Srivastava [Houston, TX

    2011-08-09

    A method of producing de-alloyed nanoparticles. In an embodiment, the method comprises admixing metal precursors, freeze-drying, annealing, and de-alloying the nanoparticles in situ. Further, in an embodiment de-alloyed nanoparticle formed by the method, wherein the nanoparticle further comprises a core-shell arrangement. The nanoparticle is suitable for electrocatalytic processes and devices.

  12. Effects of segregation of primary alloying elements on the creep response in magnesium alloys

    DEFF Research Database (Denmark)

    Huang, Y.D.; Dieringa, H.; Hort, N.

    2008-01-01

    The segregation of primary alloying elements deteriorates the high temperature creep resistance of magnesium alloys. Annealing at high temperatures alleviating their segregations can improve the creep resistance. Present investigation on the effect of segregation of primary alloying elements...... on the creep response may provide some useful information about how to improve the creep resistance of magnesium alloys in the future. (c) 2008 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved....

  13. Effectiveness of Ti-micro alloying in relation to cooling rate on corrosion of AZ91 Mg alloy

    International Nuclear Information System (INIS)

    Candan, S.; Celik, M.; Candan, E.

    2016-01-01

    In this study, micro Ti-alloyed AZ91 Mg alloys (AZ91 + 0.5wt.%Ti) have been investigated in order to clarify effectiveness of micro alloying and/or cooling rate on their corrosion properties. Molten alloys were solidified under various cooling rates by using four stage step mold. The microstructural investigations were carried out by using scanning electron microscopy (SEM). Corrosion behaviors of the alloys were evaluated by means of immersion and electrochemical polarization tests in 3.5% NaCl solution. Results showed that the Mg 17 Al 12 (β) intermetallic phase in the microstructure of AZ91 Mg alloy formed as a net-like structure. The Ti addition has reduced the distribution and continuity of β intermetallic phase and its morphology has emerged as fully divorced eutectic. Compared to AZ91 alloy, the effect of the cooling rate in Ti-added alloy on the grain size was less pronounced. When AZ91 and its Ti-added alloys were compared under the same cooling conditions, the Ti addition showed notably high corrosion resistance. Electrochemical test results showed that while I corr values of AZ91 decrease with the increase in the cooling rate, the effect of the cooling rate on I corr values was much lower in the Ti-added alloy. The corrosion resistance of AZ91 Mg alloy was sensitive towards the cooling rates while Ti-added alloy was not affected much from the cooling conditions. - Highlights: • Effect the cooling rate on grain size was less pronounced in the Ti-added alloy. • The morphology of the β phase transformed into fully divorced eutectics. • Ti addition exhibited significantly higher corrosion resistance. • Ti micro alloying is more effective than faster cooling of the alloy on corrosion.

  14. Mechanical and bio-corrosion properties of quaternary Mg–Ca–Mn–Zn alloys compared with binary Mg–Ca alloys

    International Nuclear Information System (INIS)

    Bakhsheshi-Rad, H.R.; Idris, M.H.; Abdul-Kadir, M.R.; Ourdjini, A.; Medraj, M.; Daroonparvar, M.; Hamzah, E.

    2014-01-01

    Highlights: • Quaternary alloy show better mechanical and corrosion properties than binary alloy. • Mg–2Ca–0.5Mn–2Zn alloy showed suitable mechanical properties for bone application. • The improved corrosion resistance with addition of Mn and Zn into the Mg–Ca alloy. • Formation of protective surface film Mn-containing magnesium on quaternary alloy. • Secondary phases have strong effect on micro-galvanic corrosion of Mg alloys. - Abstract: Binary Mg–xCa alloys and the quaternary Mg–Ca–Mn–xZn were studied to investigate their bio-corrosion and mechanical properties. The surface morphology of specimens was characterized by X-ray diffraction (XRD), Fourier-transformed infrared spectroscopy (FTIR), scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDS). The results of mechanical properties show that the yield strength (YS), ultimate tensile strength (UTS) and elongation of quaternary alloy increased significantly with the addition of zinc (Zn) up to 4 wt.%. However, further addition of Zn content beyond 4 wt.% did not improve yield strength and ultimate tensile strength. In contrast, increasing calcium (Ca) content has a deleterious effect on binary Mg–Ca alloys. Compression tests of the magnesium (Mg) alloys revealed that the compression strength of quaternary alloy was higher than that of binary alloy. However, binary Mg–Ca alloy showed higher reduction in compression strength after immersion in simulated body fluid. The bio-corrosion behaviour of the binary and quaternary Mg alloys were investigated using immersion tests and electrochemical tests. Electrochemical tests shows that the corrosion potential (E corr ) of binary Mg–2Ca significantly shifted toward nobeler direction from −1996.8 to −1616.6 mV SCE with the addition of 0.5 wt.% manganese (Mn) and 2 wt.% Zn content. However, further addition of Zn to 7 wt.% into quaternary alloy has the reverse effect. Immersion tests show that the quaternary

  15. Space Qualification Testing of a Shape Memory Alloy Deployable CubeSat Antenna

    Science.gov (United States)

    2016-09-15

    from a specific input vibration . This excitation vibration can be applied acoustically through a speaker or physically by an impact hammer. NASA...Shape Memory Alloy (SMA) L-band deployable QHA. In this research, a testing approach is developed to conduct random vibration , thermal vacuum...92 4.4 Vibration Test Results

  16. Effect of reversible hydrogen alloying and plastic deformation on microstructure development in titanium alloys

    International Nuclear Information System (INIS)

    Murzinova, M.A.

    2011-01-01

    Hydrogen leads to degradation in fracture-related mechanical properties of titanium alloys and is usually considered as a very dangerous element. Numerous studies of hydrogen interaction with titanium alloys showed that hydrogen may be considered not only as an impurity but also as temporary alloying element. This statement is based on the following. Hydrogen stabilizes high-temperature β-phase, leads to decrease in temperature of β→α transformation and extends (α + β )-phase field. The BCC β-phase exhibits lower strength and higher ductility in comparison with HCP α -phase. As a result, hydrogen improves hot workability of hard-to-deform titanium alloys. Hydrogen changes chemical composition of the phases, kinetics of phase transformations, and at low temperatures additional phase transformation (β→α + TiH 2 ) takes place, which is accompanied with noticeable change in volumes of phases. As a result, fine lamellar microstructure may be formed in hydrogenated titanium alloys after heat treatment. It was shown that controlled hydrogen alloying improves weldability and machinability of titanium alloys. After processing hydrogenated titanium preforms are subjected to vacuum annealing, and the hydrogen content decreases up to safe level. Hydrogen removal is accompanied with hydrides dissolution and β→α transformation that makes possible to control structure formation at this final step of treatment. Thus, reversible hydrogen alloying of titanium alloys allows to obtain novel microstructure with enhanced properties. The aim of the work was to study the effect of hydrogen on structure formation, namely: i) influence of hydrogen content on transformation of lamellar microstructure to globular one during deformation in (α+β)-phase field; ii) effect of dissolved hydrogen on dynamic recrystallization in single α- and β- phase regions; iii) influence of vacuum annealing temperature on microstructure development. The work was focused on the optimization of

  17. Physical metallurgy of titanium alloys

    International Nuclear Information System (INIS)

    Collings, E.W.

    1988-01-01

    Researches in electric, magnetic, thermophysical properties of titanium alloys in the wide range of temperatures (from helium upto elevated one), as well as stability of phases in alloys of different types are generalized. Fundamental description of physical properties of binary model alloys is given. Acoustic emission, shape memory and Bauschinger effects, pseudoelasticity, aging and other aspects of physical metallurgy of titanium alloys are considered

  18. Fe-Cr-Ni system alloys

    International Nuclear Information System (INIS)

    Levin, F.L.

    1986-01-01

    Phase diagram of Fe-Cr-Ni system, which is the basic one for production of corrosion resistant alloys, is considered. Data on corrosion resistance of such alloys are correlated depending on a number of factors: quality and composition of modifying elements, corrosion medium, temperature, alloy structure, mechanical and thermal treatment. Grades of Fe-Ni-Cr alloys are presented, and fields of their application are pointed out

  19. A novel luminol chemiluminescent method catalyzed by silver/gold alloy nanoparticles for determination of anticancer drug flutamide.

    Science.gov (United States)

    Chaichi, Mohammad Javad; Azizi, Seyed Naser; Heidarpour, Maryam

    2013-12-01

    It was found that silver/gold alloy nanoparticles enhance the chemiluminescence (CL) of the luminol-H2O2 system in alkaline solution. The studies of UV-Vis spectra, CL spectra, effects of concentrations luminol, hydrogen peroxide and silver/gold alloy nanoparticles solutions were carried out to explore the CL enhancement mechanism. Flutamide was found to quench the CL signals of the luminol-H2O2 reaction catalyzed by silver/gold alloy nanoparticles, which made it applicable for the determination of flutamide. Under the optimum conditions, the CL intensity is proportional to the concentration of the flutamide in solution over the range 5.0 × 10(-7) to 1.0 × 10(-4)mol L(-1). Detection limit was obtained 1.2 × 10(-8)mol L(-1)and the relative standard deviation (RSD) γ5%. This work is introduced as a new method for the determination of flutamide in commercial tablets. Box-Behnken experimental design is applied to investigate and validate the CL measurement parameters. Copyright © 2013 Elsevier B.V. All rights reserved.

  20. Galvanic corrosion in odontological alloys

    International Nuclear Information System (INIS)

    Riesgo, O.; Bianchi, G.L.; Duffo, G.S.

    1993-01-01

    Galvanic corrosion can occur when different alloys are placed in direct contact within the oral cavity or within tissues. Concern has been expressed associated with the coupling of selected restorative materials as well as implant material with various alloys used for restorative procedures. This could be critical if the crown or bridge had subgingival finish line with a metallic zone in contact with the tissue, and the implant was made in titanium alloy. The present work shows the results of galvanic coupling studies done on implants of titanium alloy connected to nickel-chromium and cobalt-chromium alloys. (Author)