28 CFR 36.102 - Application.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 36.102 Section 36.102... ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General § 36.102 Application. (a) General. This part applies to any... courses related to applications, licensing, certification, or credentialing for secondary or postsecondary...

50 CFR 550.102 - Application.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Application. 550.102 Section 550.102 Wildlife and Fisheries MARINE MAMMAL COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY MARINE MAMMAL COMMISSION § 550.102 Application. This part...

49 CFR 28.102 - Application.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Application. 28.102 Section 28.102 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.102 Application. This part...

28 CFR 39.102 - Application.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 39.102 Section 39.102 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.102 Application. This part applies to...

7 CFR 948.102 - Communications.

Science.gov (United States)

2010-01-01

... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 948.102 Section 948.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Rules and Regulations General § 948.102 Communications. Unless otherwise provided in §§ 948.1 to 948.92...

Silicon Alloying On Aluminium Based Alloy Surface

International Nuclear Information System (INIS)

Suryanto

2002-01-01

Silicon alloying on surface of aluminium based alloy was carried out using electron beam. This is performed in order to enhance tribological properties of the alloy. Silicon is considered most important alloying element in aluminium alloy, particularly for tribological components. Prior to silicon alloying. aluminium substrate were painted with binder and silicon powder and dried in a furnace. Silicon alloying were carried out in a vacuum chamber. The Silicon alloyed materials were assessed using some techniques. The results show that silicon alloying formed a composite metal-non metal system in which silicon particles are dispersed in the alloyed layer. Silicon content in the alloyed layer is about 40% while in other place is only 10.5 %. The hardness of layer changes significantly. The wear properties of the alloying alloys increase. Silicon surface alloying also reduced the coefficient of friction for sliding against a hardened steel counter face, which could otherwise be higher because of the strong adhesion of aluminium to steel. The hardness of the silicon surface alloyed material dropped when it underwent a heating cycle similar to the ion coating process. Hence, silicon alloying is not a suitable choice for use as an intermediate layer for duplex treatment

Mechanical behavior and strengthening mechanisms in ultrafine grain precipitation-strengthened aluminum alloy

International Nuclear Information System (INIS)

Ma, Kaka; Wen, Haiming; Hu, Tao; Topping, Troy D.; Isheim, Dieter; Seidman, David N.; Lavernia, Enrique J.; Schoenung, Julie M.

2014-01-01

To provide insight into the relationships between precipitation phenomena, grain size and mechanical behavior in a complex precipitation-strengthened alloy system, Al 7075 alloy, a commonly used aluminum alloy, was selected as a model system in the present study. Ultrafine-grained (UFG) bulk materials were fabricated through cryomilling, degassing, hot isostatic pressing and extrusion, followed by a subsequent heat treatment. The mechanical behavior and microstructure of the materials were analyzed and compared directly to the coarse-grained (CG) counterpart. Three-dimensional atom-probe tomography was utilized to investigate the intermetallic precipitates and oxide dispersoids formed in the as-extruded UFG material. UFG 7075 exhibits higher strength than the CG 7075 alloy for each equivalent condition. After a T6 temper, the yield strength (YS) and ultimate tensile strength (UTS) of UFG 7075 achieved 734 and 774 MPa, respectively, which are ∼120 MPa higher than those of the CG equivalent. The strength of as-extruded UFG 7075 (YS: 583 MPa, UTS: 631 MPa) is even higher than that of commercial 7075-T6. More importantly, the strengthening mechanisms in each material were established quantitatively for the first time for this complex precipitation-strengthened system, accounting for grain-boundary, dislocation, solid-solution, precipitation and oxide dispersoid strengthening contributions. Grain-boundary strengthening was the predominant mechanism in as-extruded UFG 7075, contributing a strength increment estimated to be 242 MPa, whereas Orowan precipitation strengthening was predominant in the as-extruded CG 7075 (∼102 MPa) and in the T6-tempered materials, and was estimated to contribute 472 and 414 MPa for CG-T6 and UFG-T6, respectively

12 CFR 509.102 - Discovery.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Discovery. 509.102 Section 509.102 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.102 Discovery. (a) In general. A party may take the deposition of an...

25 CFR 720.102 - Application.

Science.gov (United States)

2010-04-01

... 25 Indians 2 2010-04-01 2010-04-01 false Application. 720.102 Section 720.102 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.102 Application...

12 CFR 410.102 - Application.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Application. 410.102 Section 410.102 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.102 Application...

5 CFR 730.102 - Definitions.

Science.gov (United States)

2010-01-01

...) NOTIFICATION OF POST-EMPLOYMENT RESTRICTIONS § 730.102 Definitions. Agency means an Executive agency as defined in 5 U.S.C. 105, but does not include the General Accounting Office. Senior executive means a member... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 730.102 Section 730.102...

Beyond Ni-based superalloys: Development of CoRe-based alloys for gas turbine applications at very high temperatures

Czech Academy of Sciences Publication Activity Database

Mukherji, D.; Roesler, J.; Strunz, Pavel; Gilles, R.; Schumacher, G.; Piegert, S.

2011-01-01

Roč. 102, č. 9 (2011), s. 1125-1132 ISSN 1862-5282 R&D Projects: GA ČR(CZ) GAP204/11/1453 Institutional research plan: CEZ:AV0Z10480505 Keywords : Co-base alloy * Rhenium * Electron microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.830, year: 2011

Correlation between diffusion barriers and alloying energy in binary alloys

DEFF Research Database (Denmark)

Vej-Hansen, Ulrik Grønbjerg; Rossmeisl, Jan; Stephens, Ifan

2016-01-01

In this paper, we explore the notion that a negative alloying energy may act as a descriptor for long term stability of Pt-alloys as cathode catalysts in low temperature fuel cells.......In this paper, we explore the notion that a negative alloying energy may act as a descriptor for long term stability of Pt-alloys as cathode catalysts in low temperature fuel cells....

Electrical Resistance Alloys and Low-Expansion Alloys

DEFF Research Database (Denmark)

Kjer, Torben

1996-01-01

The article gives an overview of electrical resistance alloys and alloys with low thermal expansion. The electrical resistance alloys comprise resistance alloys, heating alloys and thermostat alloys. The low expansion alloys comprise alloys with very low expansion coefficients, alloys with very low...... thermoelastic coefficients and age hardenable low expansion alloys....

40 CFR 152.102 - Publication.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...

Titanium alloys. Advances in alloys, processes, products and applications

International Nuclear Information System (INIS)

Blenkinsop, P.A.

1993-01-01

The last few years have been a period of consolidation of existing alloys and processes. While the aerospace industry remains the principal driving force for alloy development, the paper illustrates examples of new markets being established in 'older' alloys, by a combination of product/process development and a re-examination of engineering design parameters. Considerable attention is still being directed towards the titanium aluminide systems, but other more conventional alloy developments are underway aimed at specific engineering and process requirements, both in the aerospace and non-aerospace sectors. Both the advanced high temperature and conventional alloy developments are considered, before the paper goes on to assess the potential of new processes and products, like spray-forming, metal matrix composites and shaped-plate rolling. (orig.)

22 CFR 225.102 - Definitions.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 225.102 Section 225.102 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.102 Definitions. (a... includes communication or interpersonal contact between investigator and subject. “Private information...

45 CFR 2104.102 - Application.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2104.102 Section 2104.102 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION OF FINE ARTS ENFORCEMENT OF....102 Application. This part applies to all programs or activities conducted by the agency. ...

45 CFR 1706.102 - Application.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1706.102 Section 1706.102 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.102 Application. This part...

29 CFR 541.102 - Management.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Management. 541.102 Section 541.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS DEFINING AND... Executive Employees § 541.102 Management. Generally, “management” includes, but is not limited to...

17 CFR 149.102 - Application.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Application. 149.102 Section 149.102 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ENFORCEMENT OF... COMMISSION § 149.102 Application. This part applies to all programs or activities conducted by the agency. ...

44 CFR 16.102 - Application.

Science.gov (United States)

2010-10-01

... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 16.102 Section 16.102 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.102 Application. This regulation (§§ 16...

45 CFR 1214.102 - Application.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1214.102 Section 1214.102 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE....102 Application. This part applies to all programs or activities conducted by the agency, except for...

Difference in Neutropenia due to Administration Schedule of TAS-102

Directory of Open Access Journals (Sweden)

Yoichiro Yoshida

2017-03-01

Full Text Available TAS-102 significantly improves overall survival in patients with metastatic colorectal cancer. The most common adverse event of TAS-102 is bone marrow suppression, which leads to neutropenia. The incidence of neutropenia is high, and there is no known effective prevention method. Furthermore, the administration method of TAS-102 is complicated. We reported that neutropenia could be avoided by changing to a simple administration method of TAS-102.

45 CFR 2490.102 - Application.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2490.102 Section 2490.102 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.102 Application. This part (§§ 2490.101-2490.170) applies to...

45 CFR 2301.102 - Application.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2301.102 Section 2301.102 Public Welfare Regulations Relating to Public Welfare (Continued) ARCTIC RESEARCH COMMISSION ENFORCEMENT OF... COMMISSION § 2301.102 Application. This part (§§ 2301.101-2301.170) applies to all programs or activities...

7 CFR 1709.102 - Policy.

Science.gov (United States)

2010-01-01

... ASSISTANCE TO HIGH ENERGY COST COMMUNITIES RUS High Energy Cost Grant Program § 1709.102 Policy. (a) All high... 7 Agriculture 11 2010-01-01 2010-01-01 false Policy. 1709.102 Section 1709.102 Agriculture...). (b) RUS may give priority consideration to projects that benefit smaller rural communities...

3 CFR 102.140 - Employment.

Science.gov (United States)

2010-01-01

... 3 The President 1 2010-01-01 2010-01-01 false Employment. 102.140 Section 102.140 Presidential... PROGRAMS OR ACTIVITIES CONDUCTED BY THE EXECUTIVE OFFICE OF THE PRESIDENT § 102.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...

Interphase thermodynamic bond in heterogeneous alloys: effects on alloy properties

International Nuclear Information System (INIS)

Savchenko, A.M.; Konovalov, Yu.V.; Yuferov, O.I.

2005-01-01

Inconsistency between a conventional thermodynamic description of alloys as a mechanical mixture of phases and a real alloys state as a common thermodynamic system in which there is a complicated physical-chemical phases interaction has been considered. It is supposed that in heterogeneous alloys (eutectic ones, for instance), so called interphase thermodynamic bond can become apparent due to a partial electron levels splitting under phase interaction. Thermodynamic description of phase equilibrium in alloys is proposed taking into account a thermodynamic bond for the system with phase diagram of eutectic type, and methods of the value of this bond estimation are presented. Experimental evidence (Al-Cu-Si, Al-Si-Mg-Cu, U-Mo + Al) of the effect of interphase thermodynamic bond on temperature and enthalpy of melting of alloys are produced as well as possibility of its effects on alloys electrical conduction, strength, heat and corrosion resistance is substantiated theoretically [ru

Advances in titanium alloys

International Nuclear Information System (INIS)

Seagle, S.R.; Wood, J.R.

1993-01-01

As described above, new developments in the aerospace market are focusing on higher temperature alloys for jet engine components and higher strength/toughness alloys for airframe applications. Conventional alloys for engines have reached their maximum useful temperature of about 1000 F (540 C) because of oxidation resistance requirements. IMI 834 and Ti-1100 advanced alloys show some improvement, however, the major improvement appears to be in gamma titanium aluminides which could extend the maximum usage temperature to about 1500 F (815 C). This puts titanium alloys in a competitive position to replace nickel-base superalloys. Advanced airframe alloys such as Ti-6-22-22S, Beta C TM , Ti-15-333 and Ti-10-2-3 with higher strength than conventional Ti-6-4 are being utilized in significantly greater quantities, both in military and commercial applications. These alloys offer improved strength with little or no sacrifice in toughness and improved formability, in some cases. Advanced industrial alloys are being developed for improved corrosion resistance in more reducing and higher temperature environments such as those encountered in sour gas wells. Efforts are focused on small precious metal additions to optimize corrosion performance for specific applications at a modest increase in cost. As these applications develop, the usage of titanium alloys for industrial markets should steadily increase to approach that for aerospace applications. (orig.)

29 CFR 102.151 - Settlement.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Settlement. 102.151 Section 102.151 Labor Regulations... Expenses § 102.151 Settlement. The applicant and the General Counsel may agree on a proposed settlement of... on a proposed settlement of an award before an application has been filed, the proposed settlement...

29 CFR 102.7 - State.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false State. 102.7 Section 102.7 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.7 State. The term State as used herein shall include the District of Columbia and all States, Territories, and possessions...

32 CFR 935.102 - Information.

Science.gov (United States)

2010-07-01

... 32 National Defense 6 2010-07-01 2010-07-01 false Information. 935.102 Section 935.102 National... WAKE ISLAND CODE Criminal Actions § 935.102 Information. (a) Any offense may be prosecuted by a written information signed by the Island Attorney. However, if the offense is one for which issue of a citation is...

20 CFR 653.102 - Job information.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Job information. 653.102 Section 653.102... SERVICE SYSTEM Services for Migrant and Seasonal Farmworkers (MSFWs) § 653.102 Job information. All State agencies shall make job order information conspicuous and available to MSFWs in all local offices. This...

19 CFR 360.102 - Online registration.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Online registration. 360.102 Section 360.102... ANALYSIS SYSTEM § 360.102 Online registration. (a) In general. (1) Any importer, importing company, customs.... boxes will not be accepted. A user identification number will be issued within two business days...

Irradiation-assisted stress corrosion cracking in HTH Alloy X-750 and Alloy 625

International Nuclear Information System (INIS)

Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.

1995-01-01

In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water to determine the irradiation-assisted stress corrosion cracking (IASCC) behavior of HTH Alloy X-750 and direct-aged Alloy 625. New data confirm previous results showing that high irradiation levels reduce SCC resistance in Alloy X-750. Heat-to-heat variability correlates with boron content, with low boron heats showing improved IASCC properties. Alloy 625 is resistant to IASCC, as no cracking was observed in any Alloy 625 specimens. Microstructural, microchemical and deformation studies were performed to characterize the mechanisms responsible for IASCC in Alloy X-750 and the lack of an effect in Alloy 625. The mechanisms under investigation are: boron transmutation effects, radiation-induced changes in microstructure and deformation characteristics, and radiation-induced segregation. Irradiation of Alloy X-750 caused significant strengthening and ductility loss that was associated with the formation of cavities and dislocation loops. High irradiation levels did not cause significant segregation of alloying or trace elements in Alloy X-750. Irradiation of Alloy 625 resulted in the formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to the loops and precipitates was apparently offset by a partial dissolution of γ double-prime precipitates, as Alloy 625 showed no irradiation-induced strengthening or ductility loss. In the nonirradiated condition, an IASCC susceptible HTH heat containing 28 ppm B showed grain boundary segregation of boron, whereas a nonsusceptible HTH heat containing 2 ppm B and Alloy 625 with 20 ppm B did not show significant boron segregation. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in Alloy X-750, and the absence of these two effects results in the superior IASCC resistance displayed by Alloy 625

22 CFR 102.8 - Reporting accidents.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting accidents. 102.8 Section 102.8... Accidents Abroad § 102.8 Reporting accidents. (a) To airline and Civil Aeronautics Administration... probably be the first to be informed of the accident, in which event he will be expected to report the...

29 CFR 102.70 - Runoff election.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Runoff election. 102.70 Section 102.70 Labor Regulations... Runoff election. (a) The regional director shall conduct a runoff election, without further order of the... objections are filed as provided in § 102.69. Only one runoff shall be held pursuant to this section. (b...

Laser surface alloying of aluminium-transition metal alloys

International Nuclear Information System (INIS)

Almeida, A.; Vilar, R.

1998-01-01

Laser surface alloying has been used as a tool to produce hard and corrosion resistant Al-transition metal (TM) alloys. Cr and Mo are particularly interesting alloying elements to produce stable high-strength alloys because they present low diffusion coefficients and solid solubility in Al. To produce Al-TM surface alloys a two-step laser process was developed: firstly, the material is alloyed using low scanning speed and secondly, the microstructure is modified by a refinement step. This process was used in the production of Al-Cr, Al-Mo and Al-Mo and Al-Nb surface alloys by alloying Cr, Mo or Nb powder into an Al and 7175 Al alloy substrate using a CO 2 laser . This paper presents a review of the work that has been developed at Instituto Superior Tecnico on laser alloying of Al-TM alloy, over the last years. (Author) 16 refs

An approach to modeling tensile–compressive asymmetry for martensitic shape memory alloys

International Nuclear Information System (INIS)

Zaki, Wael

2010-01-01

In this paper, the asymmetric tensile–compressive behavior of shape memory alloys is modeled based on the mathematical framework of Raniecki and Mróz (2008 Acta Mech. 195 81–102). The framework allows the definition of smooth, non-symmetric, pressure-insensitive yield functions that are used here to incorporate tensile–compressive modeling capabilities into the Zaki–Moumni (ZM) model for shape memory materials. It is found that, despite some increased complexity, the generalized model is capable of producing satisfactory results that agree with uniaxial experimental data taken from the literature

5 CFR 430.102 - Performance management.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Performance management. 430.102 Section 430.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Management § 430.102 Performance management. (a) Performance management is the...

Crevice corrosion propagation on alloy 625 and alloy C276 in natural seawater

International Nuclear Information System (INIS)

McCafferty, E.; Bogar, F.D.; Thomas, E.D. II; Creegan, C.A.; Lucas, K.E.; Kaznoff, A.I.

1997-01-01

Chemical composition of the aqueous solution within crevices on two different Ni-Cr-Mo-Fe alloys immersed in natural seawater was determined using a semiquantitative thin-layer chromatographic method. Active crevices were found to contain concentrated amounts of dissolved Ni 2+ , Cr 3+ , Mo 3+ , and Fe 2+ ions. Propagation of crevice corrosion for the two alloys was determined from anodic polarization curves in model crevice solutions based upon stoichiometric dissolution or selective dissolution of alloy components. Both alloys 625 (UNS N06625) and C276 (UNS N10276) underwent crevice corrosion in the model crevice electrolytes. For the model crevice solution based upon selective dissolution of alloy constituents, the anodic dissolution rate for alloy 625 was higher than that for alloy C276. This trend was reversed for the model crevice solution based upon uniform dissolution of alloy constituents

48 CFR 4.102 - Contractor's signature.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor's signature. 4.102 Section 4.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL ADMINISTRATIVE MATTERS Contract Execution 4.102 Contractor's signature. (a) Individuals. A contract with an...

5 CFR 847.102 - Regulatory structure.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 847.102 Section 847.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... INSTRUMENTALITIES General Provisions § 847.102 Regulatory structure. (a)(1) Subpart A of this part contains...

23 CFR 810.102 - Eligible projects.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...

5 CFR 10.2 - Accountability systems.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accountability systems. 10.2 Section 10.2 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE RULES AGENCY ACCOUNTABILITY SYSTEMS; OPM AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.2 Accountability systems. The Director of...

42 CFR 422.102 - Supplemental benefits.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Supplemental benefits. 422.102 Section 422.102... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Benefits and Beneficiary Protections § 422.102 Supplemental benefits. (a) Mandatory supplemental benefits. (1) Subject to CMS approval, an MA organization may...

7 CFR 1900.102 - Applicable law.

Science.gov (United States)

2010-01-01

... 7 Agriculture 12 2010-01-01 2010-01-01 false Applicable law. 1900.102 Section 1900.102 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Applicability of Federal Law § 1900.102 Applicable law. Loans made by FmHA or its successor agency...

40 CFR 280.102 - Trust fund.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Trust fund. 280.102 Section 280.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) TECHNICAL STANDARDS AND CORRECTIVE ACTION REQUIREMENTS FOR OWNERS AND OPERATORS OF UNDERGROUND STORAGE TANKS (UST) Financial Responsibility § 280.102 Trust...

41 CFR 51-10.102 - Application.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...

Alloying principles for magnesium base heat resisting alloys

International Nuclear Information System (INIS)

Drits, M.E.; Rokhlin, L.L.; Oreshkina, A.A.; Nikitina, N.I.

1982-01-01

Some binary systems of magnesium-base alloys in which solid solutions are formed, are considered for prospecting heat resistant alloys. It is shown that elements having essential solubility in solid magnesium strongly decreasing with temperature should be used for alloying maqnesium base alloys with high strength properties at increased temperatures. The strengthening phases in these alloys should comprise essential quantity of magnesium and be rather refractory

22 CFR 102.27 - Docket.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...

17 CFR 248.102 - Examples.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...

21 CFR 102.5 - General principles.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false General principles. 102.5 Section 102.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION COMMON OR USUAL NAME FOR NONSTANDARDIZED FOODS General Provisions § 102.5 General principles. (a...

39 CFR 10.2 - Advisory service.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...

29 CFR 102.4 - Region; subregion.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Region; subregion. 102.4 Section 102.4 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.4 Region; subregion. The term region as used herein shall mean that part of the United States or any Territory thereof...

28 CFR 34.102 - Peer review procedures.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Peer review procedures. 34.102 Section 34.102 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES Peer Review § 34.102 Peer review procedures. The OJJDP peer review process is contained in an OJJDP “Peer...

19 CFR 122.102 - Inspection of baggage in transit.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Inspection of baggage in transit. 122.102 Section... OF THE TREASURY AIR COMMERCE REGULATIONS Accompanied Baggage in Transit § 122.102 Inspection of baggage in transit. (a) General baggage in transit may be inspected upon arrival, while in transit, and...

Scale up of NiTi shape memory alloy production by EBM

Science.gov (United States)

Otubo, J.; Rigo, O. D.; Moura Neto, C.; Kaufman, M. J.; Mei, P. R.

2003-10-01

The usual process to produce NiTi shape memory alloy is by vacuum induction melting (VIM) using a graphite crucible, which causes contamination of the melt with carbon. Contamination with oxygen originates from the residual oxygen inside the melting chamber. An alternative process to produce NiTi alloys is by electron beam melting (EBM) using a water-cooled copper crucible that eliminates carbon contamination, and the oxygen contamination would be minimal due to operation in a vacuum of better than 10^{-2} Pa. In a previous work, it was demonstrated that the technique is feasible for button shaped samples weighing around 30g. The present work presents the results on the scale up program that enables the production of larger samples/ingots. The results are very promising in terms of chemical composition homogeneity as well as in terms of carbon contamination, the latter being four to ten times lower than the commercially-produced VIM products, and in terms of final oxygen content which is shown to depend primarily on the starting raw materials.

Galvanic corrosion in odontological alloys

International Nuclear Information System (INIS)

Riesgo, O.; Bianchi, G.L.; Duffo, G.S.

1993-01-01

Galvanic corrosion can occur when different alloys are placed in direct contact within the oral cavity or within tissues. Concern has been expressed associated with the coupling of selected restorative materials as well as implant material with various alloys used for restorative procedures. This could be critical if the crown or bridge had subgingival finish line with a metallic zone in contact with the tissue, and the implant was made in titanium alloy. The present work shows the results of galvanic coupling studies done on implants of titanium alloy connected to nickel-chromium and cobalt-chromium alloys. (Author)

10 CFR 611.102 - Eligible project costs.

Science.gov (United States)

2010-01-01

... Accounting Principles and these costs may be considered by DOE in determining the Borrower's contribution to... 10 Energy 4 2010-01-01 2010-01-01 false Eligible project costs. 611.102 Section 611.102 Energy... PROGRAM Direct Loan Program § 611.102 Eligible project costs. (a) Eligible costs are: (1) Those costs that...

Anodic behavior of alloy 22 in bicarbonate containing media: Effect of alloying

International Nuclear Information System (INIS)

Zadorozne, N S; Giordano, C M; Rebak, R B; Ares, A E; Carranza, R M

2012-01-01

Alloy 22 is one of the candidates for the manufacture of high level nuclear waste containers. These containers provide services in natural environments characterized by multi-ionic solutions.It is estimated they could suffer three types of deterioration: general corrosion, localized corrosion (specifically crevice corrosion) and stress corrosion cracking (SCC). It has been confirmed that the presence of bicarbonate and chloride ions is necessary to produce cracking, . It has also been determined that the susceptibility to SCC could be related to the occurrence of an anodic peak in the polarization curves in these media at potentials below transpassivity. The aim of this work is to study the effect of alloying elements on the anodic behavior of Alloy 22 in media containing bicarbonate and chloride ions at different concentrations and temperatures. Polarization curves were made on alloy 22 (Ni-22% Cr-13% Mo), Ni-Mo (Ni-28, 5% Mo) and Ni-Cr (Ni-20% Cr) in the following solutions: 1 mol/L NaCl at 90 o C, and 1.148 mol/L NaHCO 3 ; 1.148 mol/L NaHCO 3 + 1 mol/L NaCl; 1.148 mol/L NaHCO 3 + 0.1 mol/L NaCl, at 90 o C, 75 o C, 60 o C and 25 o C. It was found that alloy 22 has a anodic current density peak at potentials below transpassivity, only in the presence of bicarbonate ions. Curves performed in 1 mol/L NaCl did not show any anodic peak, in any of the tested alloys. The curves made on alloys Ni-Mo and Ni-Cr in the presence of bicarbonate ions, allowed to determine that Cr, is responsible for the appearance of the anodic peak in alloy 22. The curves of alloy Ni-Mo showed no anodic peak in the studied conditions. The potential at which the anodic peak appears in alloy 22 and Ni-Cr alloy, increases with decreasing temperature. The anodic peak was also affected by solution composition. When chloride ion is added to bicarbonate solutions, the anodic peak is shifted to higher potential and current densities, depending on the concentration of added chloride ions (author)

Alloy materials

Energy Technology Data Exchange (ETDEWEB)

Hans Thieme, Cornelis Leo (Westborough, MA); Thompson, Elliott D. (Coventry, RI); Fritzemeier, Leslie G. (Acton, MA); Cameron, Robert D. (Franklin, MA); Siegal, Edward J. (Malden, MA)

2002-01-01

An alloy that contains at least two metals and can be used as a substrate for a superconductor is disclosed. The alloy can contain an oxide former. The alloy can have a biaxial or cube texture. The substrate can be used in a multilayer superconductor, which can further include one or more buffer layers disposed between the substrate and the superconductor material. The alloys can be made a by process that involves first rolling the alloy then annealing the alloy. A relatively large volume percentage of the alloy can be formed of grains having a biaxial or cube texture.

20 CFR 655.102 - Special procedures.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Special procedures. 655.102 Section 655.102 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF... in force until modified by the Administrator. ...

5 CFR 5001.102 - Prohibited financial interests in for-hire transportation companies.

Science.gov (United States)

2010-01-01

...-hire transportation companies. 5001.102 Section 5001.102 Administrative Personnel INTERSTATE COMMERCE COMMISSION SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE INTERSTATE COMMERCE COMMISSION § 5001.102 Prohibited financial interests in for-hire transportation companies. (a) General prohibition...

Effects of alloying elements on thermal desorption of helium in Ni alloys

International Nuclear Information System (INIS)

Xu, Q.; Cao, X.Z.; Sato, K.; Yoshiie, T.

2012-01-01

It is well known that the minor elements Si and Sn can suppress the formation of voids in Ni alloys. In the present study, to investigate the effects of Si and Sn on the retention of helium in Ni alloys, Ni, Ni–Si, and Ni–Sn alloys were irradiated by 5 keV He ions at 723 K. Thermal desorption spectroscopy (TDS) was performed at up to 1520 K, and microstructural observations were carried out to identify the helium trapping sites during the TDS analysis. Two peaks, at 1350 and 1457 K, appeared in the TDS spectrum of Ni. On the basis of the microstructural observations, the former peak was attributed to the release of trapped helium from small cavities and the latter to its release from large cavities. Small-cavity helium trapping sites were also found in the Ni–Si and Ni–Sn alloys, but no large cavities were observed in these alloys. In addition, it was found that the oversized element Sn could trap He atoms in the Ni–Sn alloy.

Effects of alloying elements on thermal desorption of helium in Ni alloys

Energy Technology Data Exchange (ETDEWEB)

Xu, Q., E-mail: xu@rri.kyoto-u.ac.jp [Research Reactor Institute, Kyoto University, Osaka 590-0494 (Japan); Cao, X.Z.; Sato, K.; Yoshiie, T. [Research Reactor Institute, Kyoto University, Osaka 590-0494 (Japan)

2012-12-15

It is well known that the minor elements Si and Sn can suppress the formation of voids in Ni alloys. In the present study, to investigate the effects of Si and Sn on the retention of helium in Ni alloys, Ni, Ni-Si, and Ni-Sn alloys were irradiated by 5 keV He ions at 723 K. Thermal desorption spectroscopy (TDS) was performed at up to 1520 K, and microstructural observations were carried out to identify the helium trapping sites during the TDS analysis. Two peaks, at 1350 and 1457 K, appeared in the TDS spectrum of Ni. On the basis of the microstructural observations, the former peak was attributed to the release of trapped helium from small cavities and the latter to its release from large cavities. Small-cavity helium trapping sites were also found in the Ni-Si and Ni-Sn alloys, but no large cavities were observed in these alloys. In addition, it was found that the oversized element Sn could trap He atoms in the Ni-Sn alloy.

Effects of alloying elements on thermal desorption of helium in Ni alloys

Science.gov (United States)

Xu, Q.; Cao, X. Z.; Sato, K.; Yoshiie, T.

2012-12-01

It is well known that the minor elements Si and Sn can suppress the formation of voids in Ni alloys. In the present study, to investigate the effects of Si and Sn on the retention of helium in Ni alloys, Ni, Ni-Si, and Ni-Sn alloys were irradiated by 5 keV He ions at 723 K. Thermal desorption spectroscopy (TDS) was performed at up to 1520 K, and microstructural observations were carried out to identify the helium trapping sites during the TDS analysis. Two peaks, at 1350 and 1457 K, appeared in the TDS spectrum of Ni. On the basis of the microstructural observations, the former peak was attributed to the release of trapped helium from small cavities and the latter to its release from large cavities. Small-cavity helium trapping sites were also found in the Ni-Si and Ni-Sn alloys, but no large cavities were observed in these alloys. In addition, it was found that the oversized element Sn could trap He atoms in the Ni-Sn alloy.

16 CFR 1034.102 - Application.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Application. 1034.102 Section 1034.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS... Application. This part applies to all programs or activities conducted by the agency. ...

41 CFR 102-77.15 - Who funds the Art-in-Architecture efforts?

Science.gov (United States)

2010-07-01

...-Architecture efforts? 102-77.15 Section 102-77.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 77-ART-IN-ARCHITECTURE Art-in-Architecture § 102-77.15 Who funds the Art-in-Architecture efforts? To the extent not...

Positrons in amorphous alloys

International Nuclear Information System (INIS)

Moser, Pierre.

1981-07-01

Positron annihilation techniques give interesting informations about ''empty spaces'' in amorphous alloys. The results of an extensive research work on the properties of either pre-existing or irradiation induced ''empty spaces'' in four amorphous alloys are presented. The pre-existing empty spaces appear to be small vacancy-like defects. The irradiation induced defects are ''close pairs'' with widely distributed configurations. There is a strong interaction between vacancy like and interstitial like components. A model is proposed, which explains the radiation resistance mechanism of the amorphous alloys. An extensive joint research work to study four amorphous alloys, Fe 80 B 20 ,Fe 40 Ni 40 P 14 B 6 , Cu 50 Ti 50 , Pd 80 Si 20 , is summarized

Wire Arc Additive Manufacturing of AZ31 Magnesium Alloy: Grain Refinement by Adjusting Pulse Frequency

Directory of Open Access Journals (Sweden)

Jing Guo

2016-10-01

Full Text Available Wire arc additive manufacturing (WAAM offers a potential approach to fabricate large-scale magnesium alloy components with low cost and high efficiency, although this topic is yet to be reported in literature. In this study, WAAM is preliminarily applied to fabricate AZ31 magnesium. Fully dense AZ31 magnesium alloy components are successfully obtained. Meanwhile, to refine grains and obtain good mechanical properties, the effects of pulse frequency (1, 2, 5, 10, 100, and 500 Hz on the macrostructure, microstructure and tensile properties are investigated. The results indicate that pulse frequency can result in the change of weld pool oscillations and cooling rate. This further leads to the change of the grain size, grain shape, as well as the tensile properties. Meanwhile, due to the resonance of the weld pool at 5 Hz and 10 Hz, the samples have poor geometry accuracy but contain finer equiaxed grains (21 μm and exhibit higher ultimate tensile strength (260 MPa and yield strength (102 MPa, which are similar to those of the forged AZ31 alloy. Moreover, the elongation of all samples is above 23%.

47 CFR 25.102 - Station authorization required.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station authorization required. 25.102 Section 25.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS General § 25.102 Station authorization required. (a) No person shall use or operate...

Progressive degradation of alloy 690 and the development of a significant improvement in alloy 800CR

International Nuclear Information System (INIS)

Staehle, Roger W.; Arioka, Koji; Tapping, Robert

2015-01-01

The present most widely used alloys for tubing in steam generators and structural materials in water cooled reactors are Alloy 690 and Alloy 800. However, both alloys, while improved over Alloy 600 may not meet the needs of longer range applications in the range of 80-100 years. Alloy 690 sustains damage resulting from the formation of cavities at grain boundaries which eventually cover about 50% of the area of the grain boundaries with the remainder covering being covered with carbides. The cavities seem to nucleate on the carbides leaving the grain boundaries a structure of cavities and carbides. Such a structure will lead the Alloy 690 to fail completely. Normal Alloy 800 does not produce such cavities and probably retains a large amount of its corrosion resistance but does sustain progressive SCC at low rate. A new alloy, 800CR, has been developed in a collaboration among Arioka, Tapping, and Staehle. This alloy is based on a Cr composition of 23.5-27% with the remainder retaining the previous Alloy 800 composition. 800CR sustains a crack velocity about 100 times less than Alloy 690 and a negligible rate of initiation. The 800CR, alloy is now seeking a patent. (authors)

40 CFR 26.102 - Definitions.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 26.102 Section 26.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA...) Human subject means a living individual about whom an investigator (whether professional or student...

18 CFR 376.102 - Organization.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Organization. 376.102... OF ENERGY REVISED GENERAL RULES ORGANIZATION, MISSION, AND FUNCTIONS; OPERATIONS DURING EMERGENCY CONDITIONS Organization, Mission, and Functions § 376.102 Organization. The Commission is established as an...

Characteristics of Film Formed on Alloy 600 and Alloy 690 in Water Containing lead

International Nuclear Information System (INIS)

Hwang Seong Sik; Lee, Deok Hyun; Kim, Hong Pyo; Kim, Joung Soo; Kim, Ju Yup

1999-01-01

Anodic polarization behaviors of Alloy 600 and Alloy 690 have been studied as a function of lead content in the solution of pH 4 and 10 at 90 .deg. C. As the amount of lead in the solution increased, critical current densities and passive current densities of Alloy 600 and Alloy 690 increased, while the breakdown potential of the alloys decreased. The high critical current density in the high lead solution was thought to come from the combination of an enhanced dissolution of constituents on the surface of the alloys by the lead and an anodic dissolution of metallic lead deposited on the surface of the specimens. The morphology of lead precipitated on the specimen after the anodic scan changed with the pH of solution: small irregular particles were precipitated on the surface of the specimen in the solution of pH 4, while the high density of regular sized particles was formed on it in the solution of pH 10.Pb was observed to enhance Cr depletion from the outer surface of Alloy 600 and Alloy 690 and also to increase the ratio of O 2- /OH - in the surface film formed in the high lead solution. The SCC resistance of Alloy 600 and Alloy 690 may have decreased due to the poor quality of the passive film formed and the enhanced oxygen evolution in the solution containing lead

47 CFR 32.102 - Nonregulated investments.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonregulated investments. 32.102 Section 32.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS... investments. Nonregulated investments shall include the investment in nonregulated activities that are...

The influence of alloy composition on residual stresses in heat treated aluminium alloys

Energy Technology Data Exchange (ETDEWEB)

Robinson, J.S., E-mail: jeremy.robinson@ul.ie [Department of Mechanical, Aeronautical and Biomedical Engineering, University of Limerick (Ireland); Redington, W. [Materials and Surface Science Institute, University of Limerick (Ireland)

2015-07-15

The as quenched properties of eight different heat treatable aluminium alloys are related to residual stress magnitudes with the objective being to establish if there is a relationship between the residual stress and the as quenched alloy hardness and strength. Near surface residual stresses were assessed with X-ray diffraction using both the established sin{sup 2}ψ method and the more recent cos α technique. Through thickness residual stresses were also characterised using neutron diffraction. The alloys were chosen to encompass a wide range of strengths. The low to medium strength alloys were 6060 and 6082, medium to high strength 2618A, 2014A, 7075, 7010 and two variants of 7449, while the very high strength alloy was the powder metallurgy alloy N707. To assess the as quenched strength, dynamic hardness and tensile properties were determined from samples tested immediately after quenching to minimise the influence of precipitation hardening by natural aging. In addition, hot hardness measurements were made in situ on samples cooled to simulate quench paths. Within the experimental constraints of the investigation, the distribution of residual stress through the thickness was found to follow the same pattern for all the alloys investigated, varying from tensile in the interior to surface compression. The influence of alloy strength was manifested as a change in the observed residual stress magnitudes, and surface residual stresses were found to vary linearly with as quenched hardness and strength. - Highlights: • As quenched aluminium alloys contain high magnitude residual stresses. • Surface is compressive balance by a tensile core. • As quenched surface residual stress is linear function of alloy strength. • In situ hot hardness demonstrates rapid change in intrinsic hardness during rapid cooling.

24 CFR 811.102 - Definitions.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Definitions. 811.102 Section 811... URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202... PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.102...

42 CFR 93.102 - Applicability.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

Investigation on mechanical alloying process for v-cr-ti alloys

International Nuclear Information System (INIS)

Stanciulescu, M.; Carlan, P.; Mihalache, M.; Bucsa, G.; Abrudeanu, M.; Galateanu, A.

2015-01-01

Mechanical alloying (MA) is an efficient approach for fabricating oxide-dispersion alloys and structural materials including vanadium alloys for fusion and fission application. Dissolution behaviour of the alloying elements is a key issue for optimizing the mechanical alloying process in fabricating vanadium alloys. This paper studies the MA process of V-4wt.%Cr-4wt.%Ti alloy. The outcomes of the MA powders in a planetary ball mill are reported in terms of powder particle size and morphology evolution and elemental composition. The impact of spark-plasma sintering process on the mechanically alloyed powder is analysed. An optimal set of sintering parameters, including the maximum temperature, the dwell time and the heating rate are determined. (authors)

Environmental fatigue in aluminum-lithium alloys

Science.gov (United States)

Piascik, Robert S.

1992-01-01

Aluminum-lithium alloys exhibit similar environmental fatigue crack growth characteristics compared to conventional 2000 series alloys and are more resistant to environmental fatigue compared to 7000 series alloys. The superior fatigue crack growth behavior of Al-Li alloys 2090, 2091, 8090, and 8091 is due to crack closure caused by tortuous crack path morphology and crack surface corrosion products. At high R and reduced closure, chemical environment effects are pronounced resulting in accelerated near threshold da/dN. The beneficial effects of crack closure are minimized for small cracks resulting in rapid growth rates. Limited data suggest that the 'chemically small crack' effect, observed in other alloy system, is not pronounced in Al-Li alloys. Modeling of environmental fatigue in Al-Li-Cu alloys related accelerated fatigue crack growth in moist air and salt water to hydrogen embrittlement.

42 CFR 102.74 - Disapproval of benefits.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Disapproval of benefits. 102.74 Section 102.74 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Secretarial Determinations § 102.74 Disapproval of benefits. (a) If the Secretary...

PHYSICAL CHARACTERIZATION OF VITREOUS STATE LABORATORY AY102/C106 AND AZ102 HIGH LEVEL WASTE MELTER FEED SIMULANTS (U)

Energy Technology Data Exchange (ETDEWEB)

Hansen, E

2005-03-31

The objective of this task is to characterize and report specified physical properties and pH of simulant high level waste (HLW) melter feeds (MF) processed through the scaled melters at Vitreous State Laboratories (VSL). The HLW MF simulants characterized are VSL AZ102 straight hydroxide melter feed, VSL AZ102 straight hydroxide rheology adjusted melter feed, VSL AY102/C106 straight hydroxide melter feed, VSL AY102/C106 straight hydroxide rheology adjusted melter feed, and Savannah River National Laboratory (SRNL) AY102/C106 precipitated hydroxide processed sludge blended with glass former chemicals at VSL to make melter feed. The physical properties and pH were characterized using the methods stated in the Waste Treatment Plant (WTP) characterization procedure (Ref. 7).

29 CFR 102.127 - Definitions.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Definitions. 102.127 Section 102.127 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Ex Parte Communications... parte communication means an oral or written communication not on the public record with respect to...

5 CFR 185.102 - Definitions.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 185.102 Section 185.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES..., or accounting or bookkeeping entry made: (a) With respect to a claim or to obtain the approval or...

41 CFR 109-27.102-1 - Applicability.

Science.gov (United States)

2010-07-01

...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...

41 CFR 109-27.102-51 - Policy.

Science.gov (United States)

2010-07-01

...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...

7 CFR 3560.102 - Housing project management.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Housing project management. 3560.102 Section 3560.102... § 3560.102 Housing project management. (a) General. Borrowers hold final responsibility for housing project management and must ensure that operations comply with the terms of all loan or grant documents...

29 CFR 102.104 - Withdrawal of petition.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Withdrawal of petition. 102.104 Section 102.104 Labor... Orders and Advisory Opinions Regarding Board Jurisdiction § 102.104 Withdrawal of petition. The petitioner may withdraw his petition at any time prior to issuance of the Board's advisory opinion. ...

29 CFR 784.102 - General legislative history.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 784.102 Section 784.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... Aquatic Products Legislative History of Exemptions § 784.102 General legislative history. (a) As orginally...

41 CFR 101-27.102-2 - Guidelines.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Guidelines. 101-27.102-2 Section 101-27.102-2 Public Contracts and Property Management Federal Property Management Regulations... Replenishment § 101-27.102-2 Guidelines. Guidelines for implementing the EOQ principle of stock replenishment...

24 CFR 984.102 - Program objectives.

Science.gov (United States)

2010-04-01

... education, employment, and business and social skills necessary to achieve self-sufficiency, as defined in... 984.102 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... SECTION 8 AND PUBLIC HOUSING FAMILY SELF-SUFFICIENCY PROGRAM General § 984.102 Program objectives. The...

48 CFR 22.102-2 - Administration.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Administration. 22.102-2 Section 22.102-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... facilities, including requirements for workers in all occupations and skills from local labor market areas or...

41 CFR 102-192.170 - What are GSA's responsibilities in mail management?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities in mail management? 102-192.170 Section 102-192.170 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT GSA's Responsibilities and Services § 102-192.170 What are GSA's...

29 CFR 102.116 - Signature of orders.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Signature of orders. 102.116 Section 102.116 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Certification and Signature of Documents § 102.116 Signature of orders. The executive secretary or the associate executive...

42 CFR 413.102 - Compensation of owners.

Science.gov (United States)

2010-10-01

...) Definitions—(1) Compensation. Compensation means the total benefit received by the owner for the services he... 42 Public Health 2 2010-10-01 2010-10-01 false Compensation of owners. 413.102 Section 413.102... § 413.102 Compensation of owners. (a) Principle. A reasonable allowance of compensation for services of...

29 CFR 102.138 - Definition of meeting.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...

42 CFR 102.33 - Death benefits.

Science.gov (United States)

2010-10-01

... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM... are described in § 102.82. As provided in § 102.84, the Secretary retains the right to recover death... secondary to disability benefits under the PSOB Program. Any death benefit paid under the standard...

31 CFR 17.102 - Application.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 17.102 Section 17.102 Money and Finance: Treasury Office of the Secretary of the Treasury ENFORCEMENT OF NONDISCRIMINATION ON... Application. This part applies to all programs or activities conducted by the agency, except for programs or...

48 CFR 901.102 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 901.102 Section... REGULATIONS SYSTEM Purpose, Authority, Issuance 901.102 Authority. The DEAR and amendments thereto are issued... the authority of section 644 of the Department of Energy Organization Act (42 U.S.C. 7254), section...

Magnesium secondary alloys: Alloy design for magnesium alloys with improved tolerance limits against impurities

Energy Technology Data Exchange (ETDEWEB)

Blawert, C., E-mail: carsten.blawert@gkss.d [GKSS Forschungszentrum Geesthacht GmbH, Max-Planck-Str. 1, 21502 Geesthacht (Germany); Fechner, D.; Hoeche, D.; Heitmann, V.; Dietzel, W.; Kainer, K.U. [GKSS Forschungszentrum Geesthacht GmbH, Max-Planck-Str. 1, 21502 Geesthacht (Germany); Zivanovic, P.; Scharf, C.; Ditze, A.; Groebner, J.; Schmid-Fetzer, R. [TU Clausthal, Institut fuer Metallurgie, Robert-Koch-Str. 42, 38678 Clausthal-Zellerfeld (Germany)

2010-07-15

The development of secondary magnesium alloys requires a completely different concept compared with standard alloys which obtain their corrosion resistance by reducing the levels of impurities below certain alloy and process depending limits. The present approach suitable for Mg-Al based cast and wrought alloys uses a new concept replacing the {beta}-phase by {tau}-phase, which is able to incorporate more impurities while being electro-chemically less detrimental to the matrix. The overall experimental effort correlating composition, microstructure and corrosion resistance was reduced by using thermodynamic calculations to optimise the alloy composition. The outcome is a new, more impurity tolerant alloy class with a composition between the standard AZ and ZC systems having sufficient ductility and corrosion properties comparable to the high purity standard alloys.

42 CFR 102.80 - Calculation of medical benefits.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of medical benefits. 102.80 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.80 Calculation of medical benefits. In calculating medical benefits, the Secretary will take into consideration all reasonable costs for those...

37 CFR 102.9 - Business Information.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Business Information. 102.9... COMMERCE ADMINISTRATION DISCLOSURE OF GOVERNMENT INFORMATION Freedom of Information Act § 102.9 Business Information. (a) In general. Business information obtained by USPTO from a submitter will be disclosed under...

29 CFR 1650.102 - Delegation of authority.

Science.gov (United States)

2010-07-01

... 29 Labor 4 2010-07-01 2010-07-01 false Delegation of authority. 1650.102 Section 1650.102 Labor... for the Collection of Debts by Salary Offset § 1650.102 Delegation of authority. The Chair delegated to the Chief Human Capital Officer the authority to collect debts owed by current EEOC employees, and...

Swelling in neutron-irradiated titanium alloys

International Nuclear Information System (INIS)

Peterson, D.T.

1982-04-01

Immersion density measurements have been performed on a series of titanium alloys irradiated in EBR-II to a fluence of 5 x 10 22 n/cm 2 (E > 0.1 MeV) at 450 and 550 0 C. The materials irradiated were the near-alpha alloys Ti-6242S and Ti-5621S, the alpha-beta alloy Ti-64, and the beta alloy Ti-38644. Swelling was observed in all alloys with the greater swelling being observed at 550 0 C. Microstructural examination revealed the presence of voids in all alloys. Ti-38644 was found to be the most radiation resistant. Ti-6242S and Ti-5621S also displayed good radiation resistance, whereas considerable swelling and precipitation were observed in Ti-64 at 550 0 C

31 CFR 0.102 - Policy.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Policy. 0.102 Section 0.102 Money and Finance: Treasury Office of the Secretary of the Treasury DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF... is not limited to: (1) Reassignment of work duties; (2) Disqualification from a particular assignment...

Precipitation and Hardening in Magnesium Alloys

Science.gov (United States)

Nie, Jian-Feng

2012-11-01

Magnesium alloys have received an increasing interest in the past 12 years for potential applications in the automotive, aircraft, aerospace, and electronic industries. Many of these alloys are strong because of solid-state precipitates that are produced by an age-hardening process. Although some strength improvements of existing magnesium alloys have been made and some novel alloys with improved strength have been developed, the strength level that has been achieved so far is still substantially lower than that obtained in counterpart aluminum alloys. Further improvements in the alloy strength require a better understanding of the structure, morphology, orientation of precipitates, effects of precipitate morphology, and orientation on the strengthening and microstructural factors that are important in controlling the nucleation and growth of these precipitates. In this review, precipitation in most precipitation-hardenable magnesium alloys is reviewed, and its relationship with strengthening is examined. It is demonstrated that the precipitation phenomena in these alloys, especially in the very early stage of the precipitation process, are still far from being well understood, and many fundamental issues remain unsolved even after some extensive and concerted efforts made in the past 12 years. The challenges associated with precipitation hardening and age hardening are identified and discussed, and guidelines are outlined for the rational design and development of higher strength, and ultimately ultrahigh strength, magnesium alloys via precipitation hardening.

Laser surface alloying of aluminium-transition metal alloys

Directory of Open Access Journals (Sweden)

Almeida, A.

1998-04-01

Full Text Available Laser surface alloying has been used as a tool to produce hard and corrosion resistant Al-transition metal (TM alloys. Cr and Mo are particularly interesting alloying elements to produce stable highstrength alloys because they present low diffusion coefficients and solid solubility in Al. To produce Al-TM surface alloys a two-step laser process was developed: firstly, the material is alloyed using low scanning speed and secondly, the microstructure is modified by a refinement step. This process was used in the production of Al-Cr, Al-Mo and Al-Nb surface alloys by alloying Cr, Mo or Nb powder into an Al and 7175 Al alloy substrate using a CO₂ laser. This paper presents a review of the work that has been developed at Instituto Superior Tecnico on laser alloying of Al-TM alloys, over the last years.

En el presente trabajo se estudia la aleación superficial mediante láser de aluminio con metales de transición. El cromo y el molibdeno son particularmente interesantes porque producen aleaciones de alta resistencia y por el bajo coeficiente de difusión y solución sólida en aluminio. Para producir estas aleaciones se ha seguido un procedimiento desarrollado en dos partes. En primer lugar, el material se alea usando una baja velocidad de procesado y en segundo lugar la estructura se modifica mediante un refinamiento posterior. Este procedimiento se ha empleado en la producción de aleaciones Al-Cr, Al-Mo y Al-Nb mediante aleación con láser de CO₂ de polvos de Cr, Mo o Nb en aluminio y la aleación 7175. Este trabajo es una revisión del desarrollado en el Instituto Superior Técnico de Lisboa en los últimos años.

42 CFR 102.73 - Approval of benefits.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Approval of benefits. 102.73 Section 102.73 Public... PROGRAM Secretarial Determinations § 102.73 Approval of benefits. When the Secretary has determined that benefits will be paid to a requester and has calculated the type and amount of such benefits, he will...

9 CFR 3.102 - Facilities, indoor.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Facilities, indoor. 3.102 Section 3... Marine Mammals Facilities and Operating Standards § 3.102 Facilities, indoor. (a) Ambient temperature. The air and water temperatures in indoor facilities shall be sufficiently regulated by heating or...

21 CFR 102.19 - Petitions.

Science.gov (United States)

2010-04-01

... display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Petitions. 102.19 Section 102.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

Variations of color with alloying elements in Pd-free Au-Pt-based high noble dental alloys

International Nuclear Information System (INIS)

Shiraishi, Takanobu; Takuma, Yasuko; Miura, Eri; Fujita, Takeshi; Hisatsune, Kunihiro

2007-01-01

The effects of alloying addition of a small amount of base metals (In, Sn, Fe, Zn) on color variations in Pd-free Au-Pt-based high noble dental alloys were investigated in terms of rectilinear and polar color coordinates. The ternary Au-Pt-X (X = In, Sn, Fe, Zn) and quaternary Au-Pt-In-Y (Y = Sn, Fe, Zn) alloys were prepared from high purity component metals. The amount of alloying base metals, X and Y, were restricted up to 2 at.%. The alloying addition of a small amount of Fe, In, Sn, to a binary Au-10 at.% Pt alloy (referred to as AP10) effectively increased chroma, C *. On the other hand, the addition of Zn to the parent alloy AP10 did not change color coordinates greatly. The increase in chroma in the present Au-Pt-based high noble alloys was attributed to the increase in the slope of spectral reflectance curve at its absorption edge near 515 nm. It was found that the addition of a small amount of Fe to the parent alloy AP10 markedly increased lightness, L *, and the addition of Sn gave a very light tint of red to the parent alloy. Although red-green chromaticity index a * contributed to chroma to some extent, contribution of yellow-blue chromaticity index b * was much greater in determining chroma in this Pd-free Au-Pt-based multi-component alloys. The present results are expected to be valuable in case color is to be taken into account in designing Pd-free Au-Pt-based high noble dental alloys

Variations of color with alloying elements in Pd-free Au-Pt-based high noble dental alloys

Energy Technology Data Exchange (ETDEWEB)

Shiraishi, Takanobu [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan)]. E-mail: siraisi@nagasaki-u.ac.jp; Takuma, Yasuko [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan); Miura, Eri [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan); Fujita, Takeshi [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan); Hisatsune, Kunihiro [Department of Dental and Biomedical Materials Science, Unit of Basic Medical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, 1-7-1 Sakamoto, Nagasaki 852-8588 (Japan)

2007-06-15

The effects of alloying addition of a small amount of base metals (In, Sn, Fe, Zn) on color variations in Pd-free Au-Pt-based high noble dental alloys were investigated in terms of rectilinear and polar color coordinates. The ternary Au-Pt-X (X = In, Sn, Fe, Zn) and quaternary Au-Pt-In-Y (Y = Sn, Fe, Zn) alloys were prepared from high purity component metals. The amount of alloying base metals, X and Y, were restricted up to 2 at.%. The alloying addition of a small amount of Fe, In, Sn, to a binary Au-10 at.% Pt alloy (referred to as AP10) effectively increased chroma, C *. On the other hand, the addition of Zn to the parent alloy AP10 did not change color coordinates greatly. The increase in chroma in the present Au-Pt-based high noble alloys was attributed to the increase in the slope of spectral reflectance curve at its absorption edge near 515 nm. It was found that the addition of a small amount of Fe to the parent alloy AP10 markedly increased lightness, L *, and the addition of Sn gave a very light tint of red to the parent alloy. Although red-green chromaticity index a * contributed to chroma to some extent, contribution of yellow-blue chromaticity index b * was much greater in determining chroma in this Pd-free Au-Pt-based multi-component alloys. The present results are expected to be valuable in case color is to be taken into account in designing Pd-free Au-Pt-based high noble dental alloys.

Effect of reversible hydrogen alloying and plastic deformation on microstructure development in titanium alloys

International Nuclear Information System (INIS)

Murzinova, M.A.

2011-01-01

Hydrogen leads to degradation in fracture-related mechanical properties of titanium alloys and is usually considered as a very dangerous element. Numerous studies of hydrogen interaction with titanium alloys showed that hydrogen may be considered not only as an impurity but also as temporary alloying element. This statement is based on the following. Hydrogen stabilizes high-temperature β-phase, leads to decrease in temperature of β→α transformation and extends (α + β )-phase field. The BCC β-phase exhibits lower strength and higher ductility in comparison with HCP α -phase. As a result, hydrogen improves hot workability of hard-to-deform titanium alloys. Hydrogen changes chemical composition of the phases, kinetics of phase transformations, and at low temperatures additional phase transformation (β→α + TiH 2 ) takes place, which is accompanied with noticeable change in volumes of phases. As a result, fine lamellar microstructure may be formed in hydrogenated titanium alloys after heat treatment. It was shown that controlled hydrogen alloying improves weldability and machinability of titanium alloys. After processing hydrogenated titanium preforms are subjected to vacuum annealing, and the hydrogen content decreases up to safe level. Hydrogen removal is accompanied with hydrides dissolution and β→α transformation that makes possible to control structure formation at this final step of treatment. Thus, reversible hydrogen alloying of titanium alloys allows to obtain novel microstructure with enhanced properties. The aim of the work was to study the effect of hydrogen on structure formation, namely: i) influence of hydrogen content on transformation of lamellar microstructure to globular one during deformation in (α+β)-phase field; ii) effect of dissolved hydrogen on dynamic recrystallization in single α- and β- phase regions; iii) influence of vacuum annealing temperature on microstructure development. The work was focused on the optimization of

Characteristics of mechanical alloying of Zn-Al-based alloys

International Nuclear Information System (INIS)

Zhu, Y.H.; Hong Kong Polytechnic; Perez Hernandez, A.; Lee, W.B.

2001-01-01

Three pure elemental powder mixtures of Zn-22%Al-18%Cu, Zn-5%Al-11%Cu, and Zn-27%Al-3%Cu (in wt.%) were mechanically alloyed by steel-ball milling processing. The mechanical alloying characteristics were investigated using X-ray diffraction, scanning electron microscopy, and transmission electron microscopy techniques. It was explored that mechanical alloying started with the formation of phases from pure elemental powders, and this was followed by mechanical milling-induced phase transformation. During mechanical alloying, phases stable at the higher temperatures formed at the near room temperature of milling. Nano-structure Zn-Al-based alloys were produced by mechanical alloying. (orig.)

40 CFR 133.102 - Secondary treatment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Secondary treatment. 133.102 Section... TREATMENT REGULATION § 133.102 Secondary treatment. The following paragraphs describe the minimum level of effluent quality attainable by secondary treatment in terms of the parameters—BOD5, SS and pH. All...

Effectiveness of Ti-micro alloying in relation to cooling rate on corrosion of AZ91 Mg alloy

International Nuclear Information System (INIS)

Candan, S.; Celik, M.; Candan, E.

2016-01-01

In this study, micro Ti-alloyed AZ91 Mg alloys (AZ91 + 0.5wt.%Ti) have been investigated in order to clarify effectiveness of micro alloying and/or cooling rate on their corrosion properties. Molten alloys were solidified under various cooling rates by using four stage step mold. The microstructural investigations were carried out by using scanning electron microscopy (SEM). Corrosion behaviors of the alloys were evaluated by means of immersion and electrochemical polarization tests in 3.5% NaCl solution. Results showed that the Mg 17 Al 12 (β) intermetallic phase in the microstructure of AZ91 Mg alloy formed as a net-like structure. The Ti addition has reduced the distribution and continuity of β intermetallic phase and its morphology has emerged as fully divorced eutectic. Compared to AZ91 alloy, the effect of the cooling rate in Ti-added alloy on the grain size was less pronounced. When AZ91 and its Ti-added alloys were compared under the same cooling conditions, the Ti addition showed notably high corrosion resistance. Electrochemical test results showed that while I corr values of AZ91 decrease with the increase in the cooling rate, the effect of the cooling rate on I corr values was much lower in the Ti-added alloy. The corrosion resistance of AZ91 Mg alloy was sensitive towards the cooling rates while Ti-added alloy was not affected much from the cooling conditions. - Highlights: • Effect the cooling rate on grain size was less pronounced in the Ti-added alloy. • The morphology of the β phase transformed into fully divorced eutectics. • Ti addition exhibited significantly higher corrosion resistance. • Ti micro alloying is more effective than faster cooling of the alloy on corrosion.

Effects of segregation of primary alloying elements on the creep response in magnesium alloys

DEFF Research Database (Denmark)

Huang, Y.D.; Dieringa, H.; Hort, N.

2008-01-01

The segregation of primary alloying elements deteriorates the high temperature creep resistance of magnesium alloys. Annealing at high temperatures alleviating their segregations can improve the creep resistance. Present investigation on the effect of segregation of primary alloying elements...... on the creep response may provide some useful information about how to improve the creep resistance of magnesium alloys in the future. (c) 2008 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved....

Dicty_cDB: SHL102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk

The effect of Mn and B on the magnetic and structural properties of nanostructured Fe60Al40 alloys produced by mechanical alloying.

Science.gov (United States)

Rico, M M; Alcázar, G A Pérez; Zamora, L E; González, C; Greneche, J M

2008-06-01

The effect of Mn and B on the magnetic and structural properties of nanostructured samples of the Fe60Al40 system, prepared by mechanical alloying, was studied by 57Fe Mössbauer spectrometry, X-ray diffraction and magnetic measurements. In the case of the Fe(60-x)Mn(x)Al40 system, 24 h milling time is required to achieve the BCC ternary phase. Different magnetic structures are observed according to the temperature and the Mn content for alloys milled during 48 h: ferromagnetic, antiferromagnetic, spin-glass, reentrant spin-glass and superparamagnetic behavior. They result from the bond randomness behaviour induced by the atomic disorder introduced by the MA process and from the competitive interactions of the Fe-Fe ferromagnetic interactions and the Mn-Mn and Fe-Mn antiferromagnetic interactions and finally the presence of Al atoms acting as dilutors. When B is added in the Fe60Al40 alloy and milled for 12 and 24 hours, two crystalline phases were found: a prevailing FeAl BCC phase and a Fe2B phase type. In addition, one observes an additional contribution attributed to grain boundaries which increases when both milling time and boron composition increase. Finally Mn and B were added to samples of the Fe60Al40 system prepared by mechanical alloying during 12 and 24 hours. Mn content was fixed to 10 at.% and B content varied between 0 and 20 at.%, substituting Al. X-ray patterns show two crystalline phases, the ternary FeMnAl BCC phase, and a (Fe,Mn)2B phase type. The relative proportion of the last phase increases when the B content increases, in addition to changes of the grain size and the lattice parameter. Such behavior was observed for both milling periods. On the other hand, the magnetic hyperfine field distributions show that both phases exhibit chemical disorder, and that the contribution attributed to the grain boundaries is less important when the B content increases. Coercive field values of about 10(2) Oe slightly increase with boron content

33 CFR 401.102 - Civil penalty.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Civil penalty. 401.102 Section... TRANSPORTATION SEAWAY REGULATIONS AND RULES Penalties-Violations of Seaway Regulations § 401.102 Civil penalty. (a) A person, as described in § 401.101(b), who violates a regulation is liable to a civil penalty of...

41 CFR 102-80.90 - Is the Fire Administration Authorization Act of 1992 (Public Law 102-522) relevant to fire...

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Fire Administration Authorization Act of 1992 (Public Law 102-522) relevant to fire protection engineering? 102-80.90 Section 102-80.90 Public Contracts and Property Management Federal Property Management Regulations System...

Identification of MPL R102P Mutation in Hereditary Thrombocytosis.

Science.gov (United States)

Bellanné-Chantelot, Christine; Mosca, Matthieu; Marty, Caroline; Favier, Rémi; Vainchenker, William; Plo, Isabelle

2017-01-01

The molecular basis of hereditary thrombocytosis is germline mutations affecting the thrombopoietin (TPO)/TPO receptor (MPL)/JAK2 signaling axis. Here, we report one family presenting two cases with a mild thrombocytosis. By sequencing JAK2 and MPL coding exons, we identified a germline MPL R102P heterozygous mutation in the proband and his daughter. Concomitantly, we detected high TPO levels in the serum of these two patients. The mutation was not found in three other unaffected cases from the family except in another proband's daughter who did not present thrombocytosis but had a high TPO level. The MPL R102P mutation was first described in congenital amegakaryocytic thrombocytopenia in a homozygous state with a loss-of-function activity. It was previously shown that MPL R102P was blocked in the endoplasmic reticulum without being able to translocate to the plasma membrane. Thus, this case report identifies for the first time that MPL R102P mutation can differently impact megakaryopoiesis: thrombocytosis or thrombocytopenia depending on the presence of the heterozygous or homozygous state, respectively. The paradoxical effect associated with heterozygous MPL R102P may be due to subnormal cell-surface expression of wild-type MPL in platelets inducing a defective TPO clearance. As a consequence, increased TPO levels may activate megakaryocyte progenitors that express a lower, but still sufficient level of MPL for the induction of proliferation.

Identification of MPL R102P Mutation in Hereditary Thrombocytosis

Directory of Open Access Journals (Sweden)

Christine Bellanné-Chantelot

2017-09-01

Full Text Available The molecular basis of hereditary thrombocytosis is germline mutations affecting the thrombopoietin (TPO/TPO receptor (MPL/JAK2 signaling axis. Here, we report one family presenting two cases with a mild thrombocytosis. By sequencing JAK2 and MPL coding exons, we identified a germline MPL R102P heterozygous mutation in the proband and his daughter. Concomitantly, we detected high TPO levels in the serum of these two patients. The mutation was not found in three other unaffected cases from the family except in another proband’s daughter who did not present thrombocytosis but had a high TPO level. The MPL R102P mutation was first described in congenital amegakaryocytic thrombocytopenia in a homozygous state with a loss-of-function activity. It was previously shown that MPL R102P was blocked in the endoplasmic reticulum without being able to translocate to the plasma membrane. Thus, this case report identifies for the first time that MPL R102P mutation can differently impact megakaryopoiesis: thrombocytosis or thrombocytopenia depending on the presence of the heterozygous or homozygous state, respectively. The paradoxical effect associated with heterozygous MPL R102P may be due to subnormal cell-surface expression of wild-type MPL in platelets inducing a defective TPO clearance. As a consequence, increased TPO levels may activate megakaryocyte progenitors that express a lower, but still sufficient level of MPL for the induction of proliferation.

Local atomic order in nanocrystalline Fe-based alloys obtained by mechanical alloying

International Nuclear Information System (INIS)

Jartych, E.

2003-01-01

Using the 57 Fe Moessbauer spectroscopy, a local atomic order in nanocrystalline alloys of iron with Al, Ni, W and Mo has been determined. Alloys were prepared by mechanical alloying method. Analysis of Moessbauer spectra was performed on the basis of the local environment model in terms of Warren-Cowley parameters. It was shown that impurity atoms are not randomly distributed in the volume of the first and the second co-ordination spheres of 57 Fe nuclei and they form clusters

Application of mechanical alloying to synthesis of intermetallic phases based alloys

International Nuclear Information System (INIS)

Dymek, S.

2001-01-01

Mechanical alloying is the process of synthesis of powder materials during milling in high energetic mills, usually ball mills. The central event in mechanical alloying is the ball-powder-ball collision. Powder particles are trapped between the colliding balls during milling and undergo deformation and/or fracture. Fractured parts are cold welded. The continued fracture and cold welding results in a uniform size and chemical composition of powder particles. The main applications of mechanical alloying are: processing of ODS alloys, syntheses of intermetallic phases, synthesis of nonequilibrium structures (amorphous alloys, extended solid solutions, nanocrystalline, quasi crystals) and magnetic materials. The present paper deals with application of mechanical alloying to synthesis Ni A l base intermetallic phases as well as phases from the Nb-Al binary system. The alloy were processed from elemental powders. The course of milling was monitored by scanning electron microscopy and X-ray diffraction. After milling, the collected powders were sieved by 45 μm grid and hot pressed (Nb alloys and NiAl) or hot extruded (NiAl). The resulting material was fully dense and exhibited fine grain (< 1 μm) and uniform distribution of oxide dispersoid. The consolidated material was compression and creep tested. The mechanical properties of mechanically alloys were superior to properties of their cast counterparts both in the room and elevated temperatures. Higher strength of mechanically alloyed materials results from their fine grains and from the presence of dispersoid. At elevated temperatures, the Nb-Al alloys have higher compression strength than NiAl-based alloys processed at the same conditions. The minimum creep rates of mechanically alloyed Nb alloys are an order of magnitude lower than analogously processed NiAl-base alloys. (author)

Microstructure of the Transitional Area of the Connection of a High-temperature Ni-based Brazing Alloy and Stainless Steel AISI 321 (X6CrNiTi 18–10

Directory of Open Access Journals (Sweden)

R. Augustin

2010-01-01

Full Text Available This paper presents a detailed examination of the structure of the transitional area between a brazing alloy and the parent material, the dimensions of the diffusion zones that are created, and the influence on them of a change in the brazing parameters. Connections between Ni-based brazing alloys (NI 102 with a small content of B and AISI 321 stainless steel (X6CrNiTi 18–10 were created in a vacuum (10−2 Pa at various brazing temperatures and for various holding times at the brazing temperature. Various specimens were tested. First, the brazing alloys were wetted and the dependence of the wetting on the brazing parameters was assessed. Then a chemical microanalysis was made of the interface between the brazing alloy and the parent material. The individual diffusion zones were identified on pictures from a light microscope and REM, and their dimensions, together with their dependence on the brazing parameters, were determined.

Enhancement of High Temperature Strength of 2219 Alloys Through Small Additions of Nb and Zr and a Novel Heat Treatment

Science.gov (United States)

Mondol, S.; Makineni, S. K.; Kumar, S.; Chattopadhyay, K.

2018-05-01

This paper presents a detailed investigation on the effect of small amount of Nb and Zr additions to 2219 Al alloy coupled with a novel three-stage heat treatment process. The main aim of the work is to increase the high temperature strength of 2219 alloy by introducing thermally stable L12 type ordered precipitates in the matrix as well as by reducing the coarsening of metastable strengthening θ″ and θ' precipitates. To achieve this, small amounts of Nb and Zr are added to 2219 alloy melt and retained in solid solution by suction casting in a water-cooled copper mould having a cooling rate of 102 to 103 K/s. The suction cast alloy is directly aged at 673 K (400 °C) to form L12 type ordered coherent Al3Zr precipitates. Subsequently, the alloy is solution treated at 808 K (535 °C) for 30 minutes to get supersaturation of Cu in the matrix without significantly affecting the Al3Zr precipitates. Finally, the alloy is aged at 473 K (200 °C), which results in the precipitation of θ″ and θ'. Microstructural characterization reveals that θ″ and θ' are heterogeneously precipitated on pre-existing uniformly distributed Al3Zr precipitates, which leads to a higher number density of these precipitates. This results in a significant increase in strength at room temperature as well as at 473 K (200 °C) as compared to the 2219 alloy. Furthermore, the alloy remains thermally stable after prolonged exposure at 473 K (200 °C), which is attributed to the elastic strain energy minimization by the conjoint Al3Zr/θ' or Al3Zr/θ″ precipitates, and the high Zr and Nb solute-vacancy binding energy, retarding the growth and coarsening of θ″ and θ' precipitates.

Phase formation in multicomponent monotectic aluminium alloys

Energy Technology Data Exchange (ETDEWEB)

Mirkovic, Djordje; Groebner, Joachim; Schmid-Fetzer, Rainer [Institute of Metallurgy, Clausthal University of Technology (Germany)

2008-07-01

Alloys with a miscibility gap in the liquid state are potential materials for advanced bearings in automotive and other applications. While binary alloys, such as Al-Pb or Al-Bi, are well known, the information available for ternary monotectic Al-alloys is scarce. However, the phase formation in multicomponent alloys is not only more challenging from a scientific aspect, it is also a prerequisite for a focused development of advanced alloys. This motivated our detailed study of monotectic Al-Bi-Cu-Sn alloys including both experimental and computational thermodynamic methods. Based on the initially established systematic classification of monotectic ternary Al-alloys, the first promising monotectic reaction was observed in the ternary Al-Bi-Zn system. Further ternary systems Al-Cu-Sn, Al-Bi-Sn, Al-Bi-Cu and Bi-Cu-Sn were investigated as basis for quaternary Al-Bi-Cu-Sn alloys. Experimental investigations of phase equilibria, enthalpies and solidification microstructures were combined with thermodynamic modeling. The results demonstrate that the developed precise thermodynamic description is vital to reveal the distinct multicomponent monotectic features of pertinent phase diagrams. The solidification paths of ternary monotectic alloy systems, Al-Bi-Zn, Al-Sn-Cu and Al-Bi-Cu, were also studied using thermodynamic calculations, revealing specific details of phase formation during solidification of selected alloys.

5 CFR 880.102 - Regulatory structure.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 880.102 Section 880.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... Regulatory structure. (a) This part contains the following subparts: (1) Subpart A contains general...

Effect of Al alloying on the martensitic temperature in Ti-Ta shape memory alloys

Energy Technology Data Exchange (ETDEWEB)

Ferrari, Alberto; Rogal, Jutta; Drautz, Ralf [Interdisciplinary Centre for Advanced Materials Simulation, Ruhr-Universitaet Bochum (Germany)

2017-07-01

Ti-Ta-based alloys are promising candidates as high temperature shape memory alloys (HTSMAs) for actuators and superelastic applications. The shape memory mechanism involves a martensitic transformation between the low-temperature α'' phase (orthorhombic) and the high-temperature β phase (body-centered cubic). In order to prevent the degradation of the shape memory effect, Ti-Ta needs to be alloyed with further elements. However, this often reduces the martensitic temperature M{sub s}, which is usually strongly composition dependent. The aim of this work is to analyze how the addition of a third element to Ti-Ta alloys affects M{sub s} by means of electronic structure calculations. In particular, it will be investigated how alloying Al to Ti-Ta alters the relative stability of the α'' and β phases. This understanding will help to identify new alloy compositions featuring both a stable shape memory effect and elevated transformation temperatures.

38 CFR 13.102 - Accountability of legal custodians.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Accountability of legal custodians. 13.102 Section 13.102 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS VETERANS BENEFITS ADMINISTRATION, FIDUCIARY ACTIVITIES § 13.102 Accountability of legal custodians. (a...

Magnetoimpedance effect in Nanoperm alloys

International Nuclear Information System (INIS)

Hernando, B.; Alvarez, P.; Santos, J.D.; Gorria, P.; Sanchez, M.L.; Olivera, J.; Perez, M.J.; Prida, V.M.

2006-01-01

The influence of isothermal annealing (1 h at 600 deg. C in Ar atmosphere) on the soft magnetic properties and magnetoimpedance (MI) effect has been studied in ribbons of the following Nanoperm alloys: Fe 91 Zr 7 B 2 , Fe 88 Zr 8 B 4 , Fe 87 Zr 6 B 6 Cu 1 and Fe 8 Zr 1 B 1 . A maximum MI ratio of about 27% was measured for the nanocrystalline alloy Fe 87 Zr 6 B 6 Cu 1 at a driving frequency of 0.2 MHz. The thermal annealing led to magnetic softening for this alloy, while a hardening is observed for the Fe 8 Zr 1 B 1 alloy

18 CFR 284.102 - Transportation by interstate pipelines.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Transportation by interstate pipelines. 284.102 Section 284.102 Conservation of Power and Water Resources FEDERAL ENERGY... 1978 AND RELATED AUTHORITIES Certain Transportation by Interstate Pipelines § 284.102 Transportation by...

29 CFR 1918.102 - Respiratory protection.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Respiratory protection. 1918.102 Section 1918.102 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... Respiratory protection. (See § 1918.1(b)(8)). [65 FR 40946, June 30, 2000] ...

13 CFR 102.41 - Other provisions.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Other provisions. 102.41 Section 102.41 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... the preservation of the constitutional principles of federalism and separation of powers. (d) Medical...

Stress corrosion in high-strength aluminum alloys

Science.gov (United States)

Dorward, R. C.; Hasse, K. R.

1980-01-01

Report describes results of stress-corrosion tests on aluminum alloys 7075, 7475, 7050, and 7049. Tests compare performance of original stress-corrosion-resistant (SCR) aluminum, 7075, with newer, higher-strength SCR alloys. Alloys 7050 and 7049 are found superior in short-transverse cross-corrosion resistance to older 7075 alloy; all alloys are subject to self-loading effect caused by wedging of corrosion products in cracks. Effect causes cracks to continue to grow, even at very-low externally applied loads.

The quasicrystalline phase formation in Al-Cu-Cr alloys produced by mechanical alloying

Energy Technology Data Exchange (ETDEWEB)

Sviridova, T.A.; Shevchukov, A.P.; Shelekhov, E.V. [National University of Science and Technology ' MISIS' , Moscow 119049 (Russian Federation); Diakonov, D.L. [Bardin Central Research Institute for the Iron and Steel Industry, Moscow 105005 (Russian Federation); Tcherdyntsev, V.V.; Kaloshkin, S.D. [National University of Science and Technology ' MISIS' , Moscow 119049 (Russian Federation)

2011-06-15

Research highlights: > Formation of decagonal quasicrystalline phase in Al-Cu-Cr alloys. > Obtained decagonal phase belongs to D{sub 3} family of decagonal quasicrystals. > Decagonal phase has 1.26 nm periodicity along 10-fold axis. > Alloys were produced by combination of mechanical alloying and subsequent annealing. > Phase composition of as-milled powders depending on annealing temperature. - Abstract: Almost single-phase decagonal quasicrystal with periodicity of 1.26 nm along 10-fold axis was produced in Al{sub 69}Cu{sub 21}Cr{sub 10} and Al{sub 72.5}Cu{sub 16.5}Cr{sub 11} alloys using combination of mechanical alloying (MA) and subsequent annealing. Phase transformations of as-milled powders depending on annealing temperature in the range of 200-800 deg. C are examined. Since the transformations can be explained based on kinetic and thermodynamic reasons it seems that applied technique (short preliminary MA followed by the annealing) permits to produce the equilibrium phases rather than metastable ones.

41 CFR 109-27.102-50 - Systems contracting.

Science.gov (United States)

2010-07-01

...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...

Recent developments in advanced aircraft aluminium alloys

International Nuclear Information System (INIS)

Dursun, Tolga; Soutis, Costas

2014-01-01

Highlights: • To compete with composites, performance of aluminium alloys should be increased. • Al–Li alloys have higher strength, fracture and fatigue/corrosion resistance. • Improvements of aerospace Al alloys are due to optimised solute content and ratios. • In selecting new materials, there should be no reduction in the level of safety. • The use of hybrid materials could provide additional opportunities for Al alloys. - Abstract: Aluminium alloys have been the primary material for the structural parts of aircraft for more than 80 years because of their well known performance, well established design methods, manufacturing and reliable inspection techniques. Nearly for a decade composites have started to be used more widely in large commercial jet airliners for the fuselage, wing as well as other structural components in place of aluminium alloys due their high specific properties, reduced weight, fatigue performance and corrosion resistance. Although the increased use of composite materials reduced the role of aluminium up to some extent, high strength aluminium alloys remain important in airframe construction. Aluminium is a relatively low cost, light weight metal that can be heat treated and loaded to relatively high level of stresses, and it is one of the most easily produced of the high performance materials, which results in lower manufacturing and maintenance costs. There have been important recent advances in aluminium aircraft alloys that can effectively compete with modern composite materials. This study covers latest developments in enhanced mechanical properties of aluminium alloys, and high performance joining techniques. The mechanical properties on newly developed 2000, 7000 series aluminium alloys and new generation Al–Li alloys are compared with the traditional aluminium alloys. The advantages and disadvantages of the joining methods, laser beam welding and friction stir welding, are also discussed

Mechanical alloying in the Fe-Cu system

DEFF Research Database (Denmark)

Jiang, Jianzhong; Gente, C.; Bormann, R.

1998-01-01

The studies of mechanical alloying on the Fe-Cu system, as a model system for those with positive heats of mixing, are reviewed. Several problems involved in the mechanical alloying process are discussed. For example, (1) whether alloying occurs on an atomic level; (2) what the solid solubility...... in the Fe-Cu system is; (3) where the positive energy is stored in the alloys; (4) what the decomposition process of the supersaturated alloys is; and (5) what type of magnetic properties the new materials have. The elucidation of these problems will shed light on the understanding of the mechanisms...... for the preparation of materials under highly non-equilibrium conditions in systems with positive heats of mixing by mechanical alloying....

41 CFR 102-117.200 - What is HAZMAT?

Science.gov (United States)

2010-07-01

... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...

26 CFR 1.102-1 - Gifts and inheritances.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Gifts and inheritances. 1.102-1 Section 1.102-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Excluded from Gross Income § 1.102-1 Gifts and inheritances...

42 CFR 102.82 - Calculation of death benefits.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of death benefits. 102.82 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.82 Calculation of death benefits. (a... paragraph (d) of this section for the death benefit available to dependents. (2) Deceased person means an...

Synthesis Of NiCrAlC alloys by mechanical alloying

International Nuclear Information System (INIS)

Silva, A.K.; Pereira, J.I.; Vurobi Junior, S.; Cintho, O.M.

2010-01-01

The purpose of the present paper is the synthesis of nickel alloys (NiCrAlC), which has been proposed like a economic alternative to the Stellite family Co alloys using mechanical alloying, followed by sintering heat treatment of milled material. The NiCrAlC alloys consist of a chromium carbides dispersion in a Ni 3 Al intermetallic matrix, that is easily synthesized by mechanical alloying. The use of mechanical alloying enables higher carbides sizes and distribution control in the matrix during sintering. We are also investigated the compaction of the processed materials by compressibility curves. The milling products were characterized by X-ray diffraction, and the end product was featured by conventional metallography and scanning electronic microscopy (SEM), that enabled the identification of desired phases, beyond microhardness test, which has been shown comparable to alloys manufactured by fusion after heat treating. (author)

Electrodeposition of Al-Mn alloy on AZ31B magnesium alloy in molten salts

International Nuclear Information System (INIS)

Zhang Jifu; Yan Chuanwei; Wang Fuhui

2009-01-01

The Al-Mn alloy coatings were electrodeposited on AZ31B Mg alloy in AlCl 3 -NaCl-KCl-MnCl 2 molten salts at 170 deg. C aiming to improve the corrosion resistance. However, in order to prevent AZ31B Mg alloy from corrosion during electrodeposition in molten salts and to ensure excellent adhesion of coatings to the substrate, AZ31B Mg alloy should be pre-plated with a thin zinc layer as intermediate layer. Then the microstructure, composition and phase constituents of the coatings were investigated by scanning electron microscopy (SEM), energy-dispersive X-ray spectrometry (EDX), and X-ray diffraction (XRD). It was indicated that, by adjusting the MnCl 2 content in the molten salts from 0.5 wt% to 2 wt%, the Mn content in the alloy coating was increased and the phase constituents were changed from f.c.c Al-Mn solid solution to amorphous phase. The corrosion resistance of the coatings was evaluated by potentiodynamic polarization measurements in 3.5% NaCl solution. It was confirmed that the Al-Mn alloy coatings exhibited good corrosion resistance with a chear passive region and significantly reduced corrosion current density at anodic potentiodynamic polarization. The corrosion resistance of the alloy coatings was also related with the microstructure and Mn content of the coatings.

Thermofluency in zirconium alloys

International Nuclear Information System (INIS)

Orozco M, E.A.

1976-01-01

A summary is presented about the theoretical and experimental results obtained at present in thermofluency under radiation in zirconium alloys. The phenomenon of thermofluency is presented in a general form, underlining the thermofluency at high temperature because this phenomenon is similar to the thermofluency under radiation, which ocurrs in zirconium alloys into the operating reactor. (author)

19 CFR 102.23 - Origin and Manufacturer Identification

Science.gov (United States)

2010-04-01

... Section 102.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... address of the entity performing the origin-conferring operations pursuant to § 102.21 or § 102.22, as... product from CBP custody will be denied until a determination of the country of origin is made based upon...

42 CFR 102.83 - Payment of all benefits.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Payment of all benefits. 102.83 Section 102.83... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.83 Payment of all benefits. (a) The Secretary may pay any benefits under this Program through lump-sum payments. If the Secretary determines that...

Recent advances in alloy design of Ni{sub 3}Al alloys for structural use

Energy Technology Data Exchange (ETDEWEB)

Liu, C.T.; George, E.P.

1996-12-31

This is a comprehensive review of recent advances in R&D of Ni{sub 3}Al-based alloys for structural use at elevated temperatures in hostile environments. Recent studies indicate that polycrystalline Ni{sub 3}Al is intrinsically quite ductile at ambient temperatures, and its poor tensile ductility and brittle grain-boundary fracture are caused mainly by moisture-induced hydrogen embrittlement when the aluminide is tested in moisture- or hydrogen-containing environments. Tensile ductility is improved by alloying with substitutional and interstitial elements. Among these additives, B is most effective in suppressing environmental embrittlement and enhancing grain-boundary cohesion, resulting in a dramatic increase of tensile ductility at room temperature. Both B-doped and B-free Ni{sub 3}Al alloys exhibit brittle intergranular fracture and low ductility at intermediate temperatures (300-850 C) because of oxygen-induced embrittlement in oxidizing environments. Cr is found to be most effective in alleviating elevated-temperature embrittlement. Parallel efforts on alloy development using physical metallurgy principles have led to development of several Ni{sub 3}Al alloys for industrial use. The unique properties of these alloys are briefly discussed. 56 refs, 15 figs, 3 tabs.

NKTR-102 Efficacy versus irinotecan in a mouse model of brain metastases of breast cancer

International Nuclear Information System (INIS)

Adkins, Chris E.; Nounou, Mohamed I.; Hye, Tanvirul; Mohammad, Afroz S.; Terrell-Hall, Tori; Mohan, Neel K.; Eldon, Michael A.; Hoch, Ute; Lockman, Paul R.

2015-01-01

Brain metastases are an increasing problem in women with invasive breast cancer. Strategies designed to treat brain metastases of breast cancer, particularly chemotherapeutics such as irinotecan, demonstrate limited efficacy. Conventional irinotecan distributes poorly to brain metastases; therefore, NKTR-102, a PEGylated irinotecan conjugate should enhance irinotecan and its active metabolite SN38 exposure in brain metastases leading to brain tumor cytotoxicity. Female nude mice were intracranially or intracardially implanted with human brain seeking breast cancer cells (MDA-MB-231Br) and dosed with irinotecan or NKTR-102 to determine plasma and tumor pharmacokinetics of irinotecan and SN38. Tumor burden and survival were evaluated in mice treated with vehicle, irinotecan (50 mg/kg), or NKTR-102 low and high doses (10 mg/kg, 50 mg/kg respectively). NKTR-102 penetrates the blood-tumor barrier and distributes to brain metastases. NKTR-102 increased and prolonged SN38 exposure (>20 ng/g for 168 h) versus conventional irinotecan (>1 ng/g for 4 h). Treatment with NKTR-102 extended survival time (from 35 days to 74 days) and increased overall survival for NKTR-102 low dose (30 % mice) and NKTR-102 high dose (50 % mice). Tumor burden decreased (37 % with 10 mg/kg NKTR-102 and 96 % with 50 mg/kg) and lesion sizes decreased (33 % with 10 mg/kg NKTR-102 and 83 % with 50 mg/kg NKTR-102) compared to conventional irinotecan treated animals. Elevated and prolonged tumor SN38 exposure after NKTR-102 administration appears responsible for increased survival in this model of breast cancer brain metastasis. Further, SN38 concentrations observed in this study are clinically achieved with 145 mg/m 2 NKTR-102, such as those used in the BEACON trial, underlining translational relevance of these results. The online version of this article (doi:10.1186/s12885-015-1672-4) contains supplementary material, which is available to authorized users

Irradiation effects in magnesium and aluminium alloys

International Nuclear Information System (INIS)

Sturcken, E.F.

1979-01-01

Effects of neutron irradiation on microstructure, mechanical properties and swelling of several magnesium and aluminium alloys were studied. The neutron fluences of 2-3 X 10 22 n/cm 2 , >0.2 MeV produced displacement doses of 20 to 45 displacements per atom (dpa). Ductility of the magnesium alloys was severely reduced by irradiation induced recrystallization and precipitation of various forms. Precipitation of transmuted silicon occurred in the aluminium alloys. However, the effect on ductility was much less than for the magnesium alloys. The magnesium and aluminium alloys had excellent resistance to swelling: The best magnesium alloy was Mg/3.0 wt% Al/0.19 wt% Ca; its density decreased by only 0.13%. The best aluminium alloy was 6063, with a density decrease of 0.22%. (Auth.)

12 CFR 263.102 - Prevailing party.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Prevailing party. 263.102 Section 263.102 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES... Prevailing party. Only an eligible applicant that prevailed on the merits of an adversary proceeding may...

29 CFR 1926.102 - Eye and face protection.

Science.gov (United States)

2010-07-01

... spectacles, when required by this regulation to wear eye protection, shall be protected by goggles or... 29 Labor 8 2010-07-01 2010-07-01 false Eye and face protection. 1926.102 Section 1926.102 Labor... § 1926.102 Eye and face protection. (a) General. (1) Employees shall be provided with eye and face...

42 CFR 84.102 - Man test 6; requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Man test 6; requirements. 84.102 Section 84.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.102 Man test 6; requirements....

Applications of shape memory alloys in Japan

International Nuclear Information System (INIS)

Asai, M.; Suzuki, Y.

2000-01-01

In Japan, a first application of shape memory TiNi alloy was a moving flap in an air-conditioner which was developed as sensing function of shape memory alloy at Matsushista Electric Industrial Co. Then, shape memory utilized in a coffee maker, an electric rice-cooker, a thermal mixing valve and etc. were commercialized in Japan. And brassiere wires, a guide wire for medical treatment, an antenna for portable telephone and others were commercialized utilizing superelasticity. At the same time with these commercial products, there was not only progress in fabrication technology to effect accurate transformation temperature, but also the discovery of small hysteresis alloy such as R-phase or TiNiCu alloy and low transformation temperature alloy such as TiNiFe, TiNiV and TiNiCo alloys. Therefore the shape memory alloy market has expanded widely to electric appliances, automobile, residence, medical care and other field today. (orig.)

13 CFR 102.2 - Public reading rooms.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public reading rooms. 102.2 Section 102.2 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... described in paragraph (a) of this section are available in the SBA Online Reading Room at http://www.sba...

Determination of local constitutive properties of titanium alloy matrix in boron-modified titanium alloys using spherical indentation

International Nuclear Information System (INIS)

Sreeranganathan, A.; Gokhale, A.; Tamirisakandala, S.

2008-01-01

The constitutive properties of the titanium alloy matrix in boron-modified titanium alloys are different from those of the corresponding unreinforced alloy due to the microstructural changes resulting from the addition of boron. Experimental and finite-element analyses of spherical indentation with a large penetration depth to indenter radius ratio are used to compute the local constitutive properties of the matrix alloy. The results are compared with that of the corresponding alloy without boron, processed in the same manner

Surface modification of 5083 Al alloy by electrical discharge alloying processing with a 75 mass% Si-Fe alloy electrode

Energy Technology Data Exchange (ETDEWEB)

Stambekova, Kuralay [Department of Materials Science and Engineering, National Chung Hsing University, 250 Kuo-Kuang Rd., Taichung 40227, Taiwan (China); Lin, Hung-Mao [Department of Mechanical Engineering, Far East University, No. 49, Zhonghua Rd., Xinshi Dist., Tainan City 74448, Taiwan (China); Uan, Jun-Yen, E-mail: jyuan@dragon.nchu.edu.tw [Department of Materials Science and Engineering, National Chung Hsing University, 250 Kuo-Kuang Rd., Taichung 40227, Taiwan (China)

2012-03-01

This study experimentally investigates the surface modification of 5083 Al alloy by the electrical discharge alloying (EDA) process with a Si-Fe alloy as an electrode. Samples were analyzed by transmission electron microscopy (TEM), scanning electron microscopy (SEM), micro-hardness and corrosion resistance tests. The micro-hardness of EDA alloyed layer was evidently higher than that of the base metal (5083 Al alloy). The TEM results show that the matrix of the alloyed layer has an amorphous-like structure; the matrix contains fine needle-like Si particles, block-like Si particles and nano-size Al{sub 4.5}FeSi and Al{sub 13}Fe{sub 4} particles. The TEM results support experimental results for the high hardness of the alloyed layer. Moreover, the EDA alloyed layer with composite microstructures has good corrosion resistance in NaCl aqueous solution.

Microstructural characterization of spray formed Fe-based amorfizable alloy; Caracterizacao microestrutural de ligas ferrosas amorfizaveis processadas por conformacao por spray

Energy Technology Data Exchange (ETDEWEB)

Gabriel, A.H.G.; Ananias, M.Jr. da S.; Lucena, F.A.; Santos, L.S. dos; Bolfarini, C.; Botta, W.J.; Kiminami, C.S.; Afonso, C.R.M., E-mail: guimaraes.andreh@gmail.com [Universidade Federal de Sao Carlos (UFSCar), Sao Carlos, SP (Brazil)

2014-07-01

Iron-based amorphous alloys show outstanding characteristics such as high hardness and wear resistance, with microstructure partially amorphous, making them favorable to spray forming process (SF), which has cooling rates between 10{sup 3}-10{sup 5} K/s. Thus, this work aims to use the SF in one of the alloy cast iron present in this project, being chosen the alloy with a better set of results, through the performed characterizations. The alloys studied in this project were: (Fe{sub 65}Cr{sub 17}Mo{sub 2}C{sub 14}Si{sub 1}Cu{sub 1}){sub 100-x}B{sub x} (x = 5, 8 and 12% at) and (Fe{sub 65}Cr{sub 17}Mo{sub 2}C{sub 14}Si{sub 1}Cu{sub 1}){sub 88}Nb{sub 4}B{sub 8} (at.%), being all processed through Discovery® Plasma and 'melt- spinning' and characterized using: TEM, SEM, DSC, XRD and microhardness test. The cast iron alloy selected were (Fe{sub 65}Cr{sub 17}Mo{sub 2}C{sub 14}Si{sub 1}Cu{sub 1}){sub 88}Nb{sub 4}B+8, getting by the spray forming process, deposit and overspray powder. With them, were realized almost the same characterizations, except for the TEM. The results showed 1044±102 (HV1) in Vickers microhardness and nanocrystalline overspray powder from 20-45 μm to > 180 μm. (author)

Metal-ceramic alloys in dentistry: a review.

Science.gov (United States)

Roberts, Howard W; Berzins, David W; Moore, B Keith; Charlton, David G

2009-02-01

The purpose of this article is to review basic information about the alloys used for fabricating metal-ceramic restorations in dentistry. Their compositions, properties, advantages, and disadvantages are presented and compared. In addition to reviewing traditional noble-metal and base-metal metal-ceramic alloys, titanium and gold composite alloys are also discussed. A broad search of the published literature was performed using Medline to identify pertinent current articles on metal-ceramic alloys as well as articles providing a historical background about the development of these alloys. Textbooks, the internet, and manufacturers' literature were also used to supplement this information. The review discusses traditional as well as more recently-developed alloys and technologies used in dentistry for fabricating metal-ceramic restorations. Clear advantages and disadvantages for these alloy types are provided and discussed as well as the role that compositional variations have on the alloys' performance. This information should enable clinicians and technicians to easily identify the important physical properties of each type and their primary clinical indications. A number of alloys and metals are available for metal-ceramic use in dentistry. Each has its advantages and disadvantages, primarily based on its specific composition. Continuing research and development are resulting in the production of new technologies and products, giving clinicians even more choices in designing and fabricating metal-ceramic restorations.

29 CFR 102.115 - Certification of papers and documents.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Certification of papers and documents. 102.115 Section 102... Certification and Signature of Documents § 102.115 Certification of papers and documents. The executive... Board in his place and stead shall certify copies of all papers and documents which are a part of any of...

48 CFR 1.102-3 - Acquisition team.

Science.gov (United States)

2010-10-01

... service. By identifying the team members in this manner, teamwork, unity of purpose, and open... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Acquisition team. 1.102-3... ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1.102-3 Acquisition team. The purpose of defining...

Spectroscopy of the odd-odd chiral candidate nucleus 102Rh

Directory of Open Access Journals (Sweden)

Yavahchova M.S.

2014-03-01

Full Text Available Excited states in 102Rh were populated in the fusion-evaporation reaction 94Zr(11B, 3n102Rh at a beam energy of 36 MeV, using the INGA spectrometer at IUAC, New Delhi. The angular correlations and the electromagnetic character of some of the 03B3-ray transitions observed in 102Rh were investigated in detail. A new candidate for achiral twin band was identified in 102Rh for the first time.

13 CFR 102.9 - Public Index.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public Index. 102.9 Section 102.9 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY Disclosure of... latest edition of SOP 40 03 from SBA's Online Reading Room at http://www.sba.gov/library or by requesting...

Mapping glaucoma patients' 30-2 and 10-2 visual fields reveals clusters of test points damaged in the 10-2 grid that are not sampled in the sparse 30-2 grid.

Directory of Open Access Journals (Sweden)

Ryo Asaoka

Full Text Available PURPOSE: To cluster test points in glaucoma patients' 30-2 and 10-2 visual field (VF (Humphrey Field Analyzer: HFA, Carl Zeiss Meditec, Dublin, CA in order to map the different regions damaged by the disease. METHOD: This retrospective study included 128 eyes from 128 patients. 142 total deviation (TD values (74 from the 30-2 VF and 68 from the 10-2 VF were clustered using the 'Hierarchical Ordered Partitioning And Collapsing Hybrid-Partitioning Around Medoids' algorithm. The stability of the identified clusters was evaluated using bootstrapping. RESULTS: 65 sectors were identified in total: 38 sectors were located outside the 10-2 VF whereas 29 sectors were located inside the 10-2 VF (two sectors overlap in both grids. The mapping of many sectors appeared to follow the distribution of retinal nerve fiber bundles. The results of bootstrapping suggested clusters were stable whether they were outside or inside the 10-2 VF. CONCLUSION: A considerable number of sectors were identified in the 10-2 VF area, despite the fact that clustering was carried out on all points in both the 30-2 VF and 10-2 VF simultaneously. These findings suggest that glaucomatous central VF deterioration cannot be picked up by the 30-2 test grid alone, because of poor spatial sampling; denser estimation of the central ten degrees, than offered by the 30-2 test grid alone, is needed. It may be beneficial to develop a new VF test grid that combines test points from 30-2 and 10-2 VFs--the results of this study could help to devise this test grid.

42 CFR 489.102 - Requirements for providers.

Science.gov (United States)

2010-10-01

..., nursing facilities, home health agencies, providers of home health care (and for Medicaid purposes... individual's admission as a resident. (3)(i) In the case of a home health agency, in advance of the... 42 Public Health 5 2010-10-01 2010-10-01 false Requirements for providers. 489.102 Section 489.102...

22 CFR 102.25 - Submission of comments.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Submission of comments. 102.25 Section 102.25 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION Recommendations to the... confidential in the interest of national defense or foreign policy, are to be placed in a public docket and...

Shape-memory effect in Ti-Nb alloys

International Nuclear Information System (INIS)

Peradze, T.; Berikashvili, T.; Chelidze, T.; Gorgadze, K.; Bochorishvili, M.; Taktakishvili, M.

2009-01-01

The work deals with the investigation of the binary alloy of titanium with niobium and is aimed at demonstrating the functional-mechanical possibilities of Ti-Nb alloys from the viewpoint of their potential application in practice. The shape-memory effect, super elasticity and reactive stress in alloys of Ti-Nb system were studied. It turned out that the work carried out expanded the interval of Nb content in the investigated alloys from 25.9 to 33.1 wt%. The shape recovery made up not less than 90% at the deformation of 6-8%. The reactive stress reached 350-450 MPa. In the alloys under study another (high-temperature) shape-memory effect was found, and the influence of hydrogen and oxygen on the inelastic properties of alloys was studied. (author)

Aluminum fin-stock alloys

International Nuclear Information System (INIS)

Gul, R.M.; Mutasher, F.

2007-01-01

Aluminum alloys have long been used in the production of heat exchanger fins. The comparative properties of the different alloys used for this purpose has not been an issue in the past, because of the significant thickness of the finstock material. However, in order to make fins lighter in weight, there is a growing demand for thinner finstock materials, which has emphasized the need for improved mechanical properties, thermal conductivity and corrosion resistance. The objective of this project is to determine the effect of iron, silicon and manganese percentage increment on the required mechanical properties for this application by analyzing four different aluminum alloys. The four selected aluminum alloys are 1100, 8011, 8079 and 8150, which are wrought non-heat treatable alloys with different amount of the above elements. Aluminum alloy 1100 serve as a control specimen, as it is commercially pure aluminum. The study also reports the effect of different annealing cycles on the mechanical properties of the selected alloys. Metallographic examination was also preformed to study the effect of annealing on the precipitate phases and the distribution of these phases for each alloy. The microstructure analysis of the aluminum alloys studied indicates that the precipitated phase in the case of aluminum alloys 1100 and 8079 is beta-FeAI3, while in 8011 it is a-alfa AIFeSi, and the aluminum alloy 8150 contains AI6(Mn,Fe) phase. The comparison of aluminum alloys 8011 and 8079 with aluminum alloy 1100 show that the addition of iron and silicon improves the percent elongation and reduces strength. The manganese addition increases the stability of mechanical properties along the annealing range as shown by the comparison of aluminum alloy 8150 with aluminum alloy 1100. Alloy 8150 show superior properties over the other alloys due to the reaction of iron and manganese, resulting in a preferable response to thermal treatment and improved mechanical properties. (author)

Modular titanium alloy neck adapter failures in hip replacement - failure mode analysis and influence of implant material

Directory of Open Access Journals (Sweden)

Bloemer Wilhelm

2010-01-01

Full Text Available Abstract Background Modular neck adapters for hip arthroplasty stems allow the surgeon to modify CCD angle, offset and femoral anteversion intraoperatively. Fretting or crevice corrosion may lead to failure of such a modular device due to high loads or surface contamination inside the modular coupling. Unfortunately we have experienced such a failure of implants and now report our clinical experience with the failures in order to advance orthopaedic material research and joint replacement surgery. The failed neck adapters were implanted between August 2004 and November 2006 a total of about 5000 devices. After this period, the titanium neck adapters were replaced by adapters out of cobalt-chromium. Until the end of 2008 in total 1.4% (n = 68 of the implanted titanium alloy neck adapters failed with an average time of 2.0 years (0.7 to 4.0 years postoperatively. All, but one, patients were male, their average age being 57.4 years (36 to 75 years and the average weight 102.3 kg (75 to 130 kg. The failures of neck adapters were divided into 66% with small CCD of 130° and 60% with head lengths of L or larger. Assuming an average time to failure of 2.8 years, the cumulative failure rate was calculated with 2.4%. Methods A series of adapter failures of titanium alloy modular neck adapters in combination with a titanium alloy modular short hip stem was investigated. For patients having received this particular implant combination risk factors were identified which were associated with the occurence of implant failure. A Kaplan-Meier survival-failure-analysis was conducted. The retrieved implants were analysed using microscopic and chemical methods. Modes of failure were simulated in biomechanical tests. Comparative tests included modular neck adapters made of titanium alloy and cobalt chrome alloy material. Results Retrieval examinations and biomechanical simulation revealed that primary micromotions initiated fretting within the modular tapered neck

Corrosion resistant alloy uses in the power industry

International Nuclear Information System (INIS)

Nickerson, J.L.; Hall, F.A.; Asphahani, A.I.

1989-01-01

Nickel-base alloys have been used as cost-effective measures in a variety of severely corrosive situations in pollution control units for coal-fired power plants. Cost effectiveness and practical answers to corrosion problems are illustrated (specifically the wallpaper concept/metallic lining technique). Numerous cases of successful use of HASTELLOY alloys in Flue Gas Desulfurization (FGD) systems and hazardous waste treatment incineration scrubber systems are listed. In this paper developments in nickel-base alloys and their use in FGD and other segments of the power industry are discussed. In the Ni-Cr-Mo-W alloy family, the C-22 alloy has the best resistance to localized corrosion in halide environments (chloride/fluoride-containing solutions). This alloy is also used effectively as a universal filler metal to weld less-resistant alloys were weld corrosion may be a problem. Field performance of this alloy in the power industry is described

Biocompatibility of dental alloys

Energy Technology Data Exchange (ETDEWEB)

Braemer, W. [Heraeus Kulzer GmbH and Co. KG, Hanau (Germany)

2001-10-01

Modern dental alloys have been used for 50 years to produce prosthetic dental restorations. Generally, the crowns and frames of a prosthesis are prepared in dental alloys, and then veneered by feldspar ceramics or composites. In use, the alloys are exposed to the corrosive influence of saliva and bacteria. Metallic dental materials can be classified as precious and non-precious alloys. Precious alloys consist of gold, platinum, and small amounts of non-precious components such as copper, tin, or zinc. The non-precious alloys are based on either nickel or cobalt, alloyed with chrome, molybdenum, manganese, etc. Titanium is used as Grade 2 quality for dental purposes. As well as the dental casting alloys, high purity electroplated gold (99.8 wt.-%) is used in dental technology. This review discusses the corrosion behavior of metallic dental materials with saliva in ''in vitro'' tests and the influence of alloy components on bacteria (Lactobacillus casei and Streptococcus mutans). The test results show that alloys with high gold content, cobalt-based alloys, titanium, and electroplated gold are suitable for use as dental materials. (orig.)

Electromagnetic properties of low-spin states in 102,104Pd

International Nuclear Information System (INIS)

Luontama, M.; Julin, R.; Kantele, J.; Passoja, A.; Trzaska, W.; Baecklin, A.; Jonsson, N.G.; Westerberg, L.

1985-12-01

Electromagnetic transitions from low-lying 0 + , 2 + , 4 + and 3 - states in 102 , 104 Pd have been studied with (p,2n) and (p,p) reactions and with Coulomb excitation. The E2 transition probabilities from the 0 3 + state in 102 Pd (13 W.u.) and from the 0 2 + state in 104 Pd (14 W.u.) are somewhat low for two-phonon states. Generally, the E2 transition rates are reasonably well reproduced by the IBA-2 and by the boson-expansion description. The intruding 0 2 + state (tsub(1/2) = 14.3 ns) in 102 Pd is connected to the 2 2 + and 2 3 + states via strong E2 transitions: B(E2;0 2 + →2 2 + )=96+-40 W.u.; B(E2;2 3 + →0 2 + )=17+-8 W.u

29 CFR 102.125 - Action on petition.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Action on petition. 102.125 Section 102.125 Labor....125 Action on petition. Upon the filing of such petition, the Board shall consider the same and may thereupon either grant or deny the petition in whole or in part, conduct an appropriate hearing thereon, or...

48 CFR 232.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 232.102 Section 232.102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 232.102 Description of contract financing methods. (e)(2) Progress payments...

High-temperature deformation of a mechanically alloyed niobium-yttria alloy

International Nuclear Information System (INIS)

Chou, I.; Koss, D.A.; Howell, P.R.; Ramani, A.S.

1997-01-01

Mechanical alloying (MA) and hot isostatic pressing have been used to process two Nb alloys containing yttria particles, Nb-2 vol.%Y 2 O 3 and Nb-10 vol.%Y 2 O 3 . Similar to some thermomechanically processed nickel-based alloys, both alloys exhibit partially recrystallized microstructures, consisting of a 'necklace' of small recrystallized grains surrounding much larger but isolated, unrecrystallized, cold-worked grains. Hot compression tests from 1049 to 1347 C (0.5-0.6T MP ) of the 10% Y 2 O 3 alloy show that MA material possesses a much higher yield and creep strength than its powder-blended, fully recrystallized counterpart. In fact, the density-compensated specific yield strength of the MA Nb-10Y 2 O 3 exceeds that of currently available commercial Nb alloys. (orig.)

Iron-based amorphous alloys and methods of synthesizing iron-based amorphous alloys

Science.gov (United States)

Saw, Cheng Kiong; Bauer, William A.; Choi, Jor-Shan; Day, Dan; Farmer, Joseph C.

2016-05-03

A method according to one embodiment includes combining an amorphous iron-based alloy and at least one metal selected from a group consisting of molybdenum, chromium, tungsten, boron, gadolinium, nickel phosphorous, yttrium, and alloys thereof to form a mixture, wherein the at least one metal is present in the mixture from about 5 atomic percent (at %) to about 55 at %; and ball milling the mixture at least until an amorphous alloy of the iron-based alloy and the at least one metal is formed. Several amorphous iron-based metal alloys are also presented, including corrosion-resistant amorphous iron-based metal alloys and radiation-shielding amorphous iron-based metal alloys.

Fatigue crack propagation in aluminum-lithium alloys

Science.gov (United States)

Rao, K. T. V.; Ritchie, R. O.; Piascik, R. S.; Gangloff, R. P.

1989-01-01

The principal mechanisms which govern the fatigue crack propagation resistance of aluminum-lithium alloys are investigated, with emphasis on their behavior in controlled gaseous and aqueous environments. Extensive data describe the growth kinetics of fatigue cracks in ingot metallurgy Al-Li alloys 2090, 2091, 8090, and 8091 and in powder metallurgy alloys exposed to moist air. Results are compared with data for traditional aluminum alloys 2024, 2124, 2618, 7075, and 7150. Crack growth is found to be dominated by shielding from tortuous crack paths and resultant asperity wedging. Beneficial shielding is minimized for small cracks, for high stress ratios, and for certain loading spectra. While water vapor and aqueous chloride environments enhance crack propagation, Al-Li-Cu alloys behave similarly to 2000-series aluminum alloys. Cracking in water vapor is controlled by hydrogen embrittlement, with surface films having little influence on cyclic plasticity.

Nickel alloys and high-alloyed special stainless steels. Properties, manufacturing, applications. 4. compl. rev. ed.

International Nuclear Information System (INIS)

Heubner, Ulrich; Kloewer, Jutta; Alves, Helena; Behrens, Rainer; Schindler, Claudius; Wahl, Volker; Wolf, Martin

2012-01-01

This book contains the following eight topics: 1. Nickel alloys and high-alloy special stainless steels - Material overview and metallurgical principles (U. Heubner); 2. Corrosion resistance of nickel alloys and high-alloy special stainless steels (U. Heubner); 3. Welding of nickel alloys and high-alloy special stainless steels (T. Hoffmann, M. Wolf); 4. High-temperature materials for industrial plant construction (J. Kloewer); 5. Nickel alloys and high-alloy special stainless steels as hot roll clad composites-a cost-effective alternative (C. Schindler); 6. Selected examples of the use of nickel alloys and high-alloy special stainless steels in chemical plants (H. Alves); 7. The use of nickel alloys and stainless steels in environmental engineering (V. Wahl); 8: Nickel alloys and high-alloy special stainless steels for the oil and gas industry (R. Behrens).

Microstructural characterization of Cu82.3Al8.3Mn9.4 shape memory alloy after rolling

Directory of Open Access Journals (Sweden)

Mirko Gojić

2017-09-01

Full Text Available In this paper, the microstructure of Cu82.3Al8.3Mn9.4 (in wt. % shape memory alloy after hot and cold rolling was investigated. The Cu82.3Al8.3Mn9.4 alloy was produced by a vertical continuous casting method in the form a cylinder rod of 8 mm in diameter. After the casting, hot and cold rolling was performed. By hot rolling a strip with a thickness of 1.75 mm was obtained, while by cold rolling a strip with a thickness of 1.02 mm was produced. After the rolling process, heat treatment was performed. Heat treatment was carried out by solution annealing at 900 °C held for 30 minutes and water quenched immediately after heating. The microstructure characterization of the investigated alloy was carried out by optical microscopy (OM, scanning electron microscopy (SEM equipped with a device for energy dispersive spectroscopy (EDS. Phase transformation temperatures and fusion enthalpies were determined by differential scanning calorimetry (DSC method. The homogenous martensite microstructure was confirmed by OM and SEM micrographs after casting. During rolling the two-phase microstructure occurred. Results of DSC analysis showed martensite start (Ms, martensite finish (Mf, austenite start (As and austenite finish (Af temperatures.

48 CFR 1432.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 1432.102 Section 1432.102 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 1432.102 Description of contract financing methods. Use of progress payments based on a percentage or stage...

48 CFR 932.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 932.102 Section 932.102 Federal Acquisition Regulations System DEPARTMENT OF ENERGY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 932.102 Description of contract financing methods. (e)(2) Progress payments based on a percentage or stage of...

48 CFR 1532.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 1532.102 Section 1532.102 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING General 1532.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are authorized for use as...

48 CFR 432.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 432.102 Section 432.102 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are...

48 CFR 32.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 32.102 Section 32.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.102 Description of contract financing methods. (a) Advance payments are advances of money by the Government to a...

Order/disorder in electrodeposited aluminum-titanium alloys

Directory of Open Access Journals (Sweden)

Stafford G.R.

2003-01-01

Full Text Available The composition, morphology, and crystallographic microstructure of Al-Ti alloys electrodeposited from two different chloroaluminate molten salt electrolytes were examined. Alloys containing up to 28 % atomic fraction Ti were electrodeposited at 150 °C from 2:1 AlCl3-NaCl with controlled additions of Ti2+. The apparent limit on alloy composition is proposed to be due to a mechanism by which Al3Ti forms through the reductive decomposition of [Ti(AlCl43]-. The composition of Al-Ti alloys electrodeposited from the AlCl3-EtMeImCl melt at 80 °C is limited by the diffusion of Ti2+ to the electrode surface. Alloys containing up to 18.4 % atomic fraction Ti are only obtainable at high Ti2+ concentrations in the melt and low current densities. Alloys electrodeposited from the higher temperature melt have an ordered L12 crystal structure while alloys of similar composition but deposited at lower temperature are disordered fcc. The appearance of antiphase boundaries in the ordered alloys suggests that the deposit may be disordered initially and then orders in the solid state, subsequent to the charge transfer step and adatom incorporation into the lattice. This is very similar to the disorder-trapping observed in rapidly solidified alloys. The measured domain size is consistent with a mechanism of diffusion-controlled doman growth at the examined deposition temperatures and times.

Phonon broadening in high entropy alloys

Science.gov (United States)

Körmann, Fritz; Ikeda, Yuji; Grabowski, Blazej; Sluiter, Marcel H. F.

2017-09-01

Refractory high entropy alloys feature outstanding properties making them a promising materials class for next-generation high-temperature applications. At high temperatures, materials properties are strongly affected by lattice vibrations (phonons). Phonons critically influence thermal stability, thermodynamic and elastic properties, as well as thermal conductivity. In contrast to perfect crystals and ordered alloys, the inherently present mass and force constant fluctuations in multi-component random alloys (high entropy alloys) can induce significant phonon scattering and broadening. Despite their importance, phonon scattering and broadening have so far only scarcely been investigated for high entropy alloys. We tackle this challenge from a theoretical perspective and employ ab initio calculations to systematically study the impact of force constant and mass fluctuations on the phonon spectral functions of 12 body-centered cubic random alloys, from binaries up to 5-component high entropy alloys, addressing the key question of how chemical complexity impacts phonons. We find that it is crucial to include both mass and force constant fluctuations. If one or the other is neglected, qualitatively wrong results can be obtained such as artificial phonon band gaps. We analyze how the results obtained for the phonons translate into thermodynamically integrated quantities, specifically the vibrational entropy. Changes in the vibrational entropy with increasing the number of elements can be as large as changes in the configurational entropy and are thus important for phase stability considerations. The set of studied alloys includes MoTa, MoTaNb, MoTaNbW, MoTaNbWV, VW, VWNb, VWTa, VWNbTa, VTaNbTi, VWNbTaTi, HfZrNb, HfMoTaTiZr.

Progress in development of iron base alloys

International Nuclear Information System (INIS)

Zackay, V.V.; Parker, E.R.

1980-01-01

The ways of development of new iron base high-strength alloys are considered. Perspectiveness of ferritic steel strengthening with intermetallides (TaFe 2 , for instance) is shown. Favourable combination of plasticity, strength and fracture toughness in nickel-free iron-manganese alloys (16-20%) is also pointed out. A strength level of alloyed maraging steels can be achieved by changes in chemical composition and by proper heat treatments of low- and medium-alloyed steels

Analysis of heavy alloying elements segregation in gravity cast experimental Mg-Al-Zn-RE alloy

Directory of Open Access Journals (Sweden)

A. Żydek

2010-01-01

Full Text Available Microstructure of experimental AZ91 alloy with an addition of rare earth elements (RE at a level of 4 wt.% was examined by means of light microscopy. The investigated AZ91 + 4 wt.% RE alloy was fabricated by adding cerium rich mish metal to molten commercial AZ91 alloy. In the microstructure of the resulting alloy, besides α solid solution, α + γ eutectic and discontinuous precipitates of γ phase, also the Al11RE3 phase with needle-like morphology and the polygonal Al10RE2Mn7 phase were revealed. No segregation of rare earth elements was found in the investigated gravity cast alloy, which was confirmed by statistical analysis of cerium concentrations in selected parts of the cast. Similar results were obtained for manganese. Ce and Mn concentrations were determined by a spectrophotometric method.

Research activities of biomedical magnesium alloys in China

Science.gov (United States)

Zheng, Yufeng; Gu, Xuenan

2011-04-01

The potential application of Mg alloys as bioabsorable/biodegradable implants have attracted much recent attention in China. Advances in the design and biocompatibility evaluation of bio-Mg alloys in China are reviewed in this paper. Bio-Mg alloys have been developed by alloying with the trace elements existing in human body, such as Mg-Ca, Mg-Zn and Mg-Si based systems. Additionally, novel structured Mg alloys such as porous, composited, nanocrystalline and bulk metallic glass alloys were tried. To control the biocorrosion rate of bio-Mg implant to match the self-healing/regeneration rate of the surrounding tissue in vivo, surface modification layers were coated with physical and chemical methods.

Study of fatigue crack propagation in magnesium alloys

International Nuclear Information System (INIS)

Yarema, S.Ya.; Zinyuk, O.D.; Ostash, O.P.; Kudryashov, V.G.; Elkin, F.M.

1981-01-01

Fatigue crack propagation in standard (MA2-1, MA8) and super light (MA21, MA18) alloys has been investigated in the whole range of load amplitude changes-from threshold to critical; the materials have been compared by cyclic crack resistance, fractographic analysis has been made. It is shown that MA2-1 alloy crack resistance is slightly lower than the resistance of the other three alloys. MA8 and MA21 alloys having similar mechanical properties almost do not differ in cyclic crack resistance as well. MA18 alloy has the highest resistance to fatigue crack propagation in the whole range of Ksub(max) changes. The presented results on cyclic crack resistance of MA21 and MA18 alloys agree with the data on statistic fracture toughness. The fractures have been also investigated using a scanning electron microscope. Fracture microrelieves of MA8 and MA21 alloys are very similar. At low crack propagation rates (v - 7 m/cycle) it develops through grains, in MA2-1 alloy fracture intergrain fracture areas can be observed. In MA8 and MA21 alloy fractures groove covered areas can be seen alonside with areas of slipping plane laminatron; their specific weight increases with #betta# decrease. Lower crack propagation rates and higher values of threshold stress intensity factors for MA8 and MA21 alloys than for MA2-1 alloy are caused by the absence of intergrain fracture

Complex precipitation pathways in multicomponent alloys

Energy Technology Data Exchange (ETDEWEB)

Clouet, Emmanuel; Nastar, Maylise [Service de Recherches de Metallurgie Physique, CEA/Saclay, 91191 Gif-sur-Yvette (France); Lae, Ludovic; Deschamps, Alexis [LTPCM/ENSEEG, UMR CNRS 5614, Domaine Universitaire, BP 75, 38402 St Martin d' Heres (France); Epicier, Thierry [Groupe d' Etudes de Metallurgie Physique et de Physique des Materiaux, UMR CNRS 5510, INSA, 69621 Villeurbanne (France); Lefebvre, Williams [Groupe de Physique des Materiaux, UMR CNRS 6634, Universite de Rouen, 76801 Saint Etienne du Rouvray (France)

2006-07-01

One usual way to strengthen a metal is to add alloying elements and to control the size and the density of the precipitates obtained. However, precipitation in multicomponent alloys can take complex pathways depending on the relative diffusivity of solute atoms and on the relative driving forces involved. In Al - Zr - Sc alloys, atomic simulations based on first-principle calculations combined with various complementary experimental approaches working at different scales reveal a strongly inhomogeneous structure of the precipitates: owing to the much faster diffusivity of Sc compared with Zr in the solid solution, and to the absence of Zr and Sc diffusion inside the precipitates, the precipitate core is mostly Sc-rich, whereas the external shell is Zr-rich. This explains previous observations of an enhanced nucleation rate in Al - Zr - Sc alloys compared with binary Al - Sc alloys, along with much higher resistance to Ostwald ripening, two features of the utmost importance in the field of light high-strength materials. (authors)

The Evaluation of the Corrosion Resistance of the Al-Si Alloys Antimony Alloyed

Directory of Open Access Journals (Sweden)

Svobodova J.

2014-06-01

Full Text Available This paper deals with the evaluation of the corrosion resistance of the Al-Si alloys alloyed with the different amount of antimony. Specifically it goes about the alloy AlSi7Mg0,3 which is antimony alloyed in the concentrations 0; 0,001; 0,005; 0,01 a 0,05 wt. % of antimony. The introduction of the paper is dedicated to the theory of the aluminium alloys corrosion resistance, testing and evaluation of the corrosion resistance. The influence of the antimony to the Al-Si alloys properties is described further in the introduction. The experimental part describes the experimental samples which were prepared for the experiment and further they were exposed to the loading in the atmospheric conditions for a period of the 3 months. The experimental samples were evaluated macroscopically and microscopically. The results of the experiment were documented and the conclusions in terms of the antimony impact to the corrosion resistance of the Al-Si alloy were concluded. There was compared the corrosion resistance of the Al-Si alloy antimony alloyed (with the different antimony content with the results of the Al-Si alloy without the alloying after the corrosion load in the atmospheric conditions in the experiment.

Capacity retention in hydrogen storage alloys

Science.gov (United States)

Anani, A.; Visintin, A.; Srinivasan, S.; Appleby, A. J.; Reilly, J. J.; Johnson, J. R.

1992-01-01

Results of our examination of the properties of several candidate materials for hydrogen storage electrodes and their relation to the decrease in H-storage capacity upon open-circuit storage over time are reported. In some of the alloy samples examined to date, only about 10 percent of the hydrogen capacity was lost upon storage for 20 days, while in others, this number was as high as 30 percent for the same period of time. This loss in capacity is attributed to two separate mechanisms: (1) hydrogen desorbed from the electrode due to pressure differences between the cell and the electrode sample; and (2) chemical and/or electrochemical degradation of the alloy electrode upon exposure to the cell environment. The former process is a direct consequence of the equilibrium dissociation pressure of the hydride alloy phase and the partial pressure of hydrogen in the hydride phase in equilibrium with that in the electrolyte environment, while the latter is related to the stability of the alloy phase in the cell environment. Comparison of the equilibrium gas-phase dissociation pressures of these alloys indicate that reversible loss of hydrogen capacity is higher in alloys with P(eqm) greater than 1 atm than in those with P(eqm) less than 1 atm.

Density of Ni-Cr Alloy in the Mushy State

Institute of Scientific and Technical Information of China (English)

无

2003-01-01

The density of Ni-Cr alloy in the mushy state has been measured using the modified sessile drop method. The density of Ni-Cr alloy in the mushy state was found to decrease with increasing temperature and Cr concentration in alloy.The molar volume of Ni-Cr alloy in the mushy state therefore increases with increasing the Cr concentration in alloy.The ratio of the difference of density divided by the temperature difference between liquidus and solidus temperatures decreases with increasing Cr concentration. The density of the alloy increased with the precipitation of a solid phase in alloy during the solidification process. The temperature dependence of the density of alloy in the mushy state was not linear but biquadratic.

41 CFR 102-2.140 - What elements of plain language appear in the FMR?

Science.gov (United States)

2010-07-01

... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.140 What elements of plain language... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What elements of plain language appear in the FMR? 102-2.140 Section 102-2.140 Public Contracts and Property Management Federal...

Effect of alloying elements on σ phase formation in Fe-Cr-Mn alloys

International Nuclear Information System (INIS)

Okazaki, Yoshimitsu; Miyahara, Kazuya; Hosoi, Yuzo; Tanino, Mitsuru; Komatsu, Hazime.

1989-01-01

Alloys of Fe-(8∼12%) Cr-(5∼30%) Mn were solution-treated at 1373 K for 3.6 ks, followed by cold-working of 50% reduction. Both solution-treated and 50% cold-worked materials were aged in the temperature range from 773 to 973 K for 3.6 x 10 3 ks. The identification of σ phase formation was made by using X-ray diffraction from the electrolytically extracted residues of the aged specimens. The region of σ phase formation determined by the present work is wider than that on the phase diagram already reported. It is to be noted that Mn promotes markedly the σ phase formation, and that three different types of σ phase formation are observed depending on Mn content: α→γ + α→γ + α + σ in 10% Mn, α→γ + σ in 15 to 20% Mn alloys, α→χ(Chi) →χ + σ + γ in 25 to 30% Mn alloys. An average electron concentration (e/a) in the σ phase was estimated by quantitative analysis of alloying elements using EPMA. The e/a value in the σ phase formed in Fe-(12∼16%) Cr-Mn alloys aged at 873 K for 3.6 x 10 3 ks is about 7.3, which is independent of Mn content. In order to prevent σ phase formation in Fe-12% Cr-15% Mn alloy, the value of Ni * eq of 11 (Ni * eq = Ni + 30(C) + 25(N)) is required. (author)

41 CFR 102-76.50 - What is sustainable development?

Science.gov (United States)

2010-07-01

... and Construction Sustainable Development § 102-76.50 What is sustainable development? Sustainable... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is sustainable development? 102-76.50 Section 102-76.50 Public Contracts and Property Management Federal Property Management...

Introduction to hydrogen in alloys

International Nuclear Information System (INIS)

Westlake, D.G.

1980-01-01

Substitutional alloys, both those that form hydrides and those that do not, are discussed, but with more emphasis on the former than the latter. This overview includes the following closely related subjects: (1) the significant effects of substitutional solutes on the pressure-composition-temperature (PCT) equilibria of metal-hydrogen systems, (2) the changes in thermodynamic properties resulting from differences in atom size and from modifications of electronic structure, (3) attractive and repulsive interactions between H and solute atoms and the effects of such interactions on the pressure dependent solubility for H, (4) H trapping in alloys of Group V metals and its effect on the terminal solubility for H (TSH), (5) some other mechanisms invoked to explain the enhancement (due to alloying) of the (TSH) in Group V metals, and (6) H-impurity complexes in alloys of the metals Ni, Co, and Fe. Some results showing that an enhanced TSH may ameliorate the resistance of a metal to hydrogen embrittlement are presented

Corrosion of aluminum alloys as a function of alloy composition

International Nuclear Information System (INIS)

Johnson, A.B. Jr.

1969-10-01

A study was initiated which included nineteen aluminum alloys. Tests were conducted in high purity water at 360 0 C and flow tests (approx. 20 ft/sec) in reactor process water at 130 0 C (TF-18 loop tests). High-silicon alloys and AlSi failed completely in the 360 0 C tests. However, coupling of AlSi to 8001 aluminum suppressed the failure. The alloy compositions containing iron and nickel survived tht 360 0 C autoclave exposures. Corrosion rates varied widely as a function of alloy composition, but in directions which were predictable from previous high-temperature autoclave experience. In the TF-18 loop flow tests, corrosion penetrations were similar on all of the alloys and on high-purity aluminum after 105 days. However, certain alloys established relatively low linear corrosion rates: Al-0.9 Ni-0.5 Fe-0.1 Zr, Al-1.0 Ni-0.15 Fe-11.5 Si-0.8 Mg, Al-1.2 Ni-1.8 Fe, and Al-7.0 Ni-4.8 Fe. Electrical polarity measurements between AlSi and 8001 alloys in reactor process water at temperatures up to 150 0 C indicated that AlSi was anodic to 8001 in the static autoclave system above approx. 50 0 C

Alloying element's substitution in titanium alloy with improved oxidation resistance and enhanced magnetic properties

Energy Technology Data Exchange (ETDEWEB)

Yu, Ang-Yang, E-mail: ayyu@imr.ac.cn; Wei, Hua; Hu, Qing-Miao; Yang, Rui

2017-01-15

First-principles method is used to characterize segregation and magnetic properties of alloyed Ti/TiO{sub 2}interface. We calculate the segregation energy of the doped Ti/TiO{sub 2} interface to investigate alloying atom's distribution. The oxidation resistance of Ti/TiO{sub 2} interface is enhanced by elements Fe and Ni but reduced by element Co. Magnetism could be produced by alloying elements such as Co, Fe and Ni in the bulk of titanium and the surface of Ti at Ti/TiO{sub 2} interface. The presence of these alloying elements could transform the non-magnetic titanium alloys into magnetic systems. We have also calculated the temperature dependence of magnetic permeability for the doped and pure Ti/TiO{sub 2} interfaces. Alloying effects on the Curie temperature of the Ti/TiO{sub 2} interface have been elaborated. - Highlights: • We consider the segregation of alloying atoms on the Ti(101¯0)/TiO{sub 2}(100) interface. • Alloying the Ti//TiO{sub 2} interface with Fe and Ni has a great advantage of improving the oxidation resistance. • Fe, Co and Nican enhance the magnetic properties of the investigated system. • The variation of permeability with temperature has been presented.

41 CFR 102-117.5 - What is transportation management?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is transportation management? 102-117.5 Section 102-117.5 Public Contracts and Property Management Federal Property Management... General § 102-117.5 What is transportation management? Transportation management is agency oversight of...

41 CFR 109-27.102 - Economic order quantity principle.

Science.gov (United States)

2010-07-01

... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...

25 CFR 39.102 - What is academic base funding?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false What is academic base funding? 39.102 Section 39.102... PROGRAM Indian School Equalization Formula Base and Supplemental Funding § 39.102 What is academic base funding? Academic base funding is the ADM times the weighted student unit. ...

In vitro mechanical integrity of hydroxyapatite coated magnesium alloy

International Nuclear Information System (INIS)

Kannan, M Bobby; Orr, Lynnley

2011-01-01

The mechanical integrity of resorbable implants during service, especially in load bearing orthopaedic applications, is critical. The high degradation rate of resorbable magnesium and magnesium-based implants in body fluid may potentially cause premature in-service failure. In this study, a magnesium alloy (AZ91) was potentiostatically coated with hydroxyapatite at different cathodic voltages in an attempt to enhance the mechanical integrity. The mechanical integrity of the uncoated and hydroxyapatite coated alloys was evaluated after in vitro testing of the coated samples in simulated body fluid (SBF). The uncoated alloy showed 40% loss in the mechanical strength after five days exposure to SBF. However, the hydroxyapatite coated alloy exposed to SBF showed 20% improvement in the mechanical strength as compared to that of the uncoated alloy. The alloy coated potentiostatically at -2 V performed better than the -3 V coated alloy. The cross-sectional analysis of the coatings revealed relatively uniform coating thickness for the -2 V coated alloy, whereas the -3 V coated alloy exhibited areas of uneven coating. This can be attributed to the increase in hydrogen evolution on the alloy during -3 V coating as compared to -2 V coating. The scanning electron micrographs of the in vitro tested alloy revealed that hydroxyapatite coating significantly reduced the localized corrosion of the alloy, which is critical for better in-service mechanical integrity. Thus, the study suggests that the in vitro mechanical integrity of resorbable magnesium-based alloy can be improved by potentiostatic hydroxyapatite coating.

In vitro mechanical integrity of hydroxyapatite coated magnesium alloy

Energy Technology Data Exchange (ETDEWEB)

Kannan, M Bobby; Orr, Lynnley, E-mail: bobby.mathan@jcu.edu.au [Discipline of Chemical Engineering, School of Engineering and Physical Sciences, James Cook University, Townsville, Queensland 4811 (Australia)

2011-08-15

The mechanical integrity of resorbable implants during service, especially in load bearing orthopaedic applications, is critical. The high degradation rate of resorbable magnesium and magnesium-based implants in body fluid may potentially cause premature in-service failure. In this study, a magnesium alloy (AZ91) was potentiostatically coated with hydroxyapatite at different cathodic voltages in an attempt to enhance the mechanical integrity. The mechanical integrity of the uncoated and hydroxyapatite coated alloys was evaluated after in vitro testing of the coated samples in simulated body fluid (SBF). The uncoated alloy showed 40% loss in the mechanical strength after five days exposure to SBF. However, the hydroxyapatite coated alloy exposed to SBF showed 20% improvement in the mechanical strength as compared to that of the uncoated alloy. The alloy coated potentiostatically at -2 V performed better than the -3 V coated alloy. The cross-sectional analysis of the coatings revealed relatively uniform coating thickness for the -2 V coated alloy, whereas the -3 V coated alloy exhibited areas of uneven coating. This can be attributed to the increase in hydrogen evolution on the alloy during -3 V coating as compared to -2 V coating. The scanning electron micrographs of the in vitro tested alloy revealed that hydroxyapatite coating significantly reduced the localized corrosion of the alloy, which is critical for better in-service mechanical integrity. Thus, the study suggests that the in vitro mechanical integrity of resorbable magnesium-based alloy can be improved by potentiostatic hydroxyapatite coating.

Stress corrosion crack tip microstructure in nickel-based alloys

International Nuclear Information System (INIS)

Shei, S.A.; Yang, W.J.

1994-04-01

Stress corrosion cracking behavior of several nickel-base alloys in high temperature caustic environments has been evaluated. The crack tip and fracture surfaces were examined using Auger/ESCA and Analytical Electron Microscopy (AEM) to determine the near crack tip microstructure and microchemistry. Results showed formation of chromium-rich oxides at or near the crack tip and nickel-rich de-alloying layers away from the crack tip. The stress corrosion resistance of different nickel-base alloys in caustic may be explained by the preferential oxidation and dissolution of different alloying elements at the crack tip. Alloy 600 (UNS N06600) shows good general corrosion and intergranular attack resistance in caustic because of its high nickel content. Thermally treated Alloy 690 (UNS N06690) and Alloy 600 provide good stress corrosion cracking resistance because of high chromium contents along grain boundaries. Alloy 625 (UNS N06625) does not show as good stress corrosion cracking resistance as Alloy 690 or Alloy 600 because of its high molybdenum content

Packaging design criteria, transfer and disposal of 102-AP mixer pump

International Nuclear Information System (INIS)

Carlstrom, R.F.

1994-01-01

A mixer pump installed in storage tank 241-AP-102 (102-AP) has failed. This pump is referred to as the 102-AP mixer pump (APMP). The APMP will be removed from 102-AP 1 and a new pump will be installed. The main purpose of the Packaging Design Criteria (PDC) is to establish criteria necessary to design and fabricate a shipping container for the transfer and storage of the APMP from 102-AP. The PDC will be used as a guide to develop a Safety Evaluation for Packaging (SEP)

Influence of graphite-alloy interactions on corrosion of Ni-Mo-Cr alloy in molten fluorides

Science.gov (United States)

Ai, Hua; Hou, Juan; Ye, Xiang-Xi; Zeng, Chao Liu; Sun, Hua; Li, Xiaoyun; Yu, Guojun; Zhou, Xingtai; Wang, Jian-Qiang

2018-05-01

In this study, the effects of graphite-alloy interaction on corrosion of Ni-Mo-Cr alloy in molten FLiNaK salt were investigated. The corrosion tests of Ni-Mo-Cr alloys were conducted in graphite crucibles, to examine the differences of test specimens in conditions of electric contact and isolated with graphite, respectively. The corrosion attack is severer with more weight loss and deeper Cr depletion layer in samples electric contact with graphite than those isolated with graphite. The occurrence of galvanic corrosion between alloy specimens and graphite container was confirmed by electrochemical measurement. The corrosion is controlled by nonelectric transfer in isolated test while electrochemical reaction accelerated corrosion in electric contact test.

Calculations of hydrogen diffusivity in Zr-based alloys: Influence of alloying elements and effect of stress

International Nuclear Information System (INIS)

Yu, J.; Jiang, C.; Zhang, Y.

2017-01-01

This report summarizes the progress on modeling hydrogen diffusivity in Zr-based alloys. The presence of hydrogen (H) can detrimentally affect the mechanical properties of many metals and alloys. To mitigate these detrimental effects requires fundamental understanding of the thermodynamics and kinetics governing H pickup and hydride formation. In this work, we focus on H diffusion in Zr-based alloys by studying the effects of alloying elements and stress, factors that have been shown to strongly affect H pickup and hydride formation in nuclear fuel claddings. A recently developed accelerated kinetic Monte Carlo method is used for the study. It is found that for the alloys considered here, H diffusivity depends weakly on composition, with negligible effect at high temperatures in the range of 600-1200 K. Therefore, the small variation in compositions of these alloys is likely not a major cause of the very different H pickup rates. In contrast, stress strongly affects H diffusivity. This effect needs to be considered for studying hydride formation and delayed hydride cracking.

Calculations of hydrogen diffusivity in Zr-based alloys: Influence of alloying elements and effect of stress

Energy Technology Data Exchange (ETDEWEB)

Yu, J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Jiang, C. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Zhang, Y. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

2017-06-01

This report summarizes the progress on modeling hydrogen diffusivity in Zr-based alloys. The presence of hydrogen (H) can detrimentally affect the mechanical properties of many metals and alloys. To mitigate these detrimental effects requires fundamental understanding of the thermodynamics and kinetics governing H pickup and hydride formation. In this work, we focus on H diffusion in Zr-based alloys by studying the effects of alloying elements and stress, factors that have been shown to strongly affect H pickup and hydride formation in nuclear fuel claddings. A recently developed accelerated kinetic Monte Carlo method is used for the study. It is found that for the alloys considered here, H diffusivity depends weakly on composition, with negligible effect at high temperatures in the range of 600-1200 K. Therefore, the small variation in compositions of these alloys is likely not a major cause of the very different H pickup rates. In contrast, stress strongly affects H diffusivity. This effect needs to be considered for studying hydride formation and delayed hydride cracking.

41 CFR 102-74.40 - What are concession services?

Science.gov (United States)

2010-07-01

... Management Concession Services § 102-74.40 What are concession services? Concession services are any food or... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are concession services? 102-74.40 Section 102-74.40 Public Contracts and Property Management Federal Property Management...

21 CFR 640.102 - Manufacture of Immune Globulin (Human).

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Manufacture of Immune Globulin (Human). 640.102 Section 640.102 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES....102 Manufacture of Immune Globulin (Human). (a) Processing method. The processing method shall be one...

Reducing thermal conductivity of binary alloys below the alloy limit via chemical ordering

International Nuclear Information System (INIS)

Duda, John C; English, Timothy S; Jordan, Donald A; Norris, Pamela M; Soffa, William A

2011-01-01

Substitutional solid solutions that exist in both ordered and disordered states will exhibit markedly different physical properties depending on their exact crystallographic configuration. Many random substitutional solid solutions (alloys) will display a tendency to order given the appropriate kinetic and thermodynamic conditions. Such order-disorder transitions will result in major crystallographic reconfigurations, where the atomic basis, symmetry, and periodicity of the alloy change dramatically. Consequently, the dominant scattering mechanism in ordered alloys will be different than that in disordered alloys. In this study, we present a hypothesis that ordered alloys can exhibit lower thermal conductivities than their disordered counterparts at elevated temperatures. To validate this hypothesis, we investigate the phononic transport properties of disordered and ordered AB Lennard-Jones alloys via non-equilibrium molecular dynamics and harmonic lattice dynamics calculations. It is shown that the thermal conductivity of an ordered alloy is the same as the thermal conductivity of the disordered alloy at ∼0.6T melt and lower than that of the disordered alloy above 0.8T melt .

The Properties of 7xxx Series Alloys Formed by Alloying Additions

Directory of Open Access Journals (Sweden)

Kwak Z.

2015-06-01

Full Text Available Currently there is a constant development in the field of aluminium alloys engineering. This results from, i.a., better understanding of the mechanisms that direct strengthening of these alloys and the role of microalloying. Now it is microalloying in aluminum alloys that is receiving a lot of attention. It affects substantially the macro- and microstructure and kinetics of phase transformation influencing the properties during production and its exploitation. 7xxx series aluminum alloys, based on the Al-Zn-Mg-Cu system, are high-strength alloys, moreover, the presence of Zr and Sr further increases their strength and improves resistance to cracking.

VANADIUM ALLOYS

Science.gov (United States)

Smith, K.F.; Van Thyne, R.J.

1959-05-12

This patent deals with vanadium based ternary alloys useful as fuel element jackets. According to the invention the ternary vanadium alloys, prepared in an arc furnace, contain from 2.5 to 15% by weight titanium and from 0.5 to 10% by weight niobium. Characteristics of these alloys are good thermal conductivity, low neutron capture cross section, good corrosion resistance, good welding and fabricating properties, low expansion coefficient, and high strength.

Alloying behavior of iron, gold and silver in AlCoCrCuNi-based equimolar high-entropy alloys

International Nuclear Information System (INIS)

Hsu, U.S.; Hung, U.D.; Yeh, J.W.; Chen, S.K.; Huang, Y.S.; Yang, C.C.

2007-01-01

High-entropy alloys are newly developed alloys that are composed, by definition, of at least five principal elements with concentrations in the range of 5-35 at.%. Therefore, the alloying behavior of any given principal element is significantly affected by all the other principal elements present. In order to elucidate this further, the influence of iron, silver and gold addition on the microstructure and hardness of AlCoCrCuNi-based equimolar alloys has been examined. The as-cast AlCoCrCuNi base alloy is found to have a dendritic structure, of which only solid solution FCC and BCC phases can be observed. The BCC dendrite has a chemical composition close to that of the nominal alloy, with a deficiency in copper however, which is found to segregate and form a FCC Cu-rich interdendrite. The microstructure of the iron containing alloys is similar to that of the base alloy. It is found that both of these aforementioned alloys have hardnesses of about 420 HV, which is equated to their similar microstructures. The as-cast ingot forms two layers of distinct composition with the addition of silver. These layers, which are gold and silver in color, are determined to have a hypoeutectic Ag-Cu composition and a multielement mixture of the other principal elements, respectively. This indicates the chemical incompatibility of silver with the other principal elements. The hardnesses of the gold (104 HV) and silver layers (451 HV) are the lowest and highest of the alloy systems studied. This is attributed to the hypoeutectic Ag-Cu composition of the former and the reduced copper content of the latter. Only multielement mixtures, i.e. without copper segregation, form in the gold containing alloy. Thus, it may be said that gold acts as a 'mixing agent' between copper and the other elements. Although several of the atom pairs in the gold containing alloy have positive enthalpies, thermodynamic considerations show that the high entropy contribution is sufficient to counterbalance

Hydrogen interactions in aluminum-lithium alloys

Science.gov (United States)

Smith, S. W.; Scully, J. R.

1991-01-01

A program is described which seeks to develop an understanding of the effects of dissolved and trapped hydrogen on the mechanical properties of selected Al-Li-Cu-X alloys. A proposal is made to distinguish hydrogen (H2) induced EAC from aqueous dissolution controlled EAC, to correlate H2 induced EAC with mobile and trapped concentrations, and to identify significant trap sites and hydride phases (if any) through use of model alloys and phases. A literature review shows three experimental factors which have impeded progress in the area of H2 EAC for this class of alloys. These are as listed: (1) inter-subgranular fracture in Al-Li alloys when tested in the S-T orientation in air or vacuum make it difficult to readily detect H2 induced fracture based on straight forward changes in fractography; (2) the inherently low H2 diffusivity and solubility in Al alloys is further compounded by a native oxide which acts as a H2 permeation barrier; and (3) H2 effects are masked by dissolution assisted processes when mechanical testing is performed in aqueous solutions.

Surface treatment of new type aluminum lithium alloy and fatigue crack behaviors of this alloy plate bonded with Ti–6Al–4V alloy strap

International Nuclear Information System (INIS)

Sun, Zhen-Qi; Huang, Ming-Hui; Hu, Guo-Huai

2012-01-01

Highlights: ► A new generation aluminum lithium alloy which special made for Chinese commercial plane was investigated. ► Pattern of aluminum lithium alloy and Ti alloy were shown after anodization. ► Crack propagation of samples bonded with different wide Ti straps were studied in this paper. -- Abstract: Samples consisting of new aluminum lithium alloy (Al–Li alloy) plate developed by the Aluminum Company of America and Ti–6Al–4V alloy (Ti alloy) plate were investigated. Plate of 400 mm × 140 mm × 2 mm with single edge notch was anodized in phosphoric solution and Ti alloy plate of 200 mm × 20 (40) mm × 2 mm was anodized in alkali solution. Patterns of two alloys were studied at original/anodized condition. And then, aluminum alloy and Ti alloy plates were assembled into a sample with FM 94 film adhesive. Fatigue crack behaviors of the sample were investigated under condition of nominal stress σ = 36 MPa and 54 MPa, stress ratio of 0.1. Testing results show that anodization treatment modifies alloys surface topography. Ti alloy bonding to Al–Li alloy plate effectively retards crack growth than that of Al–Li alloy plate. Fatigue life of sample bonded with Ti alloy strap improves about 62.5% than that of non-strap plate.

41 CFR 101-27.102-1 - Applicability.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.102-1 Section 101-27.102-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1...

5 CFR 179.102 - Delegation of authority.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Delegation of authority. 179.102 Section... COLLECTION STANDARDS General Provisions and Administration § 179.102 Delegation of authority. (a) The Chief... Disability Fund, the Employees' Life Insurance Fund, the Retired Federal Employees Health Benefits Act (74...

5 CFR 6201.102 - Prohibited financial interests.

Science.gov (United States)

2010-01-01

... Section 6201.102 Administrative Personnel EXPORT-IMPORT BANK OF THE UNITED STATES SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE EXPORT-IMPORT BANK OF THE UNITED STATES § 6201.102 Prohibited...) All exporters that, during the preceding two fiscal years, exported an aggregate dollar volume of...

30 CFR 219.102 - Method of payment.

Science.gov (United States)

2010-07-01

... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...

14 CFR 221.102 - Accessibility of tariffs to the public.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Accessibility of tariffs to the public. 221.102 Section 221.102 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Inspection § 221.102 Accessibility of tariffs to the public. Each file of tariffs shall be kept in complete...

In vitro mechanical integrity of hydroxyapatite coated magnesium alloy.

Science.gov (United States)

Kannan, M Bobby; Orr, Lynnley

2011-08-01

The mechanical integrity of resorbable implants during service, especially in load bearing orthopaedic applications, is critical. The high degradation rate of resorbable magnesium and magnesium-based implants in body fluid may potentially cause premature in-service failure. In this study, a magnesium alloy (AZ91) was potentiostatically coated with hydroxyapatite at different cathodic voltages in an attempt to enhance the mechanical integrity. The mechanical integrity of the uncoated and hydroxyapatite coated alloys was evaluated after in vitro testing of the coated samples in simulated body fluid (SBF). The uncoated alloy showed 40% loss in the mechanical strength after five days exposure to SBF. However, the hydroxyapatite coated alloy exposed to SBF showed 20% improvement in the mechanical strength as compared to that of the uncoated alloy. The alloy coated potentiostatically at -2 V performed better than the -3 V coated alloy. The cross-sectional analysis of the coatings revealed relatively uniform coating thickness for the -2 V coated alloy, whereas the -3 V coated alloy exhibited areas of uneven coating. This can be attributed to the increase in hydrogen evolution on the alloy during -3 V coating as compared to -2 V coating. The scanning electron micrographs of the in vitro tested alloy revealed that hydroxyapatite coating significantly reduced the localized corrosion of the alloy, which is critical for better in-service mechanical integrity. Thus, the study suggests that the in vitro mechanical integrity of resorbable magnesium-based alloy can be improved by potentiostatic hydroxyapatite coating. © 2011 IOP Publishing Ltd

Filler metal alloy for welding cast nickel aluminide alloys

Science.gov (United States)

Santella, M.L.; Sikka, V.K.

1998-03-10

A filler metal alloy used as a filler for welding cast nickel aluminide alloys contains from about 15 to about 17 wt. % chromium, from about 4 to about 5 wt. % aluminum, equal to or less than about 1.5 wt. % molybdenum, from about 1 to about 4.5 wt. % zirconium, equal to or less than about 0.01 wt. % yttrium, equal to or less than about 0.01 wt. % boron and the balance nickel. The filler metal alloy is made by melting and casting techniques such as are melting the components of the filler metal alloy and cast in copper chill molds. 3 figs.

Texture in low-alloyed uranium alloys

International Nuclear Information System (INIS)

Sariel, J.

1982-08-01

The dependence of the preferred orientation of cast and heat-treated polycrystalline adjusted uranium and uranium -0.1 w/o chromium alloys on the production process was studied. The importance of obtaining material free of preferred orientation is explained, and a survey of the regular methods to determine preferred orientation is given. Dilatometry, tensile testing and x-ray diffraction were used to determine the extent of the directionality of these alloys. Data processing showed that these methods are insufficient in a case of a material without any plastic forming, because of unreproducibility of results. Two parameters are defined from the results of Schlz's method diffraction test. These parameters are shown theoretically and experimentally (by extreme-case samples) to give the deviation from isotropy. Application of these parameters to the examined samples showes that cast material has preferred orientation, though it is not systematic. This preferred orientation was reduced by adequate heat treatments

Site preference and elastic properties of ternary alloying additions in B2 YAg alloys by first-principles calculations

Energy Technology Data Exchange (ETDEWEB)

Wu Yurong, E-mail: winwyr@126.com [College of Electromechanical Engineering, Hunan University of Science and Technology, Xiantang 411201 (China); Hu Wangyu [Department of Applied Physics, Hunan University, Changsha 410082 (China); Xu Longshan [Department of Materials Science and Engineering, Xiamen University of Technology, Xiamen 361024 (China)

2012-09-15

First-principles calculations were preformed to study the site preference behavior and elastic properties of 3d (Ti-Cu) transition-metal elements in B2 ductility YAg alloy. In YAg, Ti is found to occupy the Y sublattice whereas V, Cr, Co, Fe, Ni and Cu tend to substitute for Ag sublattice. Due to the addition of 3d transition metals, the lattice parameters of YAg is decreased in the order: Valloy, and Fe is the most effective element to improve the ductility of YAg, while Ti, Ni and V alloying elements can reduce the ductility of YAg alloy, especially, V transforms ductile into brittle for YAg alloy. In addition, both V and Ni alloying elements can increase the hardness of YAg alloy, and Y{sub 8}Ag{sub 7}V is harder than Y{sub 8}Ag{sub 7}Ni.

Nucleation of dislocation loops during irradiation in binary FCC alloys with different alloy compositions

International Nuclear Information System (INIS)

Hashimoto, T.; Shigenaka, N.; Fuse, M.

1992-01-01

Dislocation loop nucleation is analyzed using a rate theory based model for face-centered cubic (fcc) binary alloys containing A- and B-atoms. In order to calculate the nucleation process in concentrated alloys, the model considers three types of interstitial dumbbells composed of A- and B-atoms, AA-, BB-, and AB-type dumbbells. Conversions between these interstitial dumbbells are newly introduced in the formulation in consideration of dumbbell configurations and movements. The model also includes reactions, such as point defect production by irradiation, mutual recombination of an interstitial and a vacancy, and dislocation loop nucleation and growth. Parameter values are chosen based on the atom size of the alloy component elements, and dislocation loop nucleation kinetics are investigated while varying alloy compositions. Two different types of kinetics are obtained in accordance with the dominant loop nucleus type. The migration energy difference of AA- and BB-type interstitial dumbbells is important in the determination of the dominant loop nucleus type. The present model predicts that the dislocation loop concentration decrease with increasing under sized atoms content, but defect production rate and temperature dependences of loop concentration are insensitive to alloy compositions. (author)

Shape memory alloys

International Nuclear Information System (INIS)

Kaszuwara, W.

2004-01-01

Shape memory alloys (SMA), when deformed, have the ability of returning, in certain circumstances, to their initial shape. Deformations related to this phenomenon are for polycrystals 1-8% and up to 15% for monocrystals. The deformation energy is in the range of 10 6 - 10 7 J/m 3 . The deformation is caused by martensitic transformation in the material. Shape memory alloys exhibit one directional or two directional shape memory effect as well as pseudoelastic effect. Shape change is activated by temperature change, which limits working frequency of SMA to 10 2 Hz. Other group of alloys exhibit magnetic shape memory effect. In these alloys martensitic transformation is triggered by magnetic field, thus their working frequency can be higher. Composites containing shape memory alloys can also be used as shape memory materials (applied in vibration damping devices). Another group of composite materials is called heterostructures, in which SMA alloys are incorporated in a form of thin layers The heterostructures can be used as microactuators in microelectromechanical systems (MEMS). Basic SMA comprise: Ni-Ti, Cu (Cu-Zn,Cu-Al, Cu-Sn) and Fe (Fe-Mn, Fe-Cr-Ni) alloys. Shape memory alloys find applications in such areas: automatics, safety and medical devices and many domestic appliances. Currently the most important appears to be research on magnetic shape memory materials and high temperature SMA. Vital from application point of view are composite materials especially those containing several intelligent materials. (author)

Microstructure and Wear Resistance of Laser Cladding TiC Coat on Titanium Alloy%钛合金表面激光熔覆TiC涂层显微结构和耐磨性

Institute of Scientific and Technical Information of China (English)

王慧萍; 李军; 李芳; 李曼萍; 奚文龙

2012-01-01

采用HL-5000型横流CO2激光加工机在TC4钛合金表面激光熔覆TiC+ Ti和TiC+Ti+ F102复合涂层.通过SEM、EDAX、XRD、HXD-1000TMC型显微硬度计,HT-600型高温摩擦磨损试验机,分析了熔覆层的显微组织、成分、物相,测试了激光熔覆层的显微硬度和滑动摩擦磨损性能.结果表明,激光熔覆制备的TiC复合涂层与基体呈冶金结合,在TiC+ Ti激光熔覆层中,熔覆层的组织是在Ti基体上分布着TiC树枝晶;在TiC +Ti+ F102激光熔覆层中,TiC颗粒发生了部分溶解,熔覆层的组织是在Ti基和γ-Ni基的基体上分布着细小的TiC颗粒和TiC树枝晶.TiC+ Ti激光熔覆层的硬度约为700 HV0.1,TiC+Ti+ F102激光熔覆层的硬度约为800 HV0.1,两种复合涂层耐磨性均比TC4钛合金显著提高.%The laser cladding TiC + Ti and TiC + Ti + F102 composite coaling on the surfact of TC4 alloy was obtained with 5.0 Kw continuous wave CO2 laser. The microstructure,composition and phase of the coating were investigated by means of SEM,EDAX,XRD,HXD-1000TMC Microhardness Tester, HT-600 wear machine Moreover, the microhardness and friction wear properties was measured. The results indicate that the laser cladding TiC composite coating is well bonded with the matrix alloy. The microstructures of TiC dendrites in Ti matrix in the clad layer of TiC + Ti laser clad coating. For TiC + Ti + F102 laser clad coating, parts of TiC particles are dissolved to form a microstructures of TiC particles and fine TiC dendrites in the matrix of Ti and y-Ni in the clad layer. The microhardness of TiC + Ti coating is 700 HV0.1. The microhardness of TiC + Ti + F102 coating is 800 HV0.1 , and the coating greatly enhances the wear resistantce of TC4 titanium alloy.

Tracer diffusion study in binary alloys

International Nuclear Information System (INIS)

Bocquet, Jean-Louis

1973-01-01

The diffusional properties of dilute alloys are quite well described with 5 vacancy jump frequencies: the diffusion experiments allow as to determine only 3 jump frequency ratios. The first experiment set, found by Howard and Manning, was used in order to determine the 3 frequency ratios in the dilute Cu-Fe alloy. N.V. Doan has shown that the isotope effect measurements may be replaced by easier electromigration experiments: this new method was used with success for the dilute Ag-Zn and Ag-Cd alloys. Two effects which take place in less dilute alloys cannot be explained with the 5 frequency model, these are: the linear enhancement of solute diffusion and the departure from linear enhancement of solvent diffusion versus solute concentration. To explain these effects, we have had to take account of the influence of solute pairs on diffusion via 53 new vacancy jump frequencies. Diffusion in a concentrated alloy can be described with a quasi-chemical approach: we show that a description with 'surrounded atoms' allows the simultaneous explanation of the thermodynamical properties of the binary solid solution, the dependence of atomic jump frequencies with respect to the local concentration of the alloy. In this model, the two atomic species have a jump frequency spectrum at their disposal, which seems to greatly modify Manning's correlation analysis. (author) [fr

Liquid metal corrosion considerations in alloy development

International Nuclear Information System (INIS)

Tortorelli, P.F.; DeVan, J.H.

1984-01-01

Liquid metal corrosion can be an important consideration in developing alloys for fusion and fast breeder reactors and other applications. Because of the many different forms of liquid metal corrosion (dissolution, alloying, carbon transfer, etc.), alloy optimization based on corrosion resistance depends on a number of factors such as the application temperatures, the particular liquid metal, and the level and nature of impurities in the liquid and solid metals. The present paper reviews the various forms of corrosion by lithium, lead, and sodium and indicates how such corrosion reactions can influence the alloy development process

Use of low fusing alloy in dentistry.

Science.gov (United States)

Wee, A G; Schneider, R L; Aquilino, S A

1998-11-01

Low fusing alloy has been used in dentistry for remount procedures in both fixed and removable prosthodontics, in implant prosthodontics for the fabrication of solid implant casts, in maxillofacial prosthetics as oral radiation shields, and in dental research for its unique properties. Previously, the use of low fusing alloy was thought to offer a high degree of dimensional accuracy. However, multiple in vitro studies have shown that its presumed dimensional accuracy may be questionable. This article reviews the physical properties, metallurgical considerations of low fusing alloy, its applications in dentistry, and a safe, simple method of using low fusing alloy.

41 CFR 101-29.102 - Use of metric system of measurement in Federal product descriptions.

Science.gov (United States)

2010-07-01

... PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.1-General § 101-29.102 Use of metric system of measurement in... measurement in Federal product descriptions. 101-29.102 Section 101-29.102 Public Contracts and Property... Federal agencies to: (a) Maintain close liaison with other Federal agencies, State and local governments...

Tank characterization report for double-shell tank 241-AN-102

International Nuclear Information System (INIS)

Jo, J.

1996-01-01

This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists

Progress in Preparation and Research of High Entropy Alloys

Directory of Open Access Journals (Sweden)

CHEN Yong-xing

2017-11-01

Full Text Available The current high entropy alloys' studies are most in block, powder, coating, film and other areas. There are few studies of high entropy alloys in other areas and they are lack of unified classification. According to the current high entropy alloys' research situation, The paper has focused on the classification on all kinds of high entropy alloys having been researched, introduced the selecting principle of elements, summarized the preparation methods, reviewed the research institutions, research methods and research contents of high entropy alloys, prospected the application prospect of high entropy alloys, put forward a series of scientific problems of high entropy alloys, including less research on mechanism, incomplete performance research, unsystematic thermal stability study, preparation process parameters to be optimized, lightweight high entropy alloys' design, the expansion on the research field, etc, and the solutions have been given. Those have certain guiding significance for the expansion of the application of high entropy alloys subjects in the future research direction.

VLBI imaging of CTA 102

International Nuclear Information System (INIS)

Wehrle, A.E.; Cohen, M.

1989-01-01

The object CTA 102, a low-frequency variable quasar, was observed with a VLBI Global Array in 1987.5 and 1988.5 at 5.0 GHz. The structure is complex, with three compact components along a line at PA = 157 deg, and several extended, ill-defined components east of the southernmost compact component. The components have no detectable relative motions, with mu less than 0.5 mas/yr along the main axis. This contrasts with the observation reported by Baath (1987), who found mu = 0.65 + or - 0.15 mas/yr at 932 MHz, which is exceptionally high. The new upper limit allows CTA 102 to be in the normal range of superluminal sources. 11 refs

Superplasticity in powder metallurgy aluminum alloys and composites

International Nuclear Information System (INIS)

Mishra, R.S.; Bieler, T.R.; Mukherjee, A.K.

1995-01-01

Superplasticity in powder metallurgy Al alloys and composites has been reviewed through a detailed analysis. The stress-strain curves can be put into 4 categories: classical well-behaved type, continuous strain hardening type, continuous strain softening type and complex type. The origin of these different types of is discussed. The microstructural features of the processed material and the role of strain have been reviewed. The role of increasing misorientation of low angle boundaries to high angle boundaries by lattice dislocation absorption is examined. Threshold stresses have been determined and analyzed. The parametric dependencies for superplastic flow in modified conventional aluminum alloys, mechanically alloyed alloys and Al alloy matrix composites is determined to elucidate the superplastic mechanism at high strain rates. The role of incipient melting has been analyzed. A stress exponent of 2, an activation energy equal to that for grain boundary diffusion and a grain size dependence of 2 generally describes superplastic flow in modified conventional Al alloys and mechanically alloyed alloys. The present results agree well with the predictions of grain boundary sliding models. This suggests that the mechanism of high strain rate superplasticity in the above-mentioned alloys is similar to conventional superplasticity. The shift of optimum superplastic strain rates to higher values is a consequence of microstructural refinement. The parametric dependencies for superplasticity in aluminum alloy matrix composites, however, is different. A true activation energy of superplasticity in aluminum alloy matrix composites, however, is different. A true activation energy of 313 kJ/mol best describes the composites having SiC reinforcements. The role of shape of the reinforcement (particle or whisker) and processing history is addressed. The analysis suggests that the mechanism for superplasticity in composites is interface diffusion controlled grain boundary sliding

49 CFR 24.102 - Basic acquisition policies.

Science.gov (United States)

2010-10-01

... valuation only if the offer to acquire the property is $10,000, or less. (See appendix A, § 24.102(n).) [70... Transportation Office of the Secretary of Transportation UNIFORM RELOCATION ASSISTANCE AND REAL PROPERTY ACQUISITION FOR FEDERAL AND FEDERALLY-ASSISTED PROGRAMS Real Property Acquisition § 24.102 Basic acquisition...

Tank 241-AZ-102 tank characterization plan

International Nuclear Information System (INIS)

Schreiber, R.D.

1995-01-01

The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process ... Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for tank 241-AZ-102 (AZ-102) sampling activities. Tank AZ-102 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The current contents of Tank AZ-102, as of October 31, 1994, consisted of 3,600 kL (950 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-102 is expected to have two primary layers. The bottom layer is composed of 360 kL of sludge, and the top layer is composed of 3,240 kL of supernatant, with a total tank waste depth of approximately 8.9 meters

Electron beam and laser surface alloying of Al-Si base alloys

International Nuclear Information System (INIS)

Vanhille, P.; Tosto, S.; Pelletier, J.M.; Issa, A.; Vannes, A.B.; Criqui, B.

1992-01-01

Surface alloying on aluminium-base alloys is achieved either by using an electron beam or a laser beam, in order to improve the mechanical properties of the near-surface region. A predeposit of nickel is first realized by plasma spraying. Melting of both the coating and part of the substrate produces a surface alloy with a fine, dendritic microstructure with a high hardness. Enhancement of this property requires an increase in the nickel content. Various problems occur during the formation of nickel-rich surface layers: incomplete homogenization owing to a progressive increase of the liquidus temperature, cracks owing to the brittleness of this hard suface alloy, formation of a plasma when experiments are carried out in a gaseous environment (laser surface alloying). Nevertheless, various kinds of surface layers may be achieved; for example very hard surface alloys (HV 0.2 =900), with a thickness of about 500-600 μm, or very thick surface alloys (e>2 mm), with a fairly good hardness (greater than 350 HV 0.2 ). Thus, it is possible to obtain a large variety of new materials by using high energy beams on aluminium substrates. (orig.)

13 CFR 127.102 - What are the definitions of the terms used in this part?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the definitions of the terms used in this part? 127.102 Section 127.102 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION WOMEN-OWNED SMALL BUSINESS FEDERAL CONTRACT ASSISTANCE PROCEDURES General Provisions § 127.102...

Effect of alloying elements on the stability of Ni2M in Alloy690 based upon thermodynamic calculation

International Nuclear Information System (INIS)

Horiuchi, Toshiaki; Kuwano, Kazuhiro; Satoh, Naohiro

2012-01-01

Some researchers recently point out that Ni based alloys used in nuclear power plants have the ordering tendency, which is a potential to decrease mechanical properties within the expected lifetime of the plants. In the present study, authors evaluated the effect of 8 alloying elements on the ordering tendency in Alloy690 based upon thermodynamic calculation by Thermo-Calc. It is clarified that the additive amount of Fe, Cr, Ti and Si, particularly Fe and Cr, was influential for the stability of Ni 2 M, while that of Mn, Cu, B and C had almost no effect for that. Authors therefore designed the Ni 2 M stabilized alloy by no addition of Fe in Alloy690. Ni 2 M is estimated to be stable even at 773 K in the Ni 2 M stabilized alloy. The influence by long range ordering or precipitating of Ni 2 M in Alloy690 for mechanical properties or SCC susceptibility is expected to be clarified by the sample obtained in the present study. (author)

Alloying Solid Solution Strengthening of Fe-Ga Alloys: A First-Principle Study

National Research Council Canada - National Science Library

Chen, Kuiying; Cheng, Leon M

2006-01-01

... and Co in cubic solid solution of Fe-Ga alloys. Mayer bond order "BO" values were used to evaluate the atomic bond strengths in the alloys, and were then used to assess the alloying strengthening characteristics...

Thermodynamic properties of uranium in gallium–aluminium based alloys

International Nuclear Information System (INIS)

Volkovich, V.A.; Maltsev, D.S.; Yamshchikov, L.F.; Chukin, A.V.; Smolenski, V.V.; Novoselova, A.V.; Osipenko, A.G.

2015-01-01

Activity, activity coefficients and solubility of uranium was determined in gallium-aluminium alloys containing 1.6 (eutectic), 5 and 20 wt.% aluminium. Additionally, activity of uranium was determined in aluminium and Ga–Al alloys containing 0.014–20 wt.% Al. Experiments were performed up to 1073 K. Intermetallic compounds formed in the alloys were characterized by X-ray diffraction. Partial and excess thermodynamic functions of U in the studied alloys were calculated. - Highlights: • Thermodynamics of uranium is determined in Ga–Al alloys of various compositions. • Uranium in the mixed alloys interacts with both components, Ga and Al. • Interaction of U with Al increases with decreasing temperature. • Activity and solubility of uranium depend on Al content in Ga–Al alloys.

Thermodynamic properties of uranium in gallium–aluminium based alloys

Energy Technology Data Exchange (ETDEWEB)

Volkovich, V.A., E-mail: v.a.volkovich@urfu.ru [Department of Rare Metals and Nanomaterials, Institute of Physics and Technology, Ural Federal University, Ekaterinburg, 620002 (Russian Federation); Maltsev, D.S.; Yamshchikov, L.F. [Department of Rare Metals and Nanomaterials, Institute of Physics and Technology, Ural Federal University, Ekaterinburg, 620002 (Russian Federation); Chukin, A.V. [Department of Theoretical Physics and Applied Mathematics, Institute of Physics and Technology, Ural Federal University, Ekaterinburg, 620002 (Russian Federation); Smolenski, V.V.; Novoselova, A.V. [Institute of High-Temperature Electrochemistry UD RAS, Ekaterinburg, 620137 (Russian Federation); Osipenko, A.G. [JSC “State Scientific Centre - Research Institute of Atomic Reactors”, Dimitrovgrad, 433510 (Russian Federation)

2015-10-15

Activity, activity coefficients and solubility of uranium was determined in gallium-aluminium alloys containing 1.6 (eutectic), 5 and 20 wt.% aluminium. Additionally, activity of uranium was determined in aluminium and Ga–Al alloys containing 0.014–20 wt.% Al. Experiments were performed up to 1073 K. Intermetallic compounds formed in the alloys were characterized by X-ray diffraction. Partial and excess thermodynamic functions of U in the studied alloys were calculated. - Highlights: • Thermodynamics of uranium is determined in Ga–Al alloys of various compositions. • Uranium in the mixed alloys interacts with both components, Ga and Al. • Interaction of U with Al increases with decreasing temperature. • Activity and solubility of uranium depend on Al content in Ga–Al alloys.

Synapse associated protein 102 (SAP102 binds the C-terminal part of the scaffolding protein neurobeachin.

Directory of Open Access Journals (Sweden)

Juliane Lauks

Full Text Available Neurobeachin (Nbea is a multidomain scaffold protein abundant in the brain, where it is highly expressed during development. Nbea-null mice have severe defects in neuromuscular synaptic transmission resulting in lethal paralysis of the newborns. Recently, it became clear that Nbea is important also for the functioning of central synapses, where it is suggested to play a role in trafficking membrane proteins to both, the pre- and post-synaptic sites. So far, only few binding partners of Nbea have been found and the precise mechanism of their trafficking remains unclear. Here, we used mass spectrometry to identify SAP102, a MAGUK protein implicated in trafficking of the ionotropic glutamate AMPA- and NMDA-type receptors during synaptogenesis, as a novel Nbea interacting protein in mouse brain. Experiments in heterologous cells confirmed this interaction and revealed that SAP102 binds to the C-terminal part of Nbea that contains the DUF, PH, BEACH and WD40 domains. Furthermore, we discovered that introducing a mutation in Nbea's PH domain, which disrupts its interaction with the BEACH domain, abolishes this binding, thereby creating an excellent starting point to further investigate Nbea-SAP102 function in the central nervous system.

Translating VDM to Alloy

DEFF Research Database (Denmark)

Lausdahl, Kenneth

2013-01-01

specifications. However, to take advantage of the automated analysis of Alloy, the model-oriented VDM specifications must be translated into a constraint-based Alloy specifications. We describe how a sub- set of VDM can be translated into Alloy and how assertions can be expressed in VDM and checked by the Alloy...

Grindability of dental magnetic alloys.

Science.gov (United States)

Hayashi, Eisei; Kikuchi, Masafumi; Okuno, Osamu; Kimura, Kohei

2005-06-01

In this study, the grindability of cast magnetic alloys (Fe-Pt-Nb magnetic alloy and magnetic stainless steel) was evaluated and compared with that of conventional dental casting alloys (Ag-Pd-Au alloy, Type 4 gold alloy, and cobalt-chromium alloy). Grindability was evaluated in terms of grinding rate (i.e., volume of metal removed per minute) and grinding ratio (i.e., volume ratio of metal removed compared to wheel material lost). Solution treated Fe-Pt-Nb magnetic alloy had a significantly higher grinding rate than the aged one at a grinding speed of 750-1500 m x min(-1). At 500 m x min(-1), there were no significant differences in grinding rate between solution treated and aged Fe-Pt-Nb magnetic alloys. At a lower speed of 500 m x min(-1) or 750 m x min(-1), it was found that the grinding rates of aged Fe-Pt-Nb magnetic alloy and stainless steel were higher than those of conventional casting alloys.

Recombinant protective antigen 102 (rPA102): profile of a second-generation anthrax vaccine.

Science.gov (United States)

Keitel, Wendy A

2006-08-01

Recent terrorist attacks involving the use of Bacillus anthracis spores have stimulated interest in the development of new vaccines for anthrax prevention. Studies of the pathogenesis of anthrax and of the immune responses following infection and immunization underscore the pivotal role that antibodies to the protective antigen play in protection. The most promising vaccine candidates contain purified recombinant protective antigen. Clinical trials of one of these, recombinant protective antigen (rPA)102, are underway. Initial results suggest that rPA102 is well tolerated and immunogenic. Additional trials are necessary to identify optimal formulations and immunization regimens for pre- and postexposure prophylaxis. Future licensure of these and other candidate vaccines will depend on their safety and immunogenicity profiles in humans, and their ability to confer protection in animal models of inhalational anthrax.

First-principles study on the effect of alloying elements on the elastic deformation response in β-titanium alloys

International Nuclear Information System (INIS)

Gouda, Mohammed K.; Gepreel, Mohamed A. H.; Nakamura, Koichi

2015-01-01

Theoretical deformation response of hypothetical β-titanium alloys was investigated using first-principles calculation technique under periodic boundary conditions. Simulation was carried out on hypothetical 54-atom supercell of Ti–X (X = Cr, Mn, Fe, Zr, Nb, Mo, Al, and Sn) binary alloys. The results showed that the strength of Ti increases by alloying, except for Cr. The most effective alloying elements are Nb, Zr, and Mo in the current simulation. The mechanism of bond breaking was revealed by studying the local structure around the alloying element atom with respect to volume change. Moreover, the effect of alloying elements on bulk modulus and admissible strain was investigated. It was found that Zr, Nb, and Mo have a significant effect to enhance the admissible strain of Ti without change in bulk modulus

High strength alloys

Science.gov (United States)

Maziasz, Phillip James [Oak Ridge, TN; Shingledecker, John Paul [Knoxville, TN; Santella, Michael Leonard [Knoxville, TN; Schneibel, Joachim Hugo [Knoxville, TN; Sikka, Vinod Kumar [Oak Ridge, TN; Vinegar, Harold J [Bellaire, TX; John, Randy Carl [Houston, TX; Kim, Dong Sub [Sugar Land, TX

2010-08-31

High strength metal alloys are described herein. At least one composition of a metal alloy includes chromium, nickel, copper, manganese, silicon, niobium, tungsten and iron. System, methods, and heaters that include the high strength metal alloys are described herein. At least one heater system may include a canister at least partially made from material containing at least one of the metal alloys. At least one system for heating a subterranean formation may include a tubular that is at least partially made from a material containing at least one of the metal alloys.

26 CFR 509.102 - Applicable provisions of law.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Applicable provisions of law. 509.102 Section... UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.102 Applicable provisions of law. (a) General... reason of any alteration of law in relation to internal revenue. (b) Retroactivity of regulations or...

22 CFR 41.102 - Personal appearance of applicant.

Science.gov (United States)

2010-04-01

... interview. (d) Cases in which personal appearance may not be waived. A consular officer or the Deputy... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Personal appearance of applicant. 41.102... IMMIGRATION AND NATIONALITY ACT, AS AMENDED Application for Nonimmigrant Visa § 41.102 Personal appearance of...

41 CFR 102-192.120 - Must we have an agency mail manager?

Science.gov (United States)

2010-07-01

... mail manager? 102-192.120 Section 102-192.120 Public Contracts and Property Management Federal Property... MANAGEMENT Agency Mail Manager Requirements § 102-192.120 Must we have an agency mail manager? Yes, every Federal agency as defined in § 102-192.35 must have an agency mail manager. Agencies that are not “large...

Influence of the selected alloy additions on limiting the phase formation in Cu-Zn alloys

OpenAIRE

J. Kozana; St. Rzadkosz; M. Piękoś

2010-01-01

Influence of the selected alloy additions into copper and zinc alloys was investigated in order to find out the possibility of limiting the precipitation of unfavourable phase . The observation of microstructures and strength tests were performed. The results of metallographic and strength investigations indicate positive influence of small amounts of nickel, cobalt or tellurium. The precise determination of the influence of the selected alloy additions on limiting the gamma phase formation ...

Effect of stress on the superconducting transition temperature in indium, indium-alloy, tin, and tin-alloy whisker samples

International Nuclear Information System (INIS)

Cook, J.W. Jr.; Davis, W.T.; Chandler, J.H.; Skove, M.J.

1977-01-01

The dependence of the superconducting transition temperature (T/sub c/) on stress (sigma) for pure In and Sn samples was found to be in qualitative agreement with earlier work. For convenience T/sub c/ is expressed as a function of the experimentally measured strain (epsilon), which is proportional to sigma. The effect of alloying on the initial dependence of the T/sub c/-vs-epsilon curves, (per. delta T/sub c//per. delta epsilon)/sub epsilon = 0/ = eta, was quite different for the In and Sn alloys. The In samples were alloyed with a maximum of 4.8 at.% Tl, 7.9 at.% Sn, and 6.7 at.% Pd; the Sn samples were alloyed with a maximum of 0.3 at.% Cd, 6.0 at.% In, 0.3 at.% Sb, and 2.2 at.% Bi. The addition of impurities had a large effect on eta for the In alloys, with eta reversing sign for some Sn and Pb alloy contents (chi). The T/sub c/-vs-epsilon curves also became nonlinear for some chi. The possible relationship of the In alloy results to changes in the Fermi surface due to the addition of impurities is discussed. For the Sn alloy samples, there was no change in eta with any impurity. The change in room-temperature resistivity with strain was also measured. There was only a slight decrease in the dependence of resistivity on strain for the In--Sn and In--Pb data and no effect on the In--Tl or Sn alloy data

Decagonal quasicrystalline phase in as-cast and mechanically alloyed Al–Cu–Cr alloys

International Nuclear Information System (INIS)

Shevchukov, A.P.; Sviridova, T.A.; Kaloshkin, S.D.; Tcherdyntsev, V.V.; Gorshenkov, M.V.; Churyukanova, M.N.; Zhang, D.; Li, Z.

2014-01-01

Highlights: ► Microstructure of as-cast Al–Cu–Cr alloys was investigated. ► Composition of decagonal quasicrystalline phase was determined. ► Single-phase decagonal quasicrystalline powder was obtained. ► Phase composition changes during heating were controlled using DSC and X-ray diffraction. -- Abstract: Microstructure and phase composition of three Al-rich as-cast alloys of Al–Cu–Cr system were investigated by X-ray diffraction analysis (XRD) and scanning electron microscopy (SEM). The decagonal quasicrystalline phase is contained in all alloys under study and has grains with faceted shape, its composition lies in the range of 71–73 at.% Al, 11–12 at.% Cu and 15–18 at.% Cr. The heating in calorimeter of the mechanically alloyed Al 73 Cu 11 Cr 16 powder up to 600 °C leads to the formation of the pure decagonal phase. Total thermal effect in the temperature range 250–600 °C corresponding to the quasicrystalline phase formation is about 15 kJ/mol

Quantitative proteomic analysis of the inhibitory effects of CIL-102 on viability and invasiveness in human glioma cells

International Nuclear Information System (INIS)

Teng, Chih-Chuan; Kuo, Hsing-Chun; Sze, Chun-I

2013-01-01

CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone), the major active agent of the alkaloid derivative, has been demonstrated to exert anticancer effects. Herein, we present an investigation focused on the identification of the target(s) of CIL-102's action and the mechanism of its action in apoptotic and anti-invasive pathways. Proteomic approaches were used to purify and identify the protein substrates using 2D difference gel electrophoresis (2D SDS-PAGE) to assess changes in the expression of relevant protein treatment with CIL-102 that resulted in the inhibition of viability and invasion. Our results demonstrate that CIL-102 treatment of U87 cells decreased cell proliferation and invasiveness. CIL-102 dose-dependent induction of apoptosis and inhibitory invasiveness were accompanied by sustained phosphorylation of JNK1/2 and p70S6K as well as generation of the reactive oxygen species. In addition, differential proteins displayed between CIL-102-treated and untreated U87 were determined and validated. There were 11 differentially expressed proteins between the CIL-102-treated and untreated groups. Furthermore, we demonstrated that CIL-102 inhibited cancer cell proliferation and reduced anti-invasion properties by up-regulating the levels of FUMH (Fumarate hydratase). The investigation demonstrated that there was an increase in the cellular levels of FUMH in the CIL-102 reduction in viability and invasion via the activation of JNK1/2 and mTOR signaling modules. NAC administration and shRNA FUMH conferred resistance to CIL-102-inhibited HIF1α and MMP-2 levels via inhibition of JNK1/2 and mTOR activation. We concluded that CIL-102-induced an apoptosis cascade and decreased aggressiveness in astrocytoma cells by modulation of mitochondria function, providing a new mechanism for CIL-102 treatment. - Highlights: • We found the effect of CIL-102 on neuroblastoma cells. • Fumarate hydratase as a CIL-102's target by proteomic differential displays. • CIL

Quantitative proteomic analysis of the inhibitory effects of CIL-102 on viability and invasiveness in human glioma cells

Energy Technology Data Exchange (ETDEWEB)

Teng, Chih-Chuan [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Taiwan (China); Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Institute of Basic Medicine Science, National Cheng Kung University, Tainan, Taiwan (China); Kuo, Hsing-Chun [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Taiwan (China); Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Department of Medical Research China Medical University Hospital, Taichung, Taiwan (China); Sze, Chun-I, E-mail: szec@mail.ncku.edu.tw [Institute of Basic Medicine Science, Department of Cell Biology and Anatomy and Pathology, National Cheng Kung University, Tainan, Taiwan (China)

2013-11-01

CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone), the major active agent of the alkaloid derivative, has been demonstrated to exert anticancer effects. Herein, we present an investigation focused on the identification of the target(s) of CIL-102's action and the mechanism of its action in apoptotic and anti-invasive pathways. Proteomic approaches were used to purify and identify the protein substrates using 2D difference gel electrophoresis (2D SDS-PAGE) to assess changes in the expression of relevant protein treatment with CIL-102 that resulted in the inhibition of viability and invasion. Our results demonstrate that CIL-102 treatment of U87 cells decreased cell proliferation and invasiveness. CIL-102 dose-dependent induction of apoptosis and inhibitory invasiveness were accompanied by sustained phosphorylation of JNK1/2 and p70S6K as well as generation of the reactive oxygen species. In addition, differential proteins displayed between CIL-102-treated and untreated U87 were determined and validated. There were 11 differentially expressed proteins between the CIL-102-treated and untreated groups. Furthermore, we demonstrated that CIL-102 inhibited cancer cell proliferation and reduced anti-invasion properties by up-regulating the levels of FUMH (Fumarate hydratase). The investigation demonstrated that there was an increase in the cellular levels of FUMH in the CIL-102 reduction in viability and invasion via the activation of JNK1/2 and mTOR signaling modules. NAC administration and shRNA FUMH conferred resistance to CIL-102-inhibited HIF1α and MMP-2 levels via inhibition of JNK1/2 and mTOR activation. We concluded that CIL-102-induced an apoptosis cascade and decreased aggressiveness in astrocytoma cells by modulation of mitochondria function, providing a new mechanism for CIL-102 treatment. - Highlights: • We found the effect of CIL-102 on neuroblastoma cells. • Fumarate hydratase as a CIL-102's target by proteomic differential

Mechanism of serrated flow in binary Al-Li alloys

Energy Technology Data Exchange (ETDEWEB)

Kumar, S.; Pink, E. [Austrian Academy of Sciences, Leoben (Austria). Erich-Schmid-Inst. of Solid State Physics; Krol, J. [Polish Academy of Sciences, Krakow (Poland). Alexander-Krupkowski-Inst. of Metallurgy and Materials Science

1996-09-15

The work on serrated flow in Al-Li alloys has given rise to a controversy--whether serrations in these alloys are caused by lithium atoms in solid solution or by {delta}{prime}(Al{sub 3}Li)-precipitates. This controversy calls for further work to clarify the mechanism of serrated flow in the Al-Li alloys. Kumar and McShane have shown that in an Al-2.5Li-2Mg-0.14Zr alloy, non-shearable {delta}{prime}-precipitates, which are obtained in the under-aged and peak-aged conditions, might directly initiate serrated flow. However, the latter result was ambiguous because of the presence of other alloying elements, and the need to work on a binary Al-Li alloy was emphasized. The present work discusses the results from the binary Al-Li alloys.

10 CFR 2.102 - Administrative review of application.

Science.gov (United States)

2010-01-01

... proceeding to confer with the NRC staff informally. In the case of docketed application for a limited work... 10 Energy 1 2010-01-01 2010-01-01 false Administrative review of application. 2.102 Section 2.102... ORDERS Procedure for Issuance, Amendment, Transfer, or Renewal of a License, and Standard Design Approval...

Nature of negative microplastic deformation in alloys

International Nuclear Information System (INIS)

Palatnik, L.S.; Ivantsov, V.I.; Kagan, Ya.I.; Papirov, I.I.; Fat'yanova, N.B.; AN Ukrainskoj SSR, Kharkov. Fiziko-Tekhnicheskij Inst.)

1985-01-01

The paper deals with investigation of microplastic deformation of corrosion resistant aging 40KhNYU alloy and the study of physical nature of negative microdeformation in this alloy under tension. Investigation of microplasticity of 40KhNYU alloy was conducted by the method of mechanostatic hysteresis using resistance strain gauge for measuring stresses and deformations. Microplasticity curves for 40KhNYU alloy were obtained. They represent the result of competition between usual (positive) microdeformation and phase (negative) deformation under tensile effect on the alloy. It was established that the negative microdeformation increment occurs during secondary aging of the phase precipitated from initial supersat urated solid solution (primary decomposition product). This phase decomposes under tension with disperse phase precipitation which promotes decreasing its specific volume and specimen volume as a whole

24 CFR 1000.102 - What are eligible affordable housing activities?

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What are eligible affordable housing activities? 1000.102 Section 1000.102 Housing and Urban Development Regulations Relating to... § 1000.102 What are eligible affordable housing activities? Eligible affordable housing activities are...

In vitro and in vivo studies on biodegradable magnesium alloy

Directory of Open Access Journals (Sweden)

Lida Hou

2014-10-01

Full Text Available The microstructure, mechanical property, electrochemical behavior and biocompatibility of magnesium alloy (BioDe MSM™ were studied in the present work. The experimental results demonstrated that grain refining induced by extrusion improves the alloy strength significantly from 162 MPa for the as-cast alloy to 241 MPa for the as-extruded one. The anticorrosion properties of the as-extruded alloy also increased. Furthermore, the hemolysis ratio was decreased from 4.7% for the as-cast alloy to 2.9% for the as-extruded one, both below 5%. BioDe MSM™ alloy shows good biocompatibility after being implanted into the dorsal muscle and the femoral shaft of the New Zealand rabbit, respectively, and there are no abnormalities after short-term implantation. In vivo observation indicated that the corrosion rate of this alloy varies with different implantation positions, with higher degradation rate in the femur than in the muscle.

41 CFR 102-2.145 - To what do pronouns refer when used in the FMR?

Science.gov (United States)

2010-07-01

... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.145 To what do pronouns refer when used... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false To what do pronouns refer when used in the FMR? 102-2.145 Section 102-2.145 Public Contracts and Property Management Federal...

Hydrogen storage in Ti-Mn-(FeV) BCC alloys

International Nuclear Information System (INIS)

Santos, S.F.; Huot, J.

2009-01-01

Recently, the replacement of vanadium by the less expensive (FeV) commercial alloy has been investigated in Ti-Cr-V BCC solid solutions and promising results were reported. In the present work, this approach of using (FeV) alloys is adopted to synthesize alloys of the Ti-Mn-V system. Compared to the V-containing alloys, the alloys containing (FeV) have a smaller hydrogen storage capacity but a larger reversible hydrogen storage capacity, which is caused by the increase of the plateau pressure of desorption. Correlations between the structure and the hydrogen storage properties of the alloys are also discussed.

41 CFR 102-80.75 - Who assesses environmental issues in Federal construction and lease construction projects?

Science.gov (United States)

2010-07-01

... environmental issues in Federal construction and lease construction projects? 102-80.75 Section 102-80.75 Public... Management Assessment of Environmental Issues § 102-80.75 Who assesses environmental issues in Federal construction and lease construction projects? Federal agencies must assess required environmental issues...

Neutron-absorbing alloys

International Nuclear Information System (INIS)

Portnoi, K.I.; Arabei, L.B.; Gryaznov, G.M.; Levi, L.I.; Lunin, G.L.; Kozhukhov, V.M.; Markov, J.M.; Fedotov, M.E.

1975-01-01

A process is described for the production of an alloy consiting of 1 to 20% In, 0.5 to 15% Sm, and from 3 to 18% Hf, the balance being Ni. Such alloys show a good absorption capacity for thermal and intermediate neutrons, good neutron capture efficiency, and good corrosion resistance, and find application in nuclear reactor automatic control and safety systems. The Hf provides for the maintenance of a reasonably high order of neutron capture efficiency throughout the lifetime of a reactor. The alloys are formed in a vacuum furnace operating with an inert gas atmosphere at 280 to 300 mm.Hg. They have a corrosion resistance from 3 to 3.5 times that of the Ag-based alloys commonly employed, and a neutron capture efficiency about twice that of the Ag alloys. Castability and structural strength are good. (U.K.)

Systematic corrosion investigation of various Cu-Sn alloys electrodeposited on mild steel in acidic solution: Dependence of alloy composition

Energy Technology Data Exchange (ETDEWEB)

Suerme, Yavuz, E-mail: ysurme@nigde.edu.t [Department of Chemistry, Faculty of Science and Art, Nigde University, 51200 Nigde (Turkey); Guerten, A. Ali [Department of Chemistry, Faculty of Science and Art, Osmaniye Korkut Ata University, 80000 Osmaniye (Turkey); Bayol, Emel; Ersoy, Ersay [Department of Chemistry, Faculty of Science and Art, Nigde University, 51200 Nigde (Turkey)

2009-10-19

Copper-tin alloy films were galvanostatically electrodeposited on the mild steel (MS) by combining the different amount of Cu and Sn electrolytes at a constant temperature (55 deg. C) and pH (3.5). Alloy films were characterized by using the energy dispersive X-ray analysis (EDX), scanning electron microscopy (SEM), X-ray diffraction (XRD) and micrographing techniques. Corrosion behaviours were evaluated with electrochemical impedance spectrometry (EIS) and electrochemical polarization measurements. Time gradient of electrolysis process was adjusted to obtain same thickness of investigated alloys on MS. The systematic corrosion investigation of various Cu{sub x}-Sn{sub 100-x} (x = 0-100) alloy depositions on MS substrate were carried out in 0.1 M sulphuric acid medium. Results indicate that the corrosion resistance of the alloy coatings depended on the alloy composition, and the corrosion resistance increased at Cu-Sn alloy deposits in proportion to Sn ratio.

31 CFR 800.102 - Effect on other law.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Effect on other law. 800.102 Section... TAKEOVERS BY FOREIGN PERSONS General § 800.102 Effect on other law. Nothing in this part shall be construed..., or review provided by or established under any other provision of federal law, including the...

41 CFR 102-79.105 - What is the Integrated Workplace?

Science.gov (United States)

2010-07-01

... changing needs of the occupants and the organization. Integrated Workplace concepts support the objectives... Workplace? 102-79.105 Section 102-79.105 Public Contracts and Property Management Federal Property... UTILIZATION OF SPACE Assignment and Utilization of Space Integrated Workplace § 102-79.105 What is the...

27 CFR 24.102 - Premises established for taxpaid wine operations.

Science.gov (United States)

2010-04-01

... taxpaid wine operations. 24.102 Section 24.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Premises and Operations § 24.102 Premises established for taxpaid wine operations. A person desiring to bottle...

Effect of mechanical alloying on FeCrC reinforced Ni alloys

Energy Technology Data Exchange (ETDEWEB)

Yilmaz, S. Osman [Univ. of Namik Kemal, Tekirdag (Turkey); Teker, Tanju [Adiyaman Univ. (Turkey). Dept. of Metallurgical and Materials Engineering; Demir, Fatih [Batman Univ. (Turkey)

2016-05-01

Mechanical alloying (MA) is a powder metallurgy processing technique involving cold welding, fracturing and rewelding of powder particles in a high-energy ball mill. In the present study, the intermetallic matrix composites (IMCs) of Ni-Al reinforced by M{sub 7}C{sub 3} were produced by powder metallurgical routes via solid state reaction of Ni, Al and M{sub 7}C{sub 3} particulates by mechanical alloying processes. Ni, Al and M{sub 7}C{sub 3} powders having 100 μm were mixed, mechanical alloyed and the compacts were combusted in a furnace. The mechanically alloyed (MAed) powders were investigated by X-ray diffraction (XRD), microhardness measurement, optic microscopy (OM), scanning electron microscopy (SEM) and energy dispersive spectrometry (EDS). The presence of the carbides depressed the formation of unwanted NiAl intermetallic phases. The mechanical alloyed M{sub 7}C{sub 3} particles were unstable and decomposed partially within the matrix during alloying and sintering, and the morphology of the composites changed with the dissolution ratio of M{sub 7}C{sub 3} and sintering temperature.

Stochastic simulation of nucleation in binary alloys

Science.gov (United States)

L’vov, P. E.; Svetukhin, V. V.

2018-06-01

In this study, we simulate nucleation in binary alloys with respect to thermal fluctuations of the alloy composition. The simulation is based on the Cahn–Hilliard–Cook equation. We have considered the influence of some fluctuation parameters (wave vector cutoff and noise amplitude) on the kinetics of nucleation and growth of minority phase precipitates. The obtained results are validated by the example of iron–chromium alloys.

41 CFR 102-34.330 - What is the Federal Fleet Report?

Science.gov (United States)

2010-07-01

... Fleet Report? 102-34.330 Section 102-34.330 Public Contracts and Property Management Federal Property... MANAGEMENT Federal Fleet Report § 102-34.330 What is the Federal Fleet Report? The Federal Fleet Report (FFR..., in evaluating the effectiveness of the operation and management of individual fleets to determine...

Nonswelling alloy

Science.gov (United States)

Harkness, S.D.

1975-12-23

An aluminum alloy containing one weight percent copper has been found to be resistant to void formation and thus is useful in all nuclear applications which currently use aluminum or other aluminum alloys in reactor positions which are subjected to high neutron doses.

Nonswelling alloy

International Nuclear Information System (INIS)

Harkness, S.D.

1975-01-01

An aluminum alloy containing one weight percent copper has been found to be resistant to void formation and thus is useful in all nuclear applications which currently use aluminum or other aluminum alloys in reactor positions which are subjected to high neutron doses

18 CFR 375.102 - Custody and authentication of Commission records.

Science.gov (United States)

2010-04-01

... authentication of Commission records. 375.102 Section 375.102 Conservation of Power and Water Resources FEDERAL... Provisions § 375.102 Custody and authentication of Commission records. (a) Custody of official records. (1...) Authentication of Commission action. All orders and other actions of the Commission shall be authenticated or...

41 CFR 102-72.40 - What are facility management delegations?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are facility management delegations? 102-72.40 Section 102-72.40 Public Contracts and Property Management Federal Property... AUTHORITY Delegation of Authority § 102-72.40 What are facility management delegations? Facility management...

Local environment effects in disordered alloys

International Nuclear Information System (INIS)

Cable, J.W.

1978-01-01

The magnetic moment of an atom in a ferromagnetic disordered alloy depends on the local environment of that atom. This is particularly true for Ni and Pd based alloys for which neutron diffuse scattering measurements of the range and magnitude of the moment disturbances indicate that both magnetic and chemical environment are important in determining the moment distribution. In this paper we review recent neutron studies of local environment effects in Ni based alloys. These are discussed in terms of a phenomenological model that allows a separation of the total moment disturbance at a Ni site into its chemical and magnetic components

Radiation enhanced diffusion in FCC alloys

International Nuclear Information System (INIS)

Schuele, W.

1982-01-01

In many alloys vacancies and interstitials can be identified in a straight forward way by measurements of radiation enhanced diffusion. In some alloys, however, quenching experiments are also necessary for the identification of these defects. Results for two characteristic alloys in which the transformation rate during high energy particle irradiation is determined by an interstitialcy and by a vacancy diffusion mechanism only, are discussed. It is also shown that a decrease of the migration energy of defects due to an interaction of the high energy particles with the lattice atoms must be taken into account in the interpretation of the results. (author)

Irradiation-induced microstructural changes in alloy X-750

International Nuclear Information System (INIS)

Kenik, E.A.

1997-01-01

Alloy X-750 is a nickel base alloy that is often used in nuclear power systems for it's excellent corrosion resistance and mechanical properties. The present study examines the microstructure and composition profiles in a heat of Alloy X-750 before and after neutron irradiation

Influence of the selected alloy additions on limiting the phase formation in Cu-Zn alloys

Directory of Open Access Journals (Sweden)

J. Kozana

2010-01-01

Full Text Available Influence of the selected alloy additions into copper and zinc alloys was investigated in order to find out the possibility of limiting the precipitation of unfavourable phase . The observation of microstructures and strength tests were performed. The results of metallographic and strength investigations indicate positive influence of small amounts of nickel, cobalt or tellurium. The precise determination of the influence of the selected alloy additions on limiting the gamma phase formation will be the subject of further examinations.

Thermoelectrical power analysis of precipitation in 6013 aluminum alloy

International Nuclear Information System (INIS)

Abdala, M.R.W.S.; Garcia de Blas, J.C.; Barbosa, C.; Acselrad, O.

2008-01-01

The 6013 aluminum alloy was first developed for application in the aircraft industry and, more recently, as a replacement option for the use of the 6061 alloy in the automotive industry. The present work describes the evolution of the process of formation and dissolution of different kinds of precipitates in 6013 aluminum alloy, subjected to different conditions of heat treatment, using for this purpose measurements of thermoelectrical power, Vickers microhardness and differential scanning calorimeter (DSC). Although in the last years many works have been published on the use of thermoelectrical power (TEP) measurements for the analysis of precipitation process in traditional alloys such as 6061, there is still little information related to 6013 alloy. The results obtained are compared with a previous characterization work on the same alloy using transmission electron microscopy. It was observed that TEP measurements are very sensitive to precipitation phenomena in this alloy, and it has been found that there is an inverse relation between TEP and Vickers microhardness values, which allowed proposing a precipitation sequence for 6013 aluminum alloy

Phase decomposition in a mechanically alloyed Cu-44.5 at%Ni-22.5 at%Fe alloy during isothermal aging

International Nuclear Information System (INIS)

Lopez-Hirata, Victor M.; Saucedo-Munoz, Maribel L.; Diaz-Barriga-Arceo, Lucia G.

2006-01-01

A supersaturated solid solution of Cu-44.5 at%Ni-22.5 at%Fe alloy was produced by ball milling of a pure chemical elemental mixture for 1080 ks. An fcc supersaturated solid solution with a grain size of about 20 nm was obtained after milling. This alloy was subsequently aged at 803, 898 and 1003 K for different times. The growth kinetics of the modulation wavelength was determined from the X-ray diffraction results and followed the Lifshitz-Slyozov-Wagner theory for a diffusion-controlled coarsening in the MA alloy after aging. The growth kinetics of composition modulation wavelength for the MA alloy was faster at 803 and 898 K than that for the same alloy composition obtained by a conventional processing and then aged at the same temperatures. The activation energy for the decomposed phase coarsening process in the MA alloy was lower than that corresponding to the conventionally-processed alloy. (author)

Monitoring alloy formation during mechanical alloying process by x-ray diffraction techniques

International Nuclear Information System (INIS)

Abdul Kadir Masrom; Noraizam Md Diah; Mazli Mustapha

2002-01-01

Monitoring alloying (MA) is a novel processing technique that use high energy impact ball mill to produce alloys with enhanced properties and microscopically homogeneous materials starting from various powder mixtures. Mechanical alloying process was originally developed to produce oxide dispersion strengthened nickel superalloys. In principal, in high-energy ball milling process, alloy is formed by the result of repeated welding, fracturing and rewelding of powder particles in a high energy ball mill. In this process a powder mixture in a ball mill is subjected to high-energy collisions among balls. MA has been shown to be capable of synthesizing a variety of materials. It is known to be capable to prepare equilibrium and non-equilibrium phases starting from blended elemental or prealloyed powders. The process ability to produce highly metastable materials such as amorphous alloys and nanostructured materials has made this process attractive and it has been considered as a promising material processing technique that could be used to produce many advanced materials at low cost. The present study explores the conditions under which aluminum alloys formation occurs by ball milling of blended aluminum and its alloying elements powders. In this work, attempt was made in producing aluminum 2024 alloys by milling of blended elemental aluminum powder of 2024 composition in a stainless steel container under argon atmosphere for up to 210 minutes. X-ray diffraction together with thermal analysis techniques has been used to monitor phase changes in the milled powder. Results indicate that, using our predetermined milling parameters, alloys were formed after 120 minutes milling. The thermal analysis data was also presented in this report. (Author)

14 CFR 1201.102 - Functions.

Science.gov (United States)

2010-01-01

... INFORMATION Introduction § 1201.102 Functions. In order to carry out the purpose of the Act, NASA is... utilization of the scientific and engineering resources of the United States with other nations engaged in...

Room temperature creep in metals and alloys

Energy Technology Data Exchange (ETDEWEB)

Deibler, Lisa Anne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Materials Characterization and Performance

2014-09-01

Time dependent deformation in the form of creep and stress relaxation is not often considered a factor when designing structural alloy parts for use at room temperature. However, creep and stress relaxation do occur at room temperature (0.09-0.21 T_m for alloys in this report) in structural alloys. This report will summarize the available literature on room temperature creep, present creep data collected on various structural alloys, and finally compare the acquired data to equations used in the literature to model creep behavior. Based on evidence from the literature and fitting of various equations, the mechanism which causes room temperature creep is found to include dislocation generation as well as exhaustion.

Influence of the alloying effect on nickel K-shell fluorescence yield in Ni Si alloys

Science.gov (United States)

Kalayci, Y.; Agus, Y.; Ozgur, S.; Efe, N.; Zararsiz, A.; Arikan, P.; Mutlu, R. H.

2005-02-01

Alloying effects on the K-shell fluorescence yield ωK of nickel in Ni-Si binary alloy system have been studied by energy dispersive X-ray fluorescence. It is found that ωK increases from pure Ni to Ni 2Si and then decreases from Ni 2Si to NiSi. These results are discussed in terms of d-occupation number on the Ni site and it is concluded that electronic configuration as a result of p-d hybridization explain qualitatively the observed variation of ωK in Ni-Si alloys.

Electrical conductivity in random alloys

International Nuclear Information System (INIS)

Mookerjee, A.; Yussouff, M.

1983-06-01

Starting from the augmented space formalism by one of us, and the use of the Ward identity and Bethe Salpeter equation, a complete formalism for the calculation of the electrical conductivity in tight-binding models of random binary alloys has been developed. The formalism is practical in the sense that viable calculations may be carried out with its help for realistics models of alloy systems. (author)

Effect of Alloy Elements on Microstructures and Mechanical Properties in Al-Mg-Si Alloys

Science.gov (United States)

Kato, Yoshikazu; Hisayuki, Koji; Sakaguchi, Masashi; Higashi, Kenji

Microstructures and mechanical properties in the modified Al-Mg-Si alloys with variation in the alloy elements and their contents were investigated to enhance higher strength and ductility. Optimizing both the alloy element design and the industrial processes including heat-treatments and extrusion technology was carried out along the recent suggestion from the first principles calculation. The investigation concluded that the addition of Fe and/or Cu could recovery their lost ductility, furthermore increase their tensile strength up to 420 MPa at high elongation of 24 % after T6 condition for Al-0.8mass%Mg-1.0mass%Si-0.8mass%Cu-0.5mass%Fe alloy with excess Si content. The excellent combination between strength and ductility could be obtained by improvement to the grain boundary embitterment caused by grain boundary segregation of Si as a result from the interaction of Si with Cu or Fe with optimizing the amount of Cu and Fe contents.

Laves intermetallics in stainless steel-zirconium alloys

International Nuclear Information System (INIS)

Abraham, D.P.; McDeavitt, S.M.; Richardson, J.W. Jr.

1997-01-01

Laves intermetallics have a significant effect on properties of metal waste forms being developed at Argonne National Laboratory. These waste forms are stainless steel-zirconium alloys that will contain radioactive metal isotopes isolated from spent nuclear fuel by electrometallurgical treatment. The baseline waste form composition for stainless steel-clad fuels is stainless steel-15 wt.% zirconium (SS-15Zr). This article presents results of neutron diffraction measurements, heat-treatment studies and mechanical testing on SS-15Zr alloys. The Laves intermetallics in these alloys, labeled Zr(Fe,Cr,Ni) 2+x , have both C36 and C15 crystal structures. A fraction of these intermetallics transform into (Fe,Cr,Ni) 23 Zr 6 during high-temperature annealing; the authors have proposed a mechanism for this transformation. The SS-15Zr alloys show virtually no elongation in uniaxial tension, but exhibit good strength and ductility in compression tests. This article also presents neutron diffraction and microstructural data for a stainless steel-42 wt.% zirconium (SS-42Zr) alloy

Environment assisted degradation mechanisms in aluminum-lithium alloys

Science.gov (United States)

Gangloff, Richard P.; Stoner, Glenn E.; Swanson, Robert E.

1988-01-01

Section 1 of this report records the progress achieved on NASA-LaRC Grant NAG-1-745 (Environment Assisted Degradation Mechanisms in Al-Li Alloys), and is based on research conducted during the period April 1 to November 30, 1987. A discussion of work proposed for the project's second year is included. Section 2 provides an overview of the need for research on the mechanisms of environmental-mechanical degradation of advanced aerospace alloys based on aluminum and lithium. This research is to provide NASA with the basis necessary to permit metallurgical optimization of alloy performance and engineering design with respect to damage tolerance, long term durability and reliability. Section 3 reports on damage localization mechanisms in aqueous chloride corrosion fatigue of aluminum-lithium alloys. Section 4 reports on progress made on measurements and mechanisms of localized aqueous corrosion in aluminum-lithium alloys. Section 5 provides a detailed technical proposal for research on environmental degradation of Al-Li alloys, and the effect of hydrogen in this.

Irradiation of copper alloys in FFTF

International Nuclear Information System (INIS)

Brager, H.R.; Garner, F.A.

1984-01-01

Nine copper-base alloys in thirteen material conditions have been inserted into the MOTA-18 experiment for irradiation in FFTF at approx.450 0 C. The alloy Ni-1.9Be is also included in this experiment, which includes both TEM disks and miniature tensile specimens

41 CFR 102-85.5 - By what authority is the pricing policy in this part prescribed?

Science.gov (United States)

2010-07-01

... pricing policy in this part prescribed? 102-85.5 Section 102-85.5 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.5 By what authority is the pricing policy in this part prescribed? (a) General authority is granted in the Federal Property and...

Phase transformations in the titanium-niobium binary alloy system

International Nuclear Information System (INIS)

Moffat, D.L.

1985-01-01

A fundamental study of the phase transformations in the Ti-Nb binary alloy system was completed. Eight alloys in the range 20 to 70 at% Nb were investigated using transmission electron microscopy, light metallography, and x-ray diffraction. Measurements of electric resistivity and Vicker's microhardness also were performed. Emphasis was placed on the minimization of interstitial contamination in all steps of alloy fabrication and specimen preparation. In order to eliminate the effects of prior cold working, the alloys studied were recrystallized at 1000 0 C. Phase transformations were studied in alloys quenched to room temperature after recrystallization and then isothermally aged, and in those isothermally aged without a prior room temperature quench. It was found that the microstructures of the quenched 20 and 25% Nb alloys were extremely sensitive to quench rate - with a fast quench producing martensite, a slow quench, the omega phase. Microstructures of the higher niobium content alloys were much less sensitive to quench rate. The microstructures of the isothermally aged 20 and 25% Nb alloys were found to be sensitive to prior thermal history. Alloys quenched to room temperature and then aged at 400 0 C contained large omega precipitates, while those aged without an intermediate room temperature quench contained alpha precipitates

Fusion boundary microstructure evolution in aluminum alloys

Science.gov (United States)

Kostrivas, Anastasios Dimitrios

2000-10-01

A melting technique was developed to simulate the fusion boundary of aluminum alloys using the GleebleRTM thermal simulator. Using a steel sleeve to contain the aluminum, samples were heated to incremental temperatures above the solidus temperature of a number of alloys. In alloy 2195, a 4wt%Cu-1wt%Li alloy, an equiaxed non-dendritic zone (EQZ) could be formed by heating in the temperature range from approximately 630 to 640°C. At temperatures above 640°C, solidification occurred by the normal epitaxial nucleation and growth mechanism. Fusion boundary behavior was also studied in alloys 5454-H34, 6061-T6, and 2219-T8. Additionally, experimental alloy compositions were produced by making bead on plate welds using an alloy 5454-H32 base metal and 5025 or 5087 filler metals. These filler metals contain zirconium and scandium additions, respectively, and were expected to influence nucleation and growth behavior. Both as-welded and welded/heat treated (540°C and 300°C) substrates were tested by melting simulation, resulting in dendritic and EQZ structures depending on composition and substrate condition. Orientation imaging microscopy (OIM(TM)) was employed to study the crystallographic character of the microstructures produced and to verify the mechanism responsible for EQZ formation. OIM(TM) proved that grains within the EQZ have random orientation. In all other cases, where the simulated microstructures were dendritic in nature, it was shown that epitaxy was the dominant mode of nucleation. The lack of any preferred crystallographic orientation relationship in the EQZ supports a theory proposed by Lippold et al that the EQZ is the result of heterogeneous nucleation within the weld unmixed zone. EDS analysis of the 2195 on STEM revealed particles with ternary composition consisted of Zr, Cu and Al and a tetragonal type crystallographic lattice. Microdiffraction line scans on EQZ grains in the alloy 2195 showed very good agreement between the measured Cu

Vanadium alloys for structural applications in fusion systems: A review of vanadium alloy mechanical and physical properties

Energy Technology Data Exchange (ETDEWEB)

Loomis, B.A.; Smith, D.L.

1991-12-16

The current knowledge is reviewed on (1) the effects of neutron irradiation on tensile strength and ductility, ductile-brittle transition temperature, creep, fatigue, and swelling of vanadium-base alloys, (2) the compatibility of vanadium-base alloys with liquid lithium, water, and helium environments, and (3) the effects of hydrogen and helium on the physical and mechanical properties of vanadium alloys that are potential candidates for structural materials applications in fusion systems. Also, physical and mechanical properties issues are identified that have not been adequately investigated in order to qualify a vanadium-base alloy for the structural material in experimental fusion devices and/or in fusion reactors.

Vanadium alloys for structural applications in fusion systems: A review of vanadium alloy mechanical and physical properties

International Nuclear Information System (INIS)

Loomis, B.A.; Smith, D.L.

1991-01-01

The current knowledge is reviewed on (1) the effects of neutron irradiation on tensile strength and ductility, ductile-brittle transition temperature, creep, fatigue, and swelling of vanadium-base alloys, (2) the compatibility of vanadium-base alloys with liquid lithium, water, and helium environments, and (3) the effects of hydrogen and helium on the physical and mechanical properties of vanadium alloys that are potential candidates for structural materials applications in fusion systems. Also, physical and mechanical properties issues are identified that have not been adequately investigated in order to qualify a vanadium-base alloy for the structural material in experimental fusion devices and/or in fusion reactors

Microstructural development in equiatomic multicomponent alloys

International Nuclear Information System (INIS)

Cantor, B.; Chang, I.T.H.; Knight, P.; Vincent, A.J.B.

2004-01-01

Multicomponent alloys containing several components in equal atomic proportions have been manufactured by casting and melt spinning, and their microstructures and properties have been investigated by a combination of optical microscopy, scanning electron microscopy, electron probe microanalysis, X-ray diffractrometry and microhardness measurements. Alloys containing 16 and 20 components in equal proportions are multiphase, crystalline and brittle both as-cast and after melt spinning. A five component Fe 20 Cr 20 Mn 20 Ni 20 Co 20 alloy forms a single fcc solid solution which solidifies dendritically. A wide range of other six to nine component late transition metal rich multicomponent alloys exhibit the same majority fcc primary dendritic phase, which can dissolve substantial amounts of other transition metals such as Nb, Ti and V. More electronegative elements such as Cu and Ge are less stable in the fcc dendrites and are rejected into the interdendritic regions. The total number of phases is always well below the maximum equilibrium number allowed by the Gibbs phase rule, and even further below the maximum number allowed under non-equilibrium solidification conditions. Glassy structures are not formed by casting or melt spinning of late transition metal rich multicomponent alloys, indicating that the confusion principle does not apply, and other factors are more important in promoting glass formation

41 CFR 102-192.10 - What authority governs this part?

Science.gov (United States)

2010-07-01

... MANAGEMENT Introduction to this Part § 102-192.10 What authority governs this part? This part is governed by... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What authority governs this part? 102-192.10 Section 102-192.10 Public Contracts and Property Management Federal Property...

In vitro corrosion and biocompatibility of binary magnesium alloys.

Science.gov (United States)

Gu, Xuenan; Zheng, Yufeng; Cheng, Yan; Zhong, Shengping; Xi, Tingfei

2009-02-01

As bioabsorbable materials, magnesium alloys are expected to be totally degraded in the body and their biocorrosion products not deleterious to the surrounding tissues. It's critical that the alloying elements are carefully selected in consideration of their cytotoxicity and hemocompatibility. In the present study, nine alloying elements Al, Ag, In, Mn, Si, Sn, Y, Zn and Zr were added into magnesium individually to fabricate binary Mg-1X (wt.%) alloys. Pure magnesium was used as control. Their mechanical properties, corrosion properties and in vitro biocompatibilities (cytotoxicity and hemocompatibility) were evaluated by SEM, XRD, tensile test, immersion test, electrochemical corrosion test, cell culture and platelet adhesion test. The results showed that the addition of alloying elements could influence the strength and corrosion resistance of Mg. The cytotoxicity tests indicated that Mg-1Al, Mg-1Sn and Mg-1Zn alloy extracts showed no significant reduced cell viability to fibroblasts (L-929 and NIH3T3) and osteoblasts (MC3T3-E1); Mg-1Al and Mg-1Zn alloy extracts indicated no negative effect on viabilities of blood vessel related cells, ECV304 and VSMC. It was found that hemolysis and the amount of adhered platelets decreased after alloying for all Mg-1X alloys as compared to the pure magnesium control. The relationship between the corrosion products and the in vitro biocompatibility had been discussed and the suitable alloying elements for the biomedical applications associated with bone and blood vessel had been proposed.

Evolution of Nickel-titanium Alloys in Endodontics.

Science.gov (United States)

Ounsi, Hani F; Nassif, Wadih; Grandini, Simone; Salameh, Ziad; Neelakantan, Prasanna; Anil, Sukumaran

2017-11-01

To improve clinical use of nickel-titanium (NiTi) endodontic rotary instruments by better understanding the alloys that compose them. A large number of engine-driven NiTi shaping instruments already exists on the market and newer generations are being introduced regularly. While emphasis is being put on design and technique, manufacturers are more discreet about alloy characteristics that dictate instrument behavior. Along with design and technique, alloy characteristics of endodontic instruments is one of the main variables affecting clinical performance. Modification in NiTi alloys is numerous and may yield improvements, but also drawbacks. Martensitic instruments seem to display better cyclic fatigue properties at the expense of surface hardness, prompting the need for surface treatments. On the contrary, such surface treatments may improve cutting efficiency but are detrimental to the gain in cyclic fatigue resistance. Although the design of the instrument is vital, it should in no way cloud the importance of the properties of the alloy and how they influence the clinical behavior of NiTi instruments. Dentists are mostly clinicians rather than engineers. With the advances in instrumentation design and alloys, they have an obligation to deal more intimately with engineering consideration to not only take advantage of their possibilities but also acknowledge their limitations.

Change in mechanical properties of low-alloyed molybdenum alloys at two-stage strengthening during aging

International Nuclear Information System (INIS)

Bernshtejn, L.M.; Zakharov, A.M.; Arbuzov, V.K.

1977-01-01

Change in mechanical properties of hardened low-alloyed molybdenum alloys (Mo-Zr-C and Mo-Zr-Nb-C) at two-stage strengthening during ageing at 1400 deg C is studied. The initial strengthening maximum following ageing for 5 hr is caused by separation of dispersed ZrC particles and is accompanied by worsened plasticity, a development characteristic of precipitation hardening processes. The second increase in strength after a 10-hr ageing is not accompanied by reduced plasticity, this being characteristic of strengthening as a result of reconstruction of the dislocation structure. Niobium (0.16 wt.%) added to Mo-Zr-C alloys simultaneously increases their plastic and strength properties. The said effect is caused by prevention of premature decomposition of alloys on account of increased low-temperature plasticity, which permits to obtain high resistance to plastic deformation

Effect of Silicon in U-10Mo Alloy

Energy Technology Data Exchange (ETDEWEB)

Kautz, Elizabeth J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Devaraj, Arun [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kovarik, Libor [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lavender, Curt A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Joshi, Vineet V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2017-08-31

This document details a method for evaluating the effect of silicon impurity content on U-10Mo alloys. Silicon concentration in U-10Mo alloys has been shown to impact the following: volume fraction of precipitate phases, effective density of the final alloy, and 235-U enrichment in the gamma-UMo matrix. This report presents a model for calculating these quantities as a function of Silicon concentration, which along with fuel foil characterization data, will serve as a reference for quality control of the U-10Mo final alloy Si content. Additionally, detailed characterization using scanning electron microscope imaging, transmission electron microscope diffraction, and atom probe tomography showed that Silicon impurities present in U-10Mo alloys form a Si-rich precipitate phase.

41 CFR 102-36.45 - What are our responsibilities in the management of excess personal property?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are our responsibilities in the management of excess personal property? 102-36.45 Section 102-36.45 Public Contracts and... § 102-36.45 What are our responsibilities in the management of excess personal property? (a) Agency...

The use of hardfacing alloys in nuclear power plants

International Nuclear Information System (INIS)

Saarinen, K.; Aaltonen, P.

1987-08-01

In this report the structure and applications of cobalt-, nickel- and iron-based hardfacing alloys are reviewed. Cobalt-based hardfacing alloys are widely used in nuclear power plant components due to their good wear and corrosion resistance. However, the wear and corrosion products of the cobalt-containing alloys are released into the primary cooling water and transported to the reactor core where cobalt (Co-59) is transmuted to the radioactive isotope Co-60. It has been estimated that cobalt-based hardfacing alloys are responsible for up to 90% of the total cobalt released to the primary water circuit. The cobalt based hardfacing alloys are used in such components as valves, control blade pins and pumps, etc. In the Finnish nuclear power plants they are not used in in-core components. The replacement of cobalt-containing alloys in primary cooling system components is studied in many laboratories, but substitutes for the cobalt-based alloys in the complete range of nuclear hardfacing applications have so far not been found. However, the modified austenitic stainless steels have showed good resistance to galling wear and are therefore considered substitutes for cobalt-based alloys

Superconductivity in zirconium-rhodium alloys

Science.gov (United States)

Zegler, S. T.

1969-01-01

Metallographic studies and transition temperature measurements were made with isothermally annealed and water-quenched zirconium-rhodium alloys. The results clarify both the solid-state phase relations at the Zr-rich end of the Zr-Rh alloy system and the influence upon the superconducting transition temperature of structure and composition.

Studies on the growth of oxide films on alloy 800 and alloy 600 in lithiated water at high temperature

International Nuclear Information System (INIS)

Olmedo, A.M.; Bordon, R.

2007-01-01

In this work, the oxide films grown on Alloy 800 and Alloy 600 in lithiated (pH 25 C d egrees = 10.2-10.4) water at high temperature, with and without hydrogen overpressure (HO) and an initial oxygen dissolved in the water have been studied. The oxide films were grown at different temperatures (220-350 C degrees) and exposure times with HO, and at 315 C degrees without HO in static autoclaves. Some results are also reported for oxide layers grown on Alloy 800 coupons exposed in a high temperature loop during extended exposure times. The average oxide thickness was determined using descaling procedures. The morphology and composition of the oxide films were analyzed with scanning electron microscopy (SEM), EDS and X-ray diffraction (XRD). For both Alloys, at 350 C degrees with HO, the oxide layers were clearly composed of a double layer: an inner one of very small crystallites and an outer layer formed by bigger crystals scattered over the inner one. The analysis by X-ray diffraction indicated the presence of spinel structures like magnetite (Fe 3 O 4 ) and ferrites and/or nickel chromites. In this case the average oxide thickness was around 0.12 to 0.15 μm for both Alloys. Similar values were found at lower temperatures. The morphology of the oxide layer was similar at lower temperatures for Alloy 800, but a different morphology consisting of platelets or needles was found for Alloy 600. The oxide morphology found at 315 C degrees, without HO and with initial dissolved oxygen in the water, was also very different between both Alloys. The oxide film grown on Alloy 600 with an initial dissolved oxygen in the water, showed clusters of platelets forming structures like flowers that were dispersed on an rather homogeneous layer consisting of smaller platelets or needles. The average oxide film grown in this case was around 0.25 μm for Alloy 600 and 0.18 μm for Alloy 800. (author) [es

Phases in lanthanum-nickel-aluminum alloys

International Nuclear Information System (INIS)

Mosley, W.C.

1992-01-01

Lanthanum-nickel-aluminum (LANA) alloys will be used to pump, store and separate hydrogen isotopes in the Replacement Tritium Facility (RTF). The aluminum content (y) of the primary LaNi 5 -phase is controlled to produce the desired pressure-temperature behavior for adsorption and desorption of hydrogen. However, secondary phases cause decreased capacity and some may cause undesirable retention of tritium. Twenty-three alloys purchased from Ergenics, Inc. for development of RTF processes have been characterized by scanning electron microscopy (SEM) and by electron microprobe analysis (EMPA) to determine the distributions and compositions of constituent phases. This memorandum reports the results of these characterization studies. Knowledge of the structural characteristics of these alloys is a useful first step in selecting materials for specific process development tests and in interpreting results of those tests. Once this information is coupled with data on hydrogen plateau pressures, retention and capacity, secondary phase limits for RTF alloys can be specified

7 CFR 330.102 - Basis for certain regulations.

Science.gov (United States)

2010-01-01

... of the Plant Protection Act, the Secretary may prohibit or restrict the importation, entry... 7 Agriculture 5 2010-01-01 2010-01-01 false Basis for certain regulations. 330.102 Section 330.102 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION...

41 CFR 102-33.65 - What is the process for acquiring Government aircraft?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the process for acquiring Government aircraft? 102-33.65 Section 102-33.65 Public Contracts and Property Management Federal... process; planning, budgeting, and contracting, as described in §§ 102-33.70 through 102-33.105. Planning...

Irradiation assisted stress corrosion cracking of HTH Alloy X-750 and Alloy 625

International Nuclear Information System (INIS)

Mills, W.J.; Lebo, M.R.; Bajaj, R.; Kearns, J.J.; Hoffman, R.C.; Korinko, J.J.

1994-01-01

In-reactor testing of bolt-loaded precracked compact tension specimens was performed in 360 degree C water to determine effect of irradiation on the SCC behavior of HTH Alloy X-750 and direct aged Alloy 625. Out-of-flux and autoclave control specimens provided baseline data. Primary test variables were stress intensity factor, fluence, chemistry, processing history, prestrain. Results for the first series of experiments were presented at a previous conference. Data from two more recent experiments are compared with previous results; they confirm that high irradiation levels significantly reduce SCC resistance in HTH Alloy X-750. Heat-to-heat differences in IASCC were related to differences in boron content, with low boron heats showing improved SCC resistance. The in-reactor SCC performance of Alloy 625 was superior to that for Alloy X-750, as no cracking was observed in any Alloy 625 specimens even though they were tested at very high K 1 and fluence levels. A preliminary SCC usage model developed for Alloy X-750 indicates that in-reactor creep processes, which relax stresses but also increase crack tip strain rates, and radiolysis effects accelerate SCC. Hence, in-reactor SCC damage under high flux conditions may be more severe than that associated with postirradiation tests. In addition, preliminary mechanism studies were performed to determine the cause of IASCC In Alloy X-750

41 CFR 102-117.110 - What is satisfactory service?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...

Effect of structure and alloying elements on void formation in austenitic steels and nickel alloys

International Nuclear Information System (INIS)

Levy, V.; Azam, N.; Le Naour, L.; Didout, G.; Delaplace, J.

1977-01-01

In the development of the fast breeder reactors the phenomenon of metal swelling due to the formation of radiation induced voids is a large problem. In the complex alloys small fluctuations in composition can have a considerable effect on swelling and a great deal of investigation on the effect of both major and minor alloying elements is needed to be able to predict swelling. To provide more insight a research program involving irradiation of both commercial or specially cast alloys by 500 keV Ni + ions or 1 MeV electrons has been developed. The major results are presented

Formation and characterization of Al–Ti–Nb alloys by electron-beam surface alloying

Energy Technology Data Exchange (ETDEWEB)

Valkov, S., E-mail: stsvalkov@gmail.com [Institute of Electronics, Bulgarian Academy of Science, 72 Tzarigradsko Chaussee blvd., 1784 Sofia (Bulgaria); Petrov, P. [Institute of Electronics, Bulgarian Academy of Science, 72 Tzarigradsko Chaussee blvd., 1784 Sofia (Bulgaria); Lazarova, R. [Institute of Metal Science, Equipment and Technologies with Hydro and Aerodynamics Center, Bulgarian Academy of Science, 67 Shipchenski Prohod blvd., 1574 Sofia (Bulgaria); Bezdushnyi, R. [Department of Solid State Physics and Microelectronics, Faculty of Physics, Sofia University “St. Kliment Ohridsky”, 1164 Sofia (Bulgaria); Dechev, D. [Institute of Electronics, Bulgarian Academy of Science, 72 Tzarigradsko Chaussee blvd., 1784 Sofia (Bulgaria)

2016-12-15

Highlights: • Al–Ti–Nb surface alloys have been successfully obtained by electron-beam surface alloying technology. • The alloys consist of (Ti,Nb)Al{sub 3} fractions, distributed in the biphasic structure of (Ti,Nb)Al{sub 3} particles dispersed in α-Al. • The alloying speed does not affect the lattice parameters of (Ti,Nb)Al{sub 3} and, does not form additional stresses, strains etc. • It was found that lower velocity of the specimen motion during the alloying process develops more homogeneous structures. • The measured hardness of (Ti,Nb)Al{sub 3} compound reaches 775 HV[kg/cm{sup 2}] which is much greater than the values of NbAl{sub 3}. - Abstract: The combination of attractive mechanical properties, light weight and resistance to corrosion makes Ti-Al based alloys applicable in many industrial branches, like aircraft and automotive industries etc. It is known that the incorporation of Nb improves the high temperature performance and mechanical properties. In the present study on Al substrate Ti and Nb layers were deposited by DC (Direct Current) magnetron sputtering, followed by electron-beam alloying with scanning electron beam. It was chosen two speeds of the specimen motion during the alloying process: V{sub 1} = 0.5 cm/s and V{sub 2} = 1 cm/s. The alloying process was realized in circular sweep mode in order to maintain the melt pool further. The obtained results demonstrate a formation of (Ti,Nb)Al{sub 3} fractions randomly distributed in biphasic structure of intermetallic (Ti,Nb)Al{sub 3} particles, dispersed in α-Al solid solution. The evaluated (Ti,Nb)Al{sub 3} lattice parameters are independent of the speed of the specimen motion and therefore the alloying speed does not affect the lattice parameters and thus, does not form additional residual stresses, strains etc. It was found that lower velocity of the specimen motion during the alloying process develops more homogeneous structures. The metallographic analyses demonstrate a

Effect of ternary alloying elements on the shape memory behavior of Ti-Ta alloys

International Nuclear Information System (INIS)

Buenconsejo, Pio John S.; Kim, Hee Young; Miyazaki, Shuichi

2009-01-01

The effect of ternary alloying elements (X = V, Cr, Fe, Zr, Hf, Mo, Sn, Al) on the shape memory behavior of Ti-30Ta-X alloys was investigated. All the alloying elements decreased the martensitic transformation temperatures. The decrease in the martensitic transformation start (M s ) temperature due to alloying was affected by the atomic size and number of valence electrons of the alloying element. A larger number of valence electrons and a smaller atomic radius of an alloying element decreased the M s more strongly. The effect of the alloying elements on suppressing the aging effect on the shape memory behavior was also investigated. It was found that the additions of Sn and Al to Ti-Ta were effective in suppressing the effect of aging on the shape memory behavior, since they strongly suppress the formation of ω phase during aging treatment. For this reason the Ti-30Ta-1Al and Ti-30Ta-1Sn alloys exhibited a stable high-temperature shape memory effect during thermal cycling.

32 CFR 644.102 - Examples of involuntary acquisitions.

Science.gov (United States)

2010-07-01

... 32 National Defense 4 2010-07-01 2010-07-01 true Examples of involuntary acquisitions. 644.102... PROPERTY REAL ESTATE HANDBOOK Acquisition Involuntary Acquisition by the United States § 644.102 Examples... property, as prescribed by Pub. L. 91-646. Examples of involuntary acquisition are: (a) Damage to real...

45 CFR 96.102 - Carryover of unobligated funds.

Science.gov (United States)

2010-10-01

... reason or if the State has determined that program objectives would be better served by deferring... 45 Public Welfare 1 2010-10-01 2010-10-01 false Carryover of unobligated funds. 96.102 Section 96.102 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Primary...

High-Strength Low-Alloy (HSLA) Mg-Zn-Ca Alloys with Excellent Biodegradation Performance

Science.gov (United States)

Hofstetter, J.; Becker, M.; Martinelli, E.; Weinberg, A. M.; Mingler, B.; Kilian, H.; Pogatscher, S.; Uggowitzer, P. J.; Löffler, J. F.

2014-04-01

This article deals with the development of fine-grained high-strength low-alloy (HSLA) magnesium alloys intended for use as biodegradable implant material. The alloys contain solely low amounts of Zn and Ca as alloying elements. We illustrate the development path starting from the high-Zn-containing ZX50 (MgZn5Ca0.25) alloy with conventional purity, to an ultrahigh-purity ZX50 modification, and further to the ultrahigh-purity Zn-lean alloy ZX10 (MgZn1Ca0.3). It is shown that alloys with high Zn-content are prone to biocorrosion in various environments, most probably because of the presence of the intermetallic phase Mg6Zn3Ca2. A reduction of the Zn content results in (Mg,Zn)2Ca phase formation. This phase is less noble than the Mg-matrix and therefore, in contrast to Mg6Zn3Ca2, does not act as cathodic site. A fine-grained microstructure is achieved by the controlled formation of fine and homogeneously distributed (Mg,Zn)2Ca precipitates, which influence dynamic recrystallization and grain growth during hot forming. Such design scheme is comparable to that of HSLA steels, where low amounts of alloying elements are intended to produce a very fine dispersion of particles to increase the material's strength by refining the grain size. Consequently our new, ultrapure ZX10 alloy exhibits high strength (yield strength R p = 240 MPa, ultimate tensile strength R m = 255 MPa) and simultaneously high ductility (elongation to fracture A = 27%), as well as low mechanical anisotropy. Because of the anodic nature of the (Mg,Zn)2Ca particles used in the HSLA concept, the in vivo degradation in a rat femur implantation study is very slow and homogeneous without clinically observable hydrogen evolution, making the ZX10 alloy a promising material for biodegradable implants.

Damage buildup and edge dislocation mobility in equiatomic multicomponent alloys

Energy Technology Data Exchange (ETDEWEB)

Granberg, F., E-mail: fredric.granberg@helsinki.fi [Department of Physics, P.O. Box 43, FIN-00014 University of Helsinki (Finland); Djurabekova, F. [Department of Physics, P.O. Box 43, FIN-00014 University of Helsinki (Finland); Helsinki Institute of Physics, P.O. Box 43, FIN-00014 University of Helsinki (Finland); Levo, E.; Nordlund, K. [Department of Physics, P.O. Box 43, FIN-00014 University of Helsinki (Finland)

2017-02-15

Highlights: • We studied the damage buildup in equiatomic multicomponent alloys by MD simulations. • Edge dislocation mobility was lower in the studied alloys compared to elemental Ni. • Damage buildup in alloys saturated at lower levels than in elemental Ni. • Initial damage buildup is faster in alloys compared to elemental Ni. - Abstract: A new class of single phase metal alloys of equal atomic concentrations has shown very promising mechanical properties and good corrosion resistance. Moreover, a significant reduction in damage accumulation during prolonged irradiation has also been observed in these equiatomic multicomponent alloys. A comparison of elemental Ni with the two component NiFe- and the three component NiCoCr-alloy showed a substantial reduction in damage in both alloys, and an even larger difference was seen if only larger clusters were considered. One of the factors limiting the damage build-up in the alloys compared to the elemental material was seen to be dislocation mobility (Granberg et al., 2016). In this Article, we focus on a more thorough investigation of the mobility of edge dislocations in different cases of the Ni-, NiFe- and NiCoCr-samples. We find that even though the saturated amount of defects in the alloys is lower than in elemental Ni, the defect buildup in the early stages is faster in the alloys. We also find that the dislocation mobility in NiFe is lower than in Ni, at low stresses, and that the onset stress in NiFe is higher than in Ni. The same phenomenon was seen in comparison between NiFe and NiCoCr, since the three component alloy had lower dislocation mobility and higher onset stress. The dislocation velocity in elemental Ni plateaued out just under the forbidden velocity, whereas the alloys showed a more complex behaviour.

Improving High-Temperature Tensile and Low-Cycle Fatigue Behavior of Al-Si-Cu-Mg Alloys Through Micro-additions of Ti, V, and Zr

Science.gov (United States)

Shaha, S. K.; Czerwinski, F.; Kasprzak, W.; Friedman, J.; Chen, D. L.

2015-07-01

High-temperature tensile and low-cycle fatigue tests were performed to assess the influence of micro-additions of Ti, V, and Zr on the improvement of the Al-7Si-1Cu-0.5Mg (wt pct) alloy in the as-cast condition. Addition of transition metals led to modification of microstructure where in addition to conventional phases present in the Al-7Si-1Cu-0.5Mg base, new thermally stable micro-sized Zr-Ti-V-rich phases Al21.4Si4.1Ti3.5VZr3.9, Al6.7Si1.2TiZr1.8, Al2.8Si3.8V1.6Zr, and Al5.1Si35.4Ti1.6Zr5.7Fe were formed. The tensile tests showed that with increasing test temperature from 298 K to 673 K (25 °C to 400 °C), the yield stress and tensile strength of the present studied alloy decreased from 161 to 84 MPa and from 261 to 102 MPa, respectively. Also, the studied alloy exhibited 18, 12, and 5 pct higher tensile strength than the alloy A356, 354 and existing Al-Si-Cu-Mg alloy modified with additions of Zr, Ti, and Ni, respectively. The fatigue life of the studied alloy was substantially longer than those of the reference alloys A356 and the same Al-7Si-1Cu-0.5Mg base with minor additions of V, Zr, and Ti in the T6 condition. Fractographic analysis after tensile tests revealed that at the lower temperature up to 473 K (200 °C), the cleavage-type brittle fracture for the precipitates and ductile fracture for the matrix were dominant while at higher temperature fully ductile-type fracture with debonding and pull-out of cracked particles was identified. It is believed that the intermetallic precipitates containing Zr, Ti, and V improve the alloy performance at increased temperatures.

Ultrahigh temperature intermetallic alloys

Energy Technology Data Exchange (ETDEWEB)

Brady, M.P.; Zhu, J.H.; Liu, C.T.; Tortorelli, P.F.; Wright, J.L.; Carmichael, C.A.; Walker, L.R. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.

1997-12-01

A new family of Cr-Cr{sub 2}X based alloys with fabricability, mechanical properties, and oxidation resistance superior to previously developed Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys has been identified. The new alloys can be arc-melted/cast without cracking, and exhibit excellent room temperature and high-temperature tensile strengths. Preliminary evaluation of oxidation behavior at 1100 C in air indicates that the new Cr-Cr{sub 2}X based alloys form an adherent chromia-based scale. Under similar conditions, Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys suffer from extensive scale spallation.

Phase distribution studies in metallic alloy SIMFUEL

International Nuclear Information System (INIS)

Kolay, S.; Basu, M.; Kaity, S.; Das, D.

2014-01-01

Utilization of U-Pu based alloy fuel in the three stage nuclear power generation program in India is one of the important mandate due to shorter doubling time for breeding of the fissile isotopes ( 239 Pu and 233 U) to be used in Th based driver fuel in the 3rd stage. Reported information shows successful performance of fuel with porous alloy matrix in achieving 10-15 atom % burn-up. The porosity and microstructure of this alloy are strongly dependent on the composition and phases of the fission products incorporated in the matrix. The porosity influences the extent of fuel swelling and fission gas release, which affects the performance and integrity of the fuel. This study addresses to these issues taking the base alloy U-10wt% Zr

In-Vitro Corrosion Studies of Bioabsorbable Alloys

Science.gov (United States)

Gill, P.; Munroe, N.

Magnesium alloys have inspired a significant amount of attention from researchers all over the world for cardiovascular and orthopedic applications due to their light weight, mechanical integrity and degradation behavior. In this investigation, cast manufactured binary, ternary and quaternary magnesium alloys were studied for their degradation behavior by potentiodynamic polarization tests in phosphate buffer saline solution (PBS) and PBS containing amino acids (cysteine, C and tryptophan, W) at 37 °C. Electrochemical impedance spectroscopy (EIS) tests were performed to determine the charge transfer resistance and immersion tests were performed to assess corrosion rate and hydrogen evolution from the alloys. Furthermore, the surface morphology and surface chemistry of the alloys were observed by scanning electron microscopy (SEM) and X-ray diffraction (XRD).

42 CFR 102.32 - Benefits for lost employment income.

Science.gov (United States)

2010-10-01

... 102.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... pay for lost employment income or to provide disability or retirement benefits to the requester. As provided in § 102.84, the Secretary retains the right to recover benefits for lost employment income paid...

INVESTIGATION OF MAGNESIUM ALLOYS MACHINABILITY

Directory of Open Access Journals (Sweden)

Berat Barıs BULDUM

2013-01-01

Full Text Available Magnesium is the lightest structural metal. Magnesium alloys have a hexagonal lattice structure, which affects the fundamental properties of these alloys. Plastic deformation of the hexagonal lattice is more complicated than in cubic latticed metals like aluminum, copper and steel. Magnesium alloy developments have traditionally been driven by industry requirements for lightweight materials to operate under increasingly demanding conditions. Magnesium alloys have always been attractive to designers due to their low density, only two thirds that of aluminium and its alloys [1]. The element and its alloys take a big part of modern industry needs. Especially nowadays magnesium alloys are used in automotive and mechanical (trains and wagons manufacture, because of its lightness and other features. Magnesium and magnesium alloys are the easiest of all metals to machine, allowing machining operations at extremely high speed. All standard machining operations such as turning, drilling, milling, are commonly performed on magnesium parts.

Role of alloying additions on the properties of Cu–Al–Mn shape memory alloys

Energy Technology Data Exchange (ETDEWEB)

Dasgupta, Rupa, E-mail: rupadasgupta@ampri.res.in; Jain, Ashish Kumar; Kumar, Pravir; Hussain, Shahadat; Pandey, Abhishek

2015-01-25

Highlights: • Cu based SMAs with high transition temperature could be made using LM route. • The properties depend on alloying composition. • Property characterisation establishes feasibility of making SMAs. - Abstract: The effect of alloying seven different elements [Zn, Si, Fe, Ni, Mg, Cr and Ti] on the microstructure, hardness, phase precipitation and transformation temperature in a Cu–12.5Al–5Mn alloy with a view to possible improvements as a result of these additions is the focus of the reported study. The base alloy has been chosen keeping in mind its ability to exhibit shape memory properties and improved ductility over other Cu-based SMAs. The objective was to ascertain changes or improvements attained due to the individual tertiary additions. The samples were prepared through liquid metallurgy route using pure copper, aluminum, manganese and the respective quaternary alloying elements in right quantities to weigh 1000 g of the alloy in total and were melted together. Samples from the cast alloys were subject to homogenisation treatment at 200 °C for 2 h in a muffle furnace and furnace cooled. Samples from the homogenised alloys were heated and held for 2 h at 920 °C followed by ice quenching to obtain the desired martensitic structure for shape memory behaviour. The alloys in the cast, homogenised and quenched conditions were metallographically polished to observe the martensitic phase formation mainly in quenched samples which is a pre requisite for exhibiting shape memory properties in these alloys. X-ray Diffraction studies were carried out on the cast and quenched samples using Cu Kα target; and the phases identified indicate martensitic phase precipitation; however in some cases the precipitation is incomplete. Differential Scanning Calorimetric [DSC] studies were carried out on quenched samples from room temperature to 600 °C maintaining a constant rate of 10 °C/min. Results indicate clear transformation peaks in all the samples which

Role of alloying additions on the properties of Cu–Al–Mn shape memory alloys

International Nuclear Information System (INIS)

Dasgupta, Rupa; Jain, Ashish Kumar; Kumar, Pravir; Hussain, Shahadat; Pandey, Abhishek

2015-01-01

Highlights: • Cu based SMAs with high transition temperature could be made using LM route. • The properties depend on alloying composition. • Property characterisation establishes feasibility of making SMAs. - Abstract: The effect of alloying seven different elements [Zn, Si, Fe, Ni, Mg, Cr and Ti] on the microstructure, hardness, phase precipitation and transformation temperature in a Cu–12.5Al–5Mn alloy with a view to possible improvements as a result of these additions is the focus of the reported study. The base alloy has been chosen keeping in mind its ability to exhibit shape memory properties and improved ductility over other Cu-based SMAs. The objective was to ascertain changes or improvements attained due to the individual tertiary additions. The samples were prepared through liquid metallurgy route using pure copper, aluminum, manganese and the respective quaternary alloying elements in right quantities to weigh 1000 g of the alloy in total and were melted together. Samples from the cast alloys were subject to homogenisation treatment at 200 °C for 2 h in a muffle furnace and furnace cooled. Samples from the homogenised alloys were heated and held for 2 h at 920 °C followed by ice quenching to obtain the desired martensitic structure for shape memory behaviour. The alloys in the cast, homogenised and quenched conditions were metallographically polished to observe the martensitic phase formation mainly in quenched samples which is a pre requisite for exhibiting shape memory properties in these alloys. X-ray Diffraction studies were carried out on the cast and quenched samples using Cu Kα target; and the phases identified indicate martensitic phase precipitation; however in some cases the precipitation is incomplete. Differential Scanning Calorimetric [DSC] studies were carried out on quenched samples from room temperature to 600 °C maintaining a constant rate of 10 °C/min. Results indicate clear transformation peaks in all the samples which

Improvement of magnetocaloric properties of Gd-Ge-Si alloys by alloying with iron

Directory of Open Access Journals (Sweden)

Erenc-Sędziak T.

2013-01-01

Full Text Available The influence of annealing of Gd5Ge2Si2Fex alloys at 1200°C and of alloying with various amount of iron on structure as well as thermal and magnetocaloric properties is investigated. It was found that annealing for 1 to 10 hours improves the entropy change, but reduces the temperature of maximum magnetocaloric effect by up to 50 K. Prolonged annealing of the Gd5Ge2Si2 alloy results in the decrease of entropy change due to the reduction of Gd5Ge2Si2 phase content. Addition of iron to the ternary alloy enhances the magnetocaloric effect, if x = 0.4 – 0.6, especially if alloying is combined with annealing at 1200°C: the peak value of the isothermal entropy change from 0 to 2 T increases from 3.5 to 11 J/kgK. Simultaneously, the temperature of maximum magnetocaloric effect drops to 250 K. The changes in magnetocaloric properties are related to the change in phase transformation from the second order for arc molten ternary alloy to first order in the case of annealed and/or alloyed with iron. The results of this study indicate that the minor addition of iron and heat treatment to Gd-Ge-Si alloys may be useful in improving the materials’ magnetocaloric properties..

WC-3015 alloy (high-temperature alloy)

International Nuclear Information System (INIS)

Anon.

1974-01-01

WC-3015 Nb alloy containing 28 to 30 Hf, 1 to 2 Zr, 13 to 16 W, 0 to 4 Ta, 0 to 5 Ti, 0.07 to 0.33 C, less than or equal to 0.02 N, less than or equal to 0.03 O, less than or equal to 0.001 H was developed for use at high temperature in oxidizing environments. Its composition can be tailored to meet specific requirements. When WC-3015 is exposed to O at elevated temperature, Hf and Nb oxidized preferentially and HfO 2 dissolves in Nb 2 O 5 to form 6HfO-Nb 2 O 5 . This complex oxide has a tight cubic lattice which resists the diffusion of O into the substrate. During 24-h exposure to air at 2400 0 F, the alloy oxidizes to a depth of approximately 0.035 in. with a surface recession of 0 to 0.004 in. Oxidation resistance of WC-3015 welds and base material can be further enhanced greatly by applying silicide coatings. WC-3015 alloy can be machined by conventional and electrical-discharge methods. It can be hot worked readily by extrusion, forging or rolling. Cold working can be used at room or elevated temperature. It can be welded by the electron-beam or Tig processes. Physical constants, typical mechanical properties at 75 to 2400 0 F, and effects of composition and heat treatment on tensile and stress-rupture properties of the alloy are tabulated

Hydrogen in titanium alloys

International Nuclear Information System (INIS)

Wille, G.W.; Davis, J.W.

1981-04-01

The titanium alloys that offer properties worthy of consideration for fusion reactors are Ti-6Al-4V, Ti-6Al-2Sn-4Zr-2Mo-Si (Ti-6242S) and Ti-5Al-6Sn-2Zr-1Mo-Si (Ti-5621S). The Ti-6242S and Ti-5621S are being considered because of their high creep resistance at elevated temperatures of 500 0 C. Also, irradiation tests on these alloys have shown irradiation creep properties comparable to 20% cold worked 316 stainless steel. These alloys would be susceptible to slow strain rate embrittlement if sufficient hydrogen concentrations are obtained. Concentrations greater than 250 to 500 wppm hydrogen and temperatures lower than 100 to 150 0 C are approximate threshold conditions for detrimental effects on tensile properties. Indications are that at the elevated temperature - low hydrogen pressure conditions of the reactors, there would be negligible hydrogen embrittlement

Combinatorial thin film materials science: From alloy discovery and optimization to alloy design

Energy Technology Data Exchange (ETDEWEB)

Gebhardt, Thomas, E-mail: gebhardt@mch.rwth-aachen.de; Music, Denis; Takahashi, Tetsuya; Schneider, Jochen M.

2012-06-30

This paper provides an overview of modern alloy development, from discovery and optimization towards alloy design, based on combinatorial thin film materials science. The combinatorial approach, combining combinatorial materials synthesis of thin film composition-spreads with high-throughput property characterization has proven to be a powerful tool to delineate composition-structure-property relationships, and hence to efficiently identify composition windows with enhanced properties. Furthermore, and most importantly for alloy design, theoretical models and hypotheses can be critically appraised. Examples for alloy discovery, optimization, and alloy design of functional as well as structural materials are presented. Using Fe-Mn based alloys as an example, we show that the combination of modern electronic-structure calculations with the highly efficient combinatorial thin film composition-spread method constitutes an effective tool for knowledge-based alloy design.

Combinatorial thin film materials science: From alloy discovery and optimization to alloy design

International Nuclear Information System (INIS)

Gebhardt, Thomas; Music, Denis; Takahashi, Tetsuya; Schneider, Jochen M.

2012-01-01

This paper provides an overview of modern alloy development, from discovery and optimization towards alloy design, based on combinatorial thin film materials science. The combinatorial approach, combining combinatorial materials synthesis of thin film composition-spreads with high-throughput property characterization has proven to be a powerful tool to delineate composition–structure–property relationships, and hence to efficiently identify composition windows with enhanced properties. Furthermore, and most importantly for alloy design, theoretical models and hypotheses can be critically appraised. Examples for alloy discovery, optimization, and alloy design of functional as well as structural materials are presented. Using Fe-Mn based alloys as an example, we show that the combination of modern electronic-structure calculations with the highly efficient combinatorial thin film composition-spread method constitutes an effective tool for knowledge-based alloy design.

Alloy Microstructure Dictates Corrosion Modes in THA Modular Junctions.

Science.gov (United States)

Pourzal, Robin; Hall, Deborah J; Ehrich, Jonas; McCarthy, Stephanie M; Mathew, Mathew T; Jacobs, Joshua J; Urban, Robert M

2017-12-01

Adverse local tissue reactions (ALTRs) triggered by corrosion products from modular taper junctions are a known cause of premature THA failure. CoCrMo devices are of particular concern because cobalt ions and chromium-orthophosphates were shown to be linked to ALTRs, even in metal-on-polyethylene THAs. The most common categories of CoCrMo alloy are cast and wrought alloy, which exhibit fundamental microstructural differences in terms of grain size and hard phases. The impact of implant alloy microstructure on the occurring modes of corrosion and subsequent metal ion release is not well understood. The purpose of this study was to determine whether (1) the microstructure of cast CoCrMo alloy varies broadly between manufacturers and can dictate specific corrosion modes; and whether (2) the microstructure of wrought CoCrMo alloy is more consistent between manufacturers and has low implications on the alloy's corrosion behavior. The alloy microstructure of four femoral-stem and three femoral-head designs from four manufacturers was metallographically and electrochemically characterized. Three stem designs were made from cast alloy; all three head designs and one stem design were made from wrought alloy. Alloy samples were sectioned from retrieved components and then polished and etched to visualize grain structure and hard phases such as carbides (eg, M 23 C 6 ) or intermetallic phases (eg, σ phase). Potentiodynamic polarization (PDP) tests were conducted to determine the corrosion potential (E corr ), corrosion current density (I corr ), and pitting potential (E pit ) for each alloy. Four devices were tested within each group, and each measurement was repeated three times to ensure repeatable results. Differences in PDP metrics between manufacturers and between alloys with different hard phase contents were compared using one-way analysis of variance and independent-sample t-tests. Microstructural features such as twin boundaries and slip bands as well as corrosion

Low in reactor creep Zr-base alloy tubes

International Nuclear Information System (INIS)

Cheadle, B.A.; Holt, R.A.

1984-01-01

This invention relates to zirconium alloy tubes especially for use in nuclear power reactors. More particularly it relates to quaternary 3.5 percent Sn, 1 percent Mo, 1 percent Nb, balance Zr alloy tubes which have been extruded, cold worked and heat treated to lower their dislocation density. In one embodiment the alloys are cold worked less than 5 percent and stress relieved to produce a low dislocation density and in another embodiment the alloys are cold worked up to about 50 percent and annealed to produce a very low dislocation density and also small equiaxed β grains

Advanced ordered intermetallic alloy deployment

Energy Technology Data Exchange (ETDEWEB)

Liu, C.T.; Maziasz, P.J.; Easton, D.S. [Oak Ridge National Lab., TN (United States)

1997-04-01

The need for high-strength, high-temperature, and light-weight materials for structural applications has generated a great deal of interest in ordered intermetallic alloys, particularly in {gamma}-based titanium aluminides {gamma}-based TiAl alloys offer an attractive mix of low density ({approximately}4g/cm{sup 3}), good creep resistance, and high-temperature strength and oxidation resistance. For rotating or high-speed components. TiAl also has a high damping coefficient which minimizes vibrations and noise. These alloys generally contain two phases. {alpha}{sub 2} (DO{sub 19} structure) and {gamma} (L 1{sub 0}), at temperatures below 1120{degrees}C, the euticoid temperature. The mechanical properties of TiAl-based alloys are sensitive to both alloy compositions and microstructure. Depending on heat-treatment and thermomechanical processing, microstructures with near equiaxed {gamma}, a duplex structure (a mix of the {gamma} and {alpha}{sub 2} phases) can be developed in TiAl alloys containing 45 to 50 at. % Al. The major concern for structural use of TiAl alloys is their low ductility and poor fracture resistance at ambient temperatures. The purpose of this project is to improve the fracture toughness of TiAl-based alloys by controlling alloy composition, microstructure and thermomechanical treatment. This work is expected to lead to the development of TiAl alloys with significantly improved fracture toughness and tensile ductility for structural use.

Stable carbides in transition metal alloys

International Nuclear Information System (INIS)

Piotrkowski, R.

1991-01-01

In the present work different techniques were employed for the identification of stable carbides in two sets of transition metal alloys of wide technological application: a set of three high alloy M2 type steels in which W and/or Mo were total or partially replaced by Nb, and a Zr-2.5 Nb alloy. The M2 steel is a high speed steel worldwide used and the Zr-2.5 Nb alloy is the base material for the pressure tubes in the CANDU type nuclear reactors. The stability of carbide was studied in the frame of Goldschmidt's theory of interstitial alloys. The identification of stable carbides in steels was performed by determining their metallic composition with an energy analyzer attached to the scanning electron microscope (SEM). By these means typical carbides of the M2 steel, MC and M 6 C, were found. Moreover, the spatial and size distribution of carbide particles were determined after different heat treatments, and both microstructure and microhardness were correlated with the appearance of the secondary hardening phenomenon. In the Zr-Nb alloy a study of the α and β phases present after different heat treatments was performed with optical and SEM metallographic techniques, with the guide of Abriata and Bolcich phase diagram. The α-β interphase boundaries were characterized as short circuits for diffusion with radiotracer techniques and applying Fisher-Bondy-Martin model. The precipitation of carbides was promoted by heat treatments that produced first the C diffusion into the samples at high temperatures (β phase), and then the precipitation of carbide particles at lower temperature (α phase or (α+β)) two phase field. The precipitated carbides were identified as (Zr, Nb)C 1-x with SEM, electron microprobe and X-ray diffraction techniques. (Author) [es

49 CFR 179.102 - Special commodity requirements for pressure tank car tanks.

Science.gov (United States)

2010-10-01

... car tanks. 179.102 Section 179.102 Transportation Other Regulations Relating to Transportation... REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.102 Special commodity requirements for pressure tank car tanks. (a) In addition to...

In-beam studies of {sup 98}Cd and {sup 102}Sn

Energy Technology Data Exchange (ETDEWEB)

Lipoglavsek, M. [Uppsala Univ. (Sweden)]|[J. Stefan Institute, Ljubljana (Slovenia); Gorska, M.; Schubart, R. [GSI, Darmstadt (Germany)] [and others

1996-12-31

For the first time excited states of the neutron deficient nuclei {sup 98}Cd and {sup 102}Sn were identified using in-beam spectroscopy following fusion evaporation reactions. Half lives of long lived isomeric states in both nuclei were also measured. Due to very low cross sections for producing {sup 98}Cd and {sup 102}Sn with stable beams and targets, a special detector setup utilizing NORDBALL ancillary detectors and a recoil catcher device was used. High {gamma}-ray detection efficiency was achieved with two EUROBALL Ge cluster detectors.

41 CFR 102-192.20 - How are “must” and “should” used in this part?

Science.gov (United States)

2010-07-01

... 192-MAIL MANAGEMENT Introduction to this Part § 102-192.20 How are “must” and “should” used in this... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How are âmustâ and âshouldâ used in this part? 102-192.20 Section 102-192.20 Public Contracts and Property Management Federal...

48 CFR 2852.102-270 - Incorporation in full text.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Incorporation in full text... 2852.102-270 Incorporation in full text. JAR provisions or clauses shall be incorporated in solicitations and contracts in full text. ...

Alloy Fabrication Laboratory

Data.gov (United States)

Federal Laboratory Consortium — At NETL’s Alloy Fabrication Facility in Albany, OR, researchers conduct DOE research projects to produce new alloys suited to a variety of applications, from gas...

Development of microstructure in thermomechanical processing of zirconium alloys

International Nuclear Information System (INIS)

Jha, S.K.; Saibaba, N.; Jayaraj, R.N.

2009-01-01

Zirconium based alloys are used for the manufacture of fuel tubes pressure tubes calandria tubes and other components of Pressurized Heavy Water Reactors (PHWRS). In single or two phase zirconium alloy system a variety of microstructure can be generated by suitable heat treatments by the process of equilibrium and non equilibrium phase transformations Microstructure can also be modified by alloying with α and β stabilizers. The microstructure in Zr alloys could be single hexagonal phase (α alloys) two phase bcc and hexagonal (α + β alloys) phase, single metastable martensitic microstructure and β with ω phase. The microstructural and micro textural evolution during thermo mechanical treatments depends strongly on such initial microstructure. Hot extrusion is a significant bulk deformation step which decides the initial microstructure of the alloy. It is carried out at elevated temperature i e above the recrystallization temperature, which enable imposition of large strains in single step. This deformation causes a significant change in the microstructure of the material and depends on extrusion process parameters such as temperature, strain rate (Ram speed), reduction ratio etc. In the present paper development of microstructures, microtexture and texture have been examined. An attempt is also made to optimise the hot working parameters for different Zirconium alloys with help of these studies. (author)

Synthesis of Amorphous Powders of Ni-Si and Co-Si Alloys by Mechanical Alloying

Science.gov (United States)

Omuro, Keisuke; Miura, Harumatsu

1991-05-01

Amorphous powders of the Ni-Si and Co-Si alloys are synthesized by mechanical alloying (MA) from crystalline elemental powders using a high energy ball mill. The alloying and amorphization process is examined by X-ray diffraction, differential scanning calorimetry (DSC), and scanning electron microscopy. For the Ni-Si alloy, it is confirmed that the crystallization temperature of the MA powder, measured by DSC, is in good agreement with that of the powder sample prepared by mechanical grinding from the cast alloy ingot products of the same composition.

7 CFR 61.102 - Determination of quantity index.

Science.gov (United States)

2010-01-01

... the quantity index shall equal four times percentage of oil plus six times percentage of ammonia, plus 5. (b) For American Pima cottonseed the quantity index shall equal four times percentage of oil... 7 Agriculture 3 2010-01-01 2010-01-01 false Determination of quantity index. 61.102 Section 61.102...

Microstructures and phase formation in rapidly solidified Sm-Fe alloys

International Nuclear Information System (INIS)

Shield, J.E.; Kappes, B.B.; Meacham, B.E.; Dennis, K.W.; Kramer, M.J.

2003-01-01

Sm-Fe-based alloys were produced by melt spinning with various melt spinning parameters and alloying additions. The structural and microstructural evolution varied and strongly depended on processing and alloy composition. The microstructural scale was found to vary from micron to nanometer scale depending on the solidification rate and alloying additions. Additions of Si, Ti, V, Zr and Nb with C were all found to refine the scale, and the degree of refinement was dependent on the atomic size of the alloying agent. The alloying was also found to affect the dynamical aspects of the melt spinning process, although in general the material is characterized by a poor melt stream and pool, which in part contributes to the microstructural variabilities. The alloying additions also suppressed the long-range ordering, leading to formation of the TbCu 7 -type structure. The ordering was recoverable upon heat treatment, although the presence of alloying agents suppressed the recovery process relative to the binary alloy. This was attributed to the presence of Ti (V, Nb, Zr) in solid solution, which limited the diffusion kinetics necessary for ordering. In the binary alloy, the ordering led to the development of antiphase domain structures, with the antiphase boundaries effectively pinning Bloch walls

Dendritic morphology observed in the solid-state precipitation in binary alloys

Energy Technology Data Exchange (ETDEWEB)

Husain, S.W.; Ahmed, M.S.; Qamar, I. [Dr. A.Q. Khan Research Labs., Rawalpindi (Pakistan)

1999-06-01

The precipitation of {gamma}{sub 2} phase in Cu-Al {beta}-phase alloys has been observed to occur in the dendritic morphology. Such morphology is rarely observed in the solid-state transformations. Earlier it was reported that the {gamma} precipitates were formed in the dendritic shape when Cu-Zn {beta}-phase alloys were cooled from high temperature. The characteristics of these two alloy systems have been examined to find the factors promoting the dendritic morphology in the solid-state transformations. Rapid bulk diffusion and fast interfacial reaction kinetics would promote such morphology. The kinetics of atom attachment to the growing interface is expected to be fast when crystallographic similarities exist between the parent phase and the precipitate. The authors have predicted the dendritic morphology in the solid-state precipitation in many binary alloy systems simply based on such crystallographic similarities. These alloys include, in addition to Cu-Al and Cu-Zn, the {beta}-phase alloys in Ag-Li, Ag-Zn, Cu-Ga, Au-Zn, and Ni-Zn systems, {gamma}-phase alloys in Cu-Sn and Ag-Cd systems, and {delta}-phase alloys in Au-Cd system. Of these, the alloys in Ag-Zn, Ni-Zn, Ag-Cd, and Cu-Sn systems were prepared and it was indeed found that the precipitates formed in the dendritic shape.

Determination of tungsten in high-alloy steels and heat resisting alloys by isotope dilution-spark source mass spectrometry

International Nuclear Information System (INIS)

Saito, Morimasa; Yamada, Kei; Okochi, Haruno; Hirose, Fumio

1983-01-01

Tungsten in high-alloy steels and heat-resisting alloys was determined by isotope dilution method combined with spark source mass spectrometry by using 183 W enriched tungsten. The spike solution was prepared by fusing tungsten trioxide in sodium carbonate. A high-alloy steel sample was dissolved in the mixture of sulfuric acid and phosphoric acid together with the spike solution; a sample of heat resisting alloy was similarly dissolved in the mixture of hydrochloric acid, nitric acid, sulfuric acid, and phosphoric acid. The solution was evaporated to give dense white fumes. Tungsten was separated from the residue by a conventional cinchonine salt-precipitation method. The salt was ignited, and the residue was mixed with graphite powder and pressed into electrodes. The isotope 183 W and 184 W were measured. The method was applied to the determination of tungsten in JSS and NBS standard high-alloy steels and JAERI standard nickel- and NBS standard cobalt-base heat resisting alloys containing more than 0.05% tungsten. The results were obtained with satisfactory precision and accuracy. However, the results obtained for JSS standard high- speed steels containing molybdenum tended to be significantly lower than the certified values. (author)

Influence of Iron in AlSi10MgMn Alloy

Directory of Open Access Journals (Sweden)

Žihalová M.

2014-12-01

Full Text Available Presence of iron in Al-Si cast alloys is common problem mainly in secondary (recycled aluminium alloys. Better understanding of iron influence in this kind of alloys can lead to reduction of final castings cost. Presented article deals with examination of detrimental iron effect in AlSi10MgMn cast alloy. Microstructural analysis and ultimate tensile strength testing were used to consider influence of iron to microstructure and mechanical properties of selected alloy.

Fracture of Shape Memory Alloys

OpenAIRE

Miyazaki, Shuichi; Otsuka, Kazuhiro

1981-01-01

The initiation and the propagation of cracks during both quenching and deformation in polycrystalline Cu-Al-Ni alloys have been investigated under various conditions. The fracture surfaces of Ti-Ni and Cu-Al-Ni alloys were also observed by a scanning electron microscope. From these results, it was concluded that the brittleness of Cu-Al-Ni alloy and other β phase alloys are due to large elastic anisotropy and large grain sizes, while that the large ductility in Ti-Ni alloy being due to the sm...

Low-spin electromagnetic transition probabilities in {sup 102,104}Cd

Energy Technology Data Exchange (ETDEWEB)

Jolie, J.; Dewald, A.; Fransen, C.; Linnemann, A.; Melon, B.; Moeller, O. [Inst. fuer Kernphysik, Univ. zu Koeln (Germany); Boelaert, N. [Inst. fuer Kernphysik, Univ. zu Koeln (Germany); Dept. of Subatomic and Radiation Physics, Gent Univ. (Belgium); Smirnova, N.; Heyde, K. [Dept. of Subatomic and Radiation Physics, Gent Univ. (Belgium)

2007-07-01

Lifetimes of low-lying states in {sup 102,104}Cd were determined by using the recoil distance Doppler shift technique with a plunger device and a Ge array consisting of five HP Ge detectors and one Euroball cluster detector. The experiments were carried out at the Cologne FN Tandem accelerator using the {sup 92,94}Mo({sup 12}C,2n){sup 102,104}Cd reactions. The differential decay curve method in coincidence mode was employed to derive the lifetime of the first excited 2{sup +} state in both nuclei and the first excited 4{sup +} state in {sup 104}Cd. The corresponding E2 transition probabilities agree well with large scale shell-model calculations. (orig.)

ZIRCONIUM-TITANIUM-BERYLLIUM BRAZING ALLOY

Science.gov (United States)

Gilliland, R.G.; Patriarca, P.; Slaughter, G.M.; Williams, L.C.

1962-06-12

A new and improved ternary alloy is described which is of particular utility in braze-bonding parts made of a refractory metal selected from Group IV, V, and VI of the periodic table and alloys containing said metal as a predominating alloying ingredient. The brazing alloy contains, by weight, 40 to 50 per cent zirconium, 40 to 50 per cent titanium, and the balance beryllium in amounts ranging from 1 to 20 per cent, said alloy having a melting point in the range 950 to 1400 deg C. (AEC)

De-alloyed platinum nanoparticles

Science.gov (United States)

Strasser, Peter [Houston, TX; Koh, Shirlaine [Houston, TX; Mani, Prasanna [Houston, TX; Ratndeep, Srivastava [Houston, TX

2011-08-09

A method of producing de-alloyed nanoparticles. In an embodiment, the method comprises admixing metal precursors, freeze-drying, annealing, and de-alloying the nanoparticles in situ. Further, in an embodiment de-alloyed nanoparticle formed by the method, wherein the nanoparticle further comprises a core-shell arrangement. The nanoparticle is suitable for electrocatalytic processes and devices.

9 CFR 93.102 - Ports designated for the importation of birds.

Science.gov (United States)

2010-01-01

... of birds. 93.102 Section 93.102 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Birds § 93.102 Ports designated for...

41 CFR Appendix A to Part 102 - 37-Miscellaneous Donation Statutes

Science.gov (United States)

2010-07-01

... Donation Statutes A Appendix A to Part 102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Pt. 102-37, App. A Appendix A to Part 102-37—Miscellaneous Donation Statutes The...

Studies on neutron irradiation effects of iron alloys and nickel-base heat resistant alloys

International Nuclear Information System (INIS)

Watanabe, Katsutoshi

1987-09-01

The present paper describes the results of neutron irradiation effects on iron alloys and nickel-base heat resistant alloys. As for the iron alloys, irradiation hardening and embrittlement were investigated using internal friction measurement, electron microscopy and tensile testings. The role of alloying elements was also investigated to understand the irradiation behavior of iron alloys. The essential factors affecting irradiation hardening and embrittlement were thus clarified. On the other hand, postirradiation tensile and creep properties were measured of Hastelloy X alloy. Irradiation behavior at elevated temperatures is discussed. (author)

Grain refinement of an AZ63B magnesium alloy by an Al-1C master alloy

Energy Technology Data Exchange (ETDEWEB)

Yichuan Pan; Xiangfa Liu; Hua Yang [The Key Lab. of Liquid Structure and Heredity of Materials, Shandong Univ., Jinan (China)

2005-12-01

In order to develop a refiner of Mg-Al alloys, an Al-1C (in wt.%) master alloy was synthesized using a casting method. The microstructure and grain-refining performance of the Al-1C master alloy were investigated using X-ray diffraction (XRD), electron probe microanalysis (EPMA) and a grain-refining test. The microstructure of the Al-1C master alloy is composed of {alpha}-Al solid solution, Al{sub 4}C{sub 3} particles, and graphite phases. After grain refinement of AZ63B alloy by the Al-1C master alloy, the mean grain size reached a limit when 2 wt.% Al-C master alloy was added at 800 C and held for 20 min in the melt before casting. The minimum mean grain size is approximately 48 {mu}m at the one-half radius of the ingot and is about 17% of that of the unrefined alloy. The Al-1C master alloy results in better grain refinement than C{sub 2}Cl{sub 6} and MgCO{sub 3} carbon-containing refiners. (orig.)

Corrosion-electrochemical and mechanical properties of aluminium-berylium alloys alloyed by rare-earth metals

International Nuclear Information System (INIS)

Safarov, A.M.; Odinaev, Kh.E.; Shukroev, M.Sh.; Saidov, R.Kh.

1997-01-01

In order to study influence of rare earth metals on corrosion-electrochemical and mechanical properties of aluminium-berylium alloys the alloys contain 1 mass % beryllium and different amount of rare earth metals were obtained.-electrochemical and mechanical properties of aluminium-berylium alloys. The electrochemical characteristics of obtained alloys, including stationary potential, potentials of passivation beginning and full passivation, potentials of pitting formation and re passivation were defined.

Non-equiatomic high entropy alloys: Approach towards rapid alloy screening and property-oriented design

Energy Technology Data Exchange (ETDEWEB)

Pradeep, K.G. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Materials Chemistry, RWTH Aachen University, Kopernikusstr.10, 52074 Aachen (Germany); Tasan, C.C., E-mail: c.tasan@mpie.de [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Yao, M.J. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Deng, Y. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Department of Engineering Design and Materials, Norwegian University of Science and Technology, No-7491 Trondheim (Norway); Springer, H. [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany); Raabe, D., E-mail: d.raabe@mpie.de [Max-Planck-Institut für Eisenforschung GmbH, Max-Planck-str.1, 40237 Düsseldorf (Germany)

2015-11-11

The high entropy alloy (HEA) concept has triggered a renewed interest in alloy design, even though some aspects of the underlying thermodynamic concepts are still under debate. This study addresses the short-comings of this alloy design strategy with the aim to open up new directions of HEA research targeting specifically non-equiatomic yet massively alloyed compositions. We propose that a wide range of massive single phase solid solutions could be designed by including non-equiatomic variants. It is demonstrated by introducing a set of novel non-equiatomic multi-component CoCrFeMnNi alloys produced by metallurgical rapid alloy prototyping. Despite the reduced configurational entropy, detailed characterization of these materials reveals a strong resemblance to the well-studied equiatomic single phase HEA: The microstructure of these novel alloys exhibits a random distribution of alloying elements (confirmed by Energy-Dispersive Spectroscopy and Atom Probe Tomography) in a single face-centered-cubic phase (confirmed by X-ray Diffraction and Electron Backscatter Diffraction), which deforms through planar slip (confirmed by Electron-Channeling Contrast Imaging) and leads to excellent ductility (confirmed by uniaxial tensile tests). This approach widens the field of HEAs to non-equiatomic multi-component alloys since the concept enables to tailor the stacking fault energy and associated transformation phenomena which act as main mechanisms to design useful strain hardening behavior.

Non-equiatomic high entropy alloys: Approach towards rapid alloy screening and property-oriented design

International Nuclear Information System (INIS)

Pradeep, K.G.; Tasan, C.C.; Yao, M.J.; Deng, Y.; Springer, H.; Raabe, D.

2015-01-01

The high entropy alloy (HEA) concept has triggered a renewed interest in alloy design, even though some aspects of the underlying thermodynamic concepts are still under debate. This study addresses the short-comings of this alloy design strategy with the aim to open up new directions of HEA research targeting specifically non-equiatomic yet massively alloyed compositions. We propose that a wide range of massive single phase solid solutions could be designed by including non-equiatomic variants. It is demonstrated by introducing a set of novel non-equiatomic multi-component CoCrFeMnNi alloys produced by metallurgical rapid alloy prototyping. Despite the reduced configurational entropy, detailed characterization of these materials reveals a strong resemblance to the well-studied equiatomic single phase HEA: The microstructure of these novel alloys exhibits a random distribution of alloying elements (confirmed by Energy-Dispersive Spectroscopy and Atom Probe Tomography) in a single face-centered-cubic phase (confirmed by X-ray Diffraction and Electron Backscatter Diffraction), which deforms through planar slip (confirmed by Electron-Channeling Contrast Imaging) and leads to excellent ductility (confirmed by uniaxial tensile tests). This approach widens the field of HEAs to non-equiatomic multi-component alloys since the concept enables to tailor the stacking fault energy and associated transformation phenomena which act as main mechanisms to design useful strain hardening behavior.

A sulfidation-resistant nickel-base alloy

International Nuclear Information System (INIS)

Lai, G.Y.

1989-01-01

For applications in mildly to moderately sulfidizing environments, stainless steels, Fe-Ni-Cr alloys (e.g., alloys 800 and 330), and more recently Fe-Ni-Cr-Co alloys (e.g., alloy 556) are frequently used for construction of process equipment. However, for many highly sulfidizing environments, few existing commercial alloys have adequate performance. Thus, a new nickel-based alloy containing 27 wt.% Co, 28 wt.% Cr, 4 wt.% Fe, 2.75 wt.% Si, 0.5 wt.% Mn and 0.05 wt.% C (Haynes alloy HR-160) was developed

41 CFR 102-2.30 - Where and in what formats is the FMR published?

Science.gov (United States)

2010-07-01

... formats is the FMR published? 102-2.30 Section 102-2.30 Public Contracts and Property Management Federal... published? Proposed rules are published in the Federal Register. FMR bulletins are published in looseleaf format. FMR interim and final rules are published in the following formats— (a) Federal Register under...

48 CFR 1952.102-2 - Incorporation in full text.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Incorporation in full text... Clauses 1952.102-2 Incorporation in full text. All IAAR provisions and clauses shall be incorporated in solicitations and/or contracts in full text. ...

48 CFR 245.102 - Policy.

Science.gov (United States)

2010-10-01

... DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY General 245.102 Policy. (1) Mapping, charting, and geodesy property. All Government-furnished mapping, charting, and geodesy (MC&G) property is under the control of...

The behaviour of hydrogen in Excel alloy

Energy Technology Data Exchange (ETDEWEB)

Ells, C.E. [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Coleman, C.E. [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Cheadle, B.A. [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Sagat, S. [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Rodgers, D.K. [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.

1995-12-15

To enable mitigation of deleterious effects from hydride on the mechanical behaviour of Excel alloy, Zr-3.5 wt.% Sn-0.8 wt.% Mo-0.8 wt.% Nb, the behaviours of hydrogen and hydride in the alloy have been studied. Properties of interest are the terminal solid solubility, diffusivity, heat of transport, stress reorientation, and the initiation and crack growth of delayed hydride cracking. The results obtained are compared with those of other zirconium-rich alloys, notably Zr-2.5 wt.% Nb. (orig.)