Lifescience Database Archive (English)
Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT
Genetic structure of the gentle Africanized honey bee population (gAHB) in Puerto Rico.
Galindo-Cardona, Alberto; Acevedo-Gonzalez, Jenny P; Rivera-Marchand, Bert; Giray, Tugrul
2013-08-06
The Africanized honey bee is one of the most spectacular invasions in the Americas. African bees escaped from apiaries in Brazil in 1956, spread over Americas and by 1994 they were reported in Puerto Rico. In contrast to other places, the oceanic island conditions in Puerto Rico may mean a single introduction and different dynamics of the resident European and new-coming Africanized bees.To examine the genetic variation of honey bee feral populations and colonies from different locations in Puerto Rico, we used eight known polymorphic microsatellite loci. In Puerto Rico, gAHB population does not show any genetic structure (Fst = 0.0783), and is best described as one honey bee population, product of hybridization of AHB and EHB. The genetic variability in this Africanized population was similar to that reported in studies from Texas. We observed that European private allele frequencies are high in all but one locus. This contrasts with mainland Africanized populations, where European allele frequencies are diminished. Two loci with European private alleles, one on Linkage Group 7, known to carry two known defensiveness Quantitative Trait Loci (QTLs), and the other on Linkage Group 1, known to carry three functionally studied genes and 11 candidate genes associated with Varroa resistance mechanisms were respectively, significantly greater or lower in European allele frequency than the other loci with European private alleles. Genetic structure of Puerto Rico gAHB differs from mainland AHB populations, probably representing evolutionary processes on the island.
DEFF Research Database (Denmark)
Guo, Yougui; Zeng, Ping; Li, Lijuan
2011-01-01
Adaptive hysteresis band current control(AHB CC) is used to control the three-phase grid currents by means of grid side converter in wind power generation system in this paper. AHB has reached the good purpose with PLL (Lock phase loop). First the mathematical models of each part are given......, transformer and grid, and control parts, etc. The simulation results have verified that the control strategy is feasible to fit for control of gird currents, active power, reactive power and DC-link voltage in wind power generation system....
Use of Commercial FPGA-Based Evaluation Boards for Single-Event Testing of DDR2 and DDR3 SDRAMs
Ladbury, R. L.; Berg, M. D.; Wilcox, E. P.; LaBel, K. A.; Kim, H. S.; Phan, A. M.; Seidleck, C. M.
2013-01-01
We investigate the use of commercial FPGA based evaluation boards for radiation testing DDR2 and DDR3 SDRAMs. We evaluate the resulting data quality and the tradeoffs involved in the use of these boards.
Image acquisition in general radiography: The utilisation of DDR
International Nuclear Information System (INIS)
Hayre, C.M.; Eyden, A.; Blackman, S.; Carlton, K.
2017-01-01
Objective: This article explores image acquisition with DDR. General radiographic technology continues to advance therefore it remains paramount to continually reflect on DDR hardware and software amongst radiographers in an imaging modality that constitutes approximately 90% of all radiological examinations. Method: This article reports findings from a wider ethnographic study of two general radiography environments in the United Kingdom (UK). Participant observation and semi-structured interviews were the methods used to uncover original data. Results: Two key themes are discussed. Firstly, ‘the extent of DDR knowledge’ amongst radiographers is examined. The findings uncover that not all radiographers have an adequate knowledge base with DDR technology. Secondly, ‘pitfalls and near misses with DDR’ is discussed. This theme highlights the potential danger of radiographers ‘over-repeating’ X-ray examinations, coincided with the occurrence of radiological incidents whereby a patient is exposed to ionising radiation with no added benefit. Conclusion: This paper concludes by challenging the current ‘skill base’ to operate DDR equipment. In addition, new pitfalls and near misses are highlighted, which may help forestall radiation incidents in the future. Dose and image optimisation remain central tenets to the role of the radiographer. Advances in knowledge: Few studies have challenged image acquisition with DDR. This study adds to existing knowledge by uncovering original phenomena that may initiate discussions within the radiography community and continually enhance healthcare delivery. - Highlights: • Radiographers may not have appropriate knowledge of DDR technology. • Suggests DDR may facilitate a ‘hit and miss’ approach to image acquisition. • Identifies radiographic errors with DDR, leading to radiological incidents.
Discoidin domain receptor 2 (DDR2) regulates proliferation of endochondral cells in mice
International Nuclear Information System (INIS)
Kawai, Ikuma; Hisaki, Tomoka; Sugiura, Koji; Naito, Kunihiko; Kano, Kiyoshi
2012-01-01
Highlights: ► Discoidin domain receptor 2 (DDR2) is a receptor tyrosine kinase. ► DDR2 regulates cell proliferation, cell adhesion, migration, and extracellular matrix remodeling. ► We produced in vitro and in vivo model to better understand the role of DDR2. ► DDR2 might play an inhibitory role in the proliferation of chondrocyte. -- Abstract: Discoidin domain receptor 2 (DDR2) is a receptor tyrosine kinase that is activated by fibrillar collagens. DDR2 regulates cell proliferation, cell adhesion, migration, and extracellular matrix remodeling. The decrement of endogenous DDR2 represses osteoblastic marker gene expression and osteogenic differentiation in murine preosteoblastic cells, but the functions of DDR2 in chondrogenic cellular proliferation remain unclear. To better understand the role of DDR2 signaling in cellular proliferation in endochondral ossification, we inhibited Ddr2 expression via the inhibitory effect of miRNA on Ddr2 mRNA (miDdr2) and analyzed the cellular proliferation and differentiation in the prechondrocyte ATDC5 cell lines. To investigate DDR2’s molecular role in endochondral cellular proliferation in vivo, we also produced transgenic mice in which the expression of truncated, kinase dead (KD) DDR2 protein is induced, and evaluated the DDR2 function in cellular proliferation in chondrocytes. Although the miDdr2-transfected ATDC5 cell lines retained normal differentiation ability, DDR2 reduction finally promoted cellular proliferation in proportion to the decreasing ratio of Ddr2 expression, and it also promoted earlier differentiation to cartilage cells by insulin induction. The layer of hypertrophic chondrocytes in KD Ddr2 transgenic mice was not significantly thicker than that of normal littermates, but the layer of proliferative chondrocytes in KD-Ddr2 transgenic mice was significantly thicker than that of normal littermates. Taken together, our data demonstrated that DDR2 might play a local and essential role in the
Discoidin domain receptor 2 (DDR2) regulates proliferation of endochondral cells in mice
Energy Technology Data Exchange (ETDEWEB)
Kawai, Ikuma; Hisaki, Tomoka; Sugiura, Koji; Naito, Kunihiko [Laboratory of Applied Genetics, Graduate School of Agricultural and Life Science, University of Tokyo, Tokyo 113-8657 (Japan); Kano, Kiyoshi, E-mail: kanokiyo@yamaguchi-u.ac.jp [Laboratory of Developmental Biology, Joint Faculty of Veterinary Medicine, Yamaguchi University, Yamaguchi 753-8515, Japan. (Japan); Biomedical Science Center for Translational Research (BSCTR), The United Graduate School of Veterinary Science, Yamaguchi University, Yamaguchi 753-8515 (Japan)
2012-10-26
Highlights: Black-Right-Pointing-Pointer Discoidin domain receptor 2 (DDR2) is a receptor tyrosine kinase. Black-Right-Pointing-Pointer DDR2 regulates cell proliferation, cell adhesion, migration, and extracellular matrix remodeling. Black-Right-Pointing-Pointer We produced in vitro and in vivo model to better understand the role of DDR2. Black-Right-Pointing-Pointer DDR2 might play an inhibitory role in the proliferation of chondrocyte. -- Abstract: Discoidin domain receptor 2 (DDR2) is a receptor tyrosine kinase that is activated by fibrillar collagens. DDR2 regulates cell proliferation, cell adhesion, migration, and extracellular matrix remodeling. The decrement of endogenous DDR2 represses osteoblastic marker gene expression and osteogenic differentiation in murine preosteoblastic cells, but the functions of DDR2 in chondrogenic cellular proliferation remain unclear. To better understand the role of DDR2 signaling in cellular proliferation in endochondral ossification, we inhibited Ddr2 expression via the inhibitory effect of miRNA on Ddr2 mRNA (miDdr2) and analyzed the cellular proliferation and differentiation in the prechondrocyte ATDC5 cell lines. To investigate DDR2's molecular role in endochondral cellular proliferation in vivo, we also produced transgenic mice in which the expression of truncated, kinase dead (KD) DDR2 protein is induced, and evaluated the DDR2 function in cellular proliferation in chondrocytes. Although the miDdr2-transfected ATDC5 cell lines retained normal differentiation ability, DDR2 reduction finally promoted cellular proliferation in proportion to the decreasing ratio of Ddr2 expression, and it also promoted earlier differentiation to cartilage cells by insulin induction. The layer of hypertrophic chondrocytes in KD Ddr2 transgenic mice was not significantly thicker than that of normal littermates, but the layer of proliferative chondrocytes in KD-Ddr2 transgenic mice was significantly thicker than that of normal littermates
Connecting Community Security and DDR: Experiences from Burundi
Willems, R.C.; Kleingeld, J.; van Leeuwen, M.
2010-01-01
The report is based on 10 weeks of field research in Burundi between April and June 2010, and looks at the linkages between community security and DDR. It opens with a discussion of local experiences with DDR programmes, analyzing the impact of its different components, and analyzing the local
From DDR to Security Promotion: Connecting national programs to community initiatives
Verkoren, W.; Willems, R.C.; Kleingeld, J.; Rouw, H.
2010-01-01
Disarmament, demobilization and reintegration (DDR) is a set of activities that forms part of strategies for peacebuilding after civil war. DDR has become the standard way of addressing security threats in immediate post-conflict situations. However, DDR is designed to promote national security,
DDR and the Internal Organization of Non-State Armed Groups
Directory of Open Access Journals (Sweden)
Brian McQuinn
2016-03-01
Full Text Available This paper argues that demobilization, disarmament and reintegration (DDR trajectories of non-state armed groups are shaped by a group’s internal organization. Extensive research by political scientists has demonstrated a correlation between internal features of armed groups and their behaviour (e.g. extent of violence used against local communities. I extend this analysis to DDR outcomes by illustrating how two features of an armed group’s internal organization – command profile and financing architecture – influence post-conflict DDR trajectories. To substantiate the theory, four case studies from Colombia, Nepal and Libya are reviewed. The article concludes with the limitations and opportunities of this approach, including the potential of predicting DDR challenges.
Mesenchymal Stem Cell-Induced DDR2 Mediates Stromal-Breast Cancer Interactions and Metastasis Growth
Directory of Open Access Journals (Sweden)
Maria E. Gonzalez
2017-01-01
Full Text Available Increased collagen deposition by breast cancer (BC-associated mesenchymal stem/multipotent stromal cells (MSC promotes metastasis, but the mechanisms are unknown. Here, we report that the collagen receptor discoidin domain receptor 2 (DDR2 is essential for stromal-BC communication. In human BC metastasis, DDR2 is concordantly upregulated in metastatic cancer and multipotent mesenchymal stromal cells. In MSCs isolated from human BC metastasis, DDR2 maintains a fibroblastic phenotype with collagen deposition and induces pathological activation of DDR2 signaling in BC cells. Loss of DDR2 in MSCs impairs their ability to promote DDR2 phosphorylation in BC cells, as well as BC cell alignment, migration, and metastasis. Female ddr2-deficient mice homozygous for the slie mutation show inefficient spontaneous BC metastasis. These results point to a role for mesenchymal stem cell DDR2 in metastasis and suggest a therapeutic approach for metastatic BC.
Schriftstellerinnen der DDR und feministisches Bewußtsein im Staatssozialismus
Directory of Open Access Journals (Sweden)
Eva Kaufmann
2001-11-01
Full Text Available Seit den 1960er Jahren produzierten Schriftstellerinnen in der DDR wie Christa Wolf, Irmtraud Morgner, Sarah Kirsch, Brigitte Reimann, Charlotte Worgitzky, Lia Pirskawetz, und Maya Wiens eine vielfältige Literatur zu frauenrelevanten Themen. Den Obertitel „The Promised Land“ (das gelobte Land hat Lorna Martens Irmtraud Morgner entlehnt, der Autorin, die sie neben Christa Wolf als wichtigste Zeugin für „feminist writing“ in der DDR betrachtet. In Morgners Roman Leben und Abenteuer der Trobadora Beatriz steht der Begriff „gelobtes Land“ bezogen auf die DDR in einem ironischen Zusammenhang. Mit simplem Jaja oder Neinnein ist diesem „Ort des Wunderbaren“ (Morgner nicht beizukommen. Vergleichbares signalisiert auch das Fragezeichen, das Martens hinter den Begriff „Promised Land“ setzt. Der anspielungsreiche Verweis auf das Land erscheint auch insofern nützlich, als die Eigenart feministischen Schreibens genauer zu fassen ist, wenn über das Land selbst, namentlich seine Frauenpolitik, Auskünfte gegeben werden. Lorna Martens möchte herausfinden, wie Schriftstellerinnen in der DDR feministisches Bewusstsein artikuliert haben, d.h. feministisches Bewusstsein unter den vom Staatssozialismus geschaffenen Bedingungen.
Monopoly of Force: The Nexus of DDR and SSR
2011-01-01
Washington, DC, May 4, 2010. 52 Vanessa Farr, Albrecht Schnabel, and Henri Myrttinen, eds., Sexed Pistols: Gendered Impacts of Small Arms and...discussion of various lessons learned see Edward Bell and Charlotte Watson, DDR: Sup- porting Security and Development: The EU’s Added Value, London...45 Specker, The R-Phase of DDR Processes, 4. 46 This distinction has been made by many authors. See, for example, Ball and van de Goor, 2–3; Mark
Perrot, Nicolas; Dubus, Patrick; Garcia-Sanchez, Esther
2015-09-01
Memory system architectures using DDR2 technology need to be compliant with JEDEC JESD8-15A standard [1]. Therefore a bus termination regulator able to sink and source current while regulating VTT voltage is used for this purpose. Such module has been developed by 3D PLUS and is the first space qualified DDR Termination Regulator (DDR2-TR) available on the market. It is based on an innovative Bang-Bang regulation principle, chosen for its speed performance and to guarantee an output voltage that remains within the predefined limits regardless of any output current transients. The output filter type is selected to make the module rugged to any overload condition without complex protection circuits. The module has been specifically designed for low input voltage, low noise and high reliability systems where space is a key consideration. The module uses the 3D PLUS SIP (System-In-Package) technology embedding 3 stacked PCBs. No external filters or decoupling capacitors are needed.
A pilot of a video game (DDR) to promote physical activity and decrease sedentary screen time.
Maloney, Ann E; Bethea, T Carter; Kelsey, Kristine S; Marks, Julie T; Paez, Sadye; Rosenberg, Angela M; Catellier, Diane J; Hamer, Robert M; Sikich, Linmarie
2008-09-01
We examined the feasibility of Dance Dance Revolution (DDR), a dance video game, in participants' homes, to increase physical activity (PA) and to decrease sedentary screen time (SST). Sixty children (7.5 +/- 0.5 years) were randomized in a 2:1 ratio to DDR or to wait-list control (10-week delay). DDR use was logged, PA was measured objectively by accelerometry. SST was self-reported at weeks 0 and 10. At week 28, after both groups had access to DDR, accelerometry and SST were repeated. Mean use of DDR was 89 +/- 82 (range 0-660 min) min per week (mpw). The DDR group showed increased vigorous PA and a reduction in light PA; the control group showed no increase in moderate and/or vigorous PA (MVPA) although they also had a reduction in light PA. Differences between the groups were not observed. The DDR group also reported a decrease in SST of -1.2 +/- 3.7 h per week (hpw) (P increase of +3.0 +/- 7.7 hpw (nonsignificant). The difference in SST between the groups was significant, with less SST in the DDR group. Between weeks 10 and 28, numeric reductions in SST were reported in both groups. In the DDR group, SST at week 28 (8.8 +/- 6.0 hpw) was lower than baseline (10.5 +/- 5.5 hpw; P increases in vigorous PA. Further study is needed to better characterize children and contexts in which DDR may promote a healthy lifestyle.
Sacco, Antonella; Morcavallo, Alaide; Vella, Veronica; Voci, Concetta; Spatuzza, Michela; Xu, Shi-Qiong; Iozzo, Renato V.; Vigneri, Riccardo; Morrione, Andrea; Belfiore, Antonino
2015-01-01
The insulin-like growth factor-I receptor (IGF-IR), plays a key role in regulating mammalian development and growth, and is frequently deregulated in cancer contributing to tumor initiation and progression. Discoidin domain receptor 1 (DDR1), a collagen receptor tyrosine-kinase, is as well frequently overexpressed in cancer and implicated in cancer progression. Thus, we investigated whether a functional cross-talk between the IGF-IR and DDR1 exists and plays any role in cancer progression. Using human breast cancer cells we found that DDR1 constitutively associated with the IGF-IR. However, this interaction was enhanced by IGF-I stimulation, which promoted rapid DDR1 tyrosine-phosphorylation and co-internalization with the IGF-IR. Significantly, DDR1 was critical for IGF-IR endocytosis and trafficking into early endosomes, IGF-IR protein expression and IGF-I intracellular signaling and biological effects, including cell proliferation, migration and colony formation. These biological responses were inhibited by DDR1 silencing and enhanced by DDR1 overexpression. Experiments in mouse fibroblasts co-transfected with the human IGF-IR and DDR1 gave similar results and indicated that, in the absence of IGF-IR, collagen-dependent phosphorylation of DDR1 is impaired. These results demonstrate a critical role of DDR1 in the regulation of IGF-IR action, and identify DDR1 as a novel important target for breast cancers that overexpress IGF-IR. PMID:25840417
Olayan, Rawan S.
2017-11-23
Motivation Finding computationally drug-target interactions (DTIs) is a convenient strategy to identify new DTIs at low cost with reasonable accuracy. However, the current DTI prediction methods suffer the high false positive prediction rate. Results We developed DDR, a novel method that improves the DTI prediction accuracy. DDR is based on the use of a heterogeneous graph that contains known DTIs with multiple similarities between drugs and multiple similarities between target proteins. DDR applies non-linear similarity fusion method to combine different similarities. Before fusion, DDR performs a pre-processing step where a subset of similarities is selected in a heuristic process to obtain an optimized combination of similarities. Then, DDR applies a random forest model using different graph-based features extracted from the DTI heterogeneous graph. Using five repeats of 10-fold cross-validation, three testing setups, and the weighted average of area under the precision-recall curve (AUPR) scores, we show that DDR significantly reduces the AUPR score error relative to the next best start-of-the-art method for predicting DTIs by 34% when the drugs are new, by 23% when targets are new, and by 34% when the drugs and the targets are known but not all DTIs between them are not known. Using independent sources of evidence, we verify as correct 22 out of the top 25 DDR novel predictions. This suggests that DDR can be used as an efficient method to identify correct DTIs.
The Struggle after Combat. The role of NGOs in DDR processes: Afganistan Case Study
Frerks, G.E.; Gompelman, G.; Laar, van de S.; Klem, B.
2008-01-01
It has come to be well-recognised that effective DDR (Disarmant, Demobilisation and Reinregration of ex-combatants) is crucial for building durable peace and preventing a relapse into conflict. It has also become clear that DDR is difficult and that it is intertwined with other war to peace
Channel Analysis for a 6.4 Gb s-1 DDR5 Data Buffer Receiver Front-End
Lehmann, Stefanie; Gerfers, Friedel
2017-09-01
In this contribution, the channel characteristic of the next generation DDR5-SDRAM architecture and possible approaches to overcome channel impairments are analysed. Because modern enterprise server applications and networks demand higher memory bandwidth, throughput and capacity, the DDR5-SDRAM specification is currently under development as a follow-up of DDR4-SDRAM technology. In this specification, the data rate is doubled to DDR5-6400 per IO as compared to the former DDR4-3200 architecture, resulting in a total per DIMM data rate of up to 409.6 Gb s-1. The single-ended multi-point-to-point CPU channel architecture in DDRX technology remains the same for DDR5 systems. At the specified target data rate, insertion loss, reflections, cross-talk as well as power supply noise become more severe and have to be considered. Using the data buffer receiver front-end of a load-reduced memory module, sophisticated equalisation techniques can be applied to ensure target BER at the increased data rate. In this work, the worst case CPU back-plane channel is analysed to derive requirements for receiver-side equalisation from the channel response characteristics. First, channel impairments such as inter-symbol-interference, reflections from the multi-point channel structure, and crosstalk from neighboring lines are analysed in detail. Based on these results, different correction methods for DDR5 data buffer front-ends are discussed. An architecture with 1-tap FFE in combination with a multi-tap DFE is proposed. Simulation of the architecture using a random input data stream is used to reveal the required DFE tap filter depth to effectively eliminate the dominant ISI and reflection based error components.
Dib, Leila; Hayek, Peter; Sadek, Helen; Beyrouthy, Berna; Khalaf, Roy A
2008-06-01
Candida albicans is a dimorphic pathogenic fungus that causes mucosal and systemic infections. C. albicans pathogenicity is attributed to its ability to exist in different morphologic states and to respond to stress by up regulating several key genes. DDR48 is a stress-associated gene involved in DNA repair and in response to antifungal drug exposure. One allele of DDR48 was knocked out by homologous recombination that inserted a marker cassette in its position. Furthermore, reintroducing DDR48 on a plasmid created a revertant strain. Strains were grown on filamentation inducing and noninducing media, subjected to an oxidative stress challenge, injected into mice to assess virulence, and assayed for antifungal susceptibility by the E-test method. DDR48 was found to be haploid insufficient and possibly essential, since only a heterozygote, but not a homozygous, null mutant was generated. The mutant was filamentation defective on all hyphal media tested including serum and corn meal agar. Discrepancies in drug resistance profiles also were present: compared with the parental strain, DDR48/ddr48 heterozygote strain was susceptible in a dose-dependent manner to itraconazole and fluconazole and susceptible to ketoconazole. The mutant also appeared to be hypersensitive to a potentially lethal hydrogen peroxide challenge. However, no reduction in virulence of the mutant was observed. The present findings provide evidence that DDR48 is essential for filamentation, stress response, and possibly viability of C. albicans, making it a prime target for antifungal drug design.
Olayan, Rawan S.; Ashoor, Haitham; Bajic, Vladimir B.
2017-01-01
but not all DTIs between them are not known. Using independent sources of evidence, we verify as correct 22 out of the top 25 DDR novel predictions. This suggests that DDR can be used as an efficient method to identify correct DTIs.
Energy Technology Data Exchange (ETDEWEB)
Krüger, Katharina; Ziegler, Verena; Hartmann, Christina; Henninger, Christian [Institute of Toxicology, Medical Faculty, Heinrich Heine University Düsseldorf, 40225 Düsseldorf (Germany); Thomale, Jürgen [Institute of Cell Biology, University Duisburg-Essen, 45122 Essen (Germany); Schupp, Nicole [Institute of Toxicology, Medical Faculty, Heinrich Heine University Düsseldorf, 40225 Düsseldorf (Germany); Fritz, Gerhard, E-mail: fritz@uni-duesseldorf.de [Institute of Toxicology, Medical Faculty, Heinrich Heine University Düsseldorf, 40225 Düsseldorf (Germany)
2016-02-01
The platinating agent cisplatin (CisPt) is commonly used in the therapy of various types of solid tumors. The anticancer efficacy of CisPt largely depends on the formation of bivalent DNA intrastrand crosslinks, which stimulate mechanisms of the DNA damage response (DDR), thereby triggering checkpoint activation, gene expression and cell death. The clinically most relevant adverse effect associated with CisPt treatment is nephrotoxicity that results from damage to renal tubular epithelial cells. Here, we addressed the question whether the HMG-CoA-reductase inhibitor lovastatin affects the DDR of renal cells by employing rat renal proximal tubular epithelial (NRK-52E) cells as in vitro model. The data show that lovastatin has extensive inhibitory effects on CisPt-stimulated DDR of NRK-52E cells as reflected on the levels of phosphorylated ATM, Chk1, Chk2, p53 and Kap1. Mitigation of CisPt-induced DDR by lovastatin was independent of the formation of DNA damage as demonstrated by (i) the analysis of Pt-(GpG) intrastrand crosslink formation by Southwestern blot analyses and (ii) the generation of DNA strand breaks as analyzed on the level of nuclear γH2AX foci and employing the alkaline comet assay. Lovastatin protected NRK-52E cells from the cytotoxicity of high CisPt doses as shown by measuring cell viability, cellular impedance and flow cytometry-based analyses of cell death. Importantly, the statin also reduced the level of kidney DNA damage and apoptosis triggered by CisPt treatment of mice. The data show that the lipid-lowering drug lovastatin extensively counteracts pro-apoptotic signal mechanisms of the DDR of tubular epithelial cells following CisPt injury. - Highlights: • Lovastatin blocks ATM/ATR-regulated DDR of tubular cells following CisPt treatment. • Lovastatin attenuates CisPt-induced activation of protein kinase ATM in vitro. • Statin-mediated DDR inhibition is independent of initial DNA damage formation. • Statin-mediated blockage of Cis
International Nuclear Information System (INIS)
Krüger, Katharina; Ziegler, Verena; Hartmann, Christina; Henninger, Christian; Thomale, Jürgen; Schupp, Nicole; Fritz, Gerhard
2016-01-01
The platinating agent cisplatin (CisPt) is commonly used in the therapy of various types of solid tumors. The anticancer efficacy of CisPt largely depends on the formation of bivalent DNA intrastrand crosslinks, which stimulate mechanisms of the DNA damage response (DDR), thereby triggering checkpoint activation, gene expression and cell death. The clinically most relevant adverse effect associated with CisPt treatment is nephrotoxicity that results from damage to renal tubular epithelial cells. Here, we addressed the question whether the HMG-CoA-reductase inhibitor lovastatin affects the DDR of renal cells by employing rat renal proximal tubular epithelial (NRK-52E) cells as in vitro model. The data show that lovastatin has extensive inhibitory effects on CisPt-stimulated DDR of NRK-52E cells as reflected on the levels of phosphorylated ATM, Chk1, Chk2, p53 and Kap1. Mitigation of CisPt-induced DDR by lovastatin was independent of the formation of DNA damage as demonstrated by (i) the analysis of Pt-(GpG) intrastrand crosslink formation by Southwestern blot analyses and (ii) the generation of DNA strand breaks as analyzed on the level of nuclear γH2AX foci and employing the alkaline comet assay. Lovastatin protected NRK-52E cells from the cytotoxicity of high CisPt doses as shown by measuring cell viability, cellular impedance and flow cytometry-based analyses of cell death. Importantly, the statin also reduced the level of kidney DNA damage and apoptosis triggered by CisPt treatment of mice. The data show that the lipid-lowering drug lovastatin extensively counteracts pro-apoptotic signal mechanisms of the DDR of tubular epithelial cells following CisPt injury. - Highlights: • Lovastatin blocks ATM/ATR-regulated DDR of tubular cells following CisPt treatment. • Lovastatin attenuates CisPt-induced activation of protein kinase ATM in vitro. • Statin-mediated DDR inhibition is independent of initial DNA damage formation. • Statin-mediated blockage of Cis
International Nuclear Information System (INIS)
Miao, Liyun; Zhang, Deping; Liu, Hongbing; Song, Yong; Wang, Yongsheng; Zhu, Suhua; Shi, Minke; Li, Yan; Ding, Jingjing; Yang, Jun; Ye, Qing; Cai, Hourong
2014-01-01
Although many of the recently approved genomically targeted therapies have improved outcomes for patients in non–small-cell lung cancer (NSCLC) with lung adenocarcinoma, little is known about the genomic alterations that drive lung squamous cell cancer (SCC) and development of effective targeted therapies in lung SCC is a promising area to be further investigated. Discoidin domain receptor 2 (DDR2), is a novel receptor tyrosine kinases that respond to several collagens and involved in tissue repair, primary and metastatic cancer progression. Expression of DDR2 mRNA was analyzed in 54 lung SCC tissues by qRT-PCR. Over-expression approaches were used to investigate the biological functions of DDR2 and its’ mutations in lung SCC cells. Conventional Sanger sequencing was used to investigate the mutations of DDR2 gene in 86 samples. The effect of DDR2 and its’ mutations on proliferation was evaluated by MTT and colony formation assays; cell migration and invasion was evaluated by trasnwell assays. Lung SCC cells stably transfected with pEGFP-DDR2 WT, pEGFP-DDR2-S131C or empty vector were injection into nude mice to study the effect of DDR2 and its’ mutation on tumorigenesis in vivo. Protein and mRNA expression levels of E-cadherin and MMP2 were determined by qRT-PCR and western blot analysis. Differences between groups were tested for significance using Student’s t-test (two-tailed). In this study, we found that DDR2 mRNA levels were significantly decreased in 54 lung SCC tissues compared with normal lung tissues. Moreover, there were 3 novel DDR2 mutations (G531V, S131C, T681I) in 4 patients and provide the mutation rate of 4.6% in the 86 patients with lung SCC. The mutation of S131C in DDR2 could promote lung SCC cells proliferation, migration and invasion via inducing MMP-2, but reducing E-cadherin expression. These data indicated that the novel DDR2 mutation may contribute to the development and progression of lung SCC and this effect may be associated
International Nuclear Information System (INIS)
Acharyya, Aritra; Banerjee, J. P.; Chakraborty, Jit; Das, Kausik; Datta, Subir; De, Pritam; Banerjee, Suranjana
2013-01-01
The authors have carried out the large-signal characterization of silicon-based double-drift region (DDR) impact avalanche transit time (IMPATT) devices designed to operate up to 0.5 THz using a large-signal simulation method developed by the authors based on non-sinusoidal voltage excitation. The effect of band-to-band tunneling as well as parasitic series resistance on the large-signal properties of DDR Si IMPATTs have also been studied at different mm-wave and THz frequencies. Large-signal simulation results show that DDR Si IMPATT is capable of delivering peak RF power of 633.69 mW with 7.95% conversion efficiency at 94 GHz for 50% voltage modulation, whereas peak RF power output and efficiency fall to 81.08 mW and 2.01% respectively at 0.5 THz for same voltage modulation. The simulation results are compared with the experimental results and are found to be in close agreement. (semiconductor devices)
Energy Technology Data Exchange (ETDEWEB)
Dong, J; Sarkar, A; Hoffmann, P [Wayne State University, Detroit, MI (United States); Suhail, A; Fridman, R [Wayne State University School of Medicine, Detroit, MI (United States)
2016-06-15
Purpose: Discoidin domain receptors (DDR) have recently been recognized as important players in cancer progression. DDRs are cell receptors that interact with collagen, an extracellular matrix (ECM) protein. However the detailed mechanism of their interaction is unclear. Here we attempted to examine their interaction in terms of structural (surface topography), mechanical (rupture force), and kinetic (binding probability) information on the single molecular scale with the use of atomic force microscopy (AFM). Methods: The Quantitative Nano-mechanical property Mapping (QNM) mode of AFM allowed to assess the cells in liquid growth media at their optimal physiological while being viable. Human benign prostate hyperplasia (BPH-1) cell line was genetically regulated to suppress DDR expression (DDR- cells) and was compared with naturally DDR expressing cells (DDR+). Results: Binding force measurements (n = 1000) were obtained before and after the two groups were treated with fibronectin (FN), an integrin-inhibiting antibody to block the binding of integrin. The quantification indicates that cells containing DDR bind with collagen at a most probable force of 80.3–83.0 ±7.6 pN. The probability of them binding is 0.167 when other interactions (mainly due to integrin-collagen binding) are minimized. Conclusion: Together with further force measurements at different pulling speeds will determine dissociation rate, binding distance and activation barrier. These parameters in benign cells provides some groundwork in understanding DDR’s behavior in various cell microenvironments such as in malignant tumor cells. Funding supported by Richard Barber Interdisciplinary Research Program of Wayne State University.
International Nuclear Information System (INIS)
Dong, J; Sarkar, A; Hoffmann, P; Suhail, A; Fridman, R
2016-01-01
Purpose: Discoidin domain receptors (DDR) have recently been recognized as important players in cancer progression. DDRs are cell receptors that interact with collagen, an extracellular matrix (ECM) protein. However the detailed mechanism of their interaction is unclear. Here we attempted to examine their interaction in terms of structural (surface topography), mechanical (rupture force), and kinetic (binding probability) information on the single molecular scale with the use of atomic force microscopy (AFM). Methods: The Quantitative Nano-mechanical property Mapping (QNM) mode of AFM allowed to assess the cells in liquid growth media at their optimal physiological while being viable. Human benign prostate hyperplasia (BPH-1) cell line was genetically regulated to suppress DDR expression (DDR- cells) and was compared with naturally DDR expressing cells (DDR+). Results: Binding force measurements (n = 1000) were obtained before and after the two groups were treated with fibronectin (FN), an integrin-inhibiting antibody to block the binding of integrin. The quantification indicates that cells containing DDR bind with collagen at a most probable force of 80.3–83.0 ±7.6 pN. The probability of them binding is 0.167 when other interactions (mainly due to integrin-collagen binding) are minimized. Conclusion: Together with further force measurements at different pulling speeds will determine dissociation rate, binding distance and activation barrier. These parameters in benign cells provides some groundwork in understanding DDR’s behavior in various cell microenvironments such as in malignant tumor cells. Funding supported by Richard Barber Interdisciplinary Research Program of Wayne State University
Charles, Saby; Hassan, Rammal; Kevin, Magnien; Emilie, Buache; Sylvie, Brassart-Pasco; Laurence, Van-Gulick; Pierre, Jeannesson; Erik, Maquoi; Hamid, Morjani
2018-05-07
Type I collagen and DDR1 axis has been described to decrease cell proliferation and to initiate apoptosis in non-invasive breast carcinoma in three-dimensional cell culture matrices. Moreover, MT1-MMP down-regulates these effects. Here, we address the effect of type I collagen aging and MT1-MMP expression on cell proliferation suppression and induced-apoptosis in non-invasive MCF-7 and ZR-75-1 breast carcinoma. We provide evidence for a decrease in cell growth and an increase in apoptosis in the presence of adult collagen when compared to old collagen. This effect involves a differential activation of DDR1, as evidenced by a higher DDR1 phosphorylation level in adult collagen. In adult collagen, inhibition of DDR1 expression and kinase function induced an increase in cell growth to a level similar to that observed in old collagen. The impact of aging on the sensitivity of collagen to MT1-MMP has been reported recently. We used the MT1-MMP expression strategy to verify whether, by degrading adult type I collagen, it could lead to the same phenotype observed in old collagen 3D matrix. MT1-MMP overexpression abrogated the proliferation suppression and induced-apoptosis effects only in the presence of adult collagen. This suggests that differential collagen degradation by MT1-MMP induced a structural disorganization of adult collagen and inhibits DDR1 activation. This could in turn impair DDR1-induced cell growth suppression and apoptosis. Taken together, our data suggest that modifications of collagen structural organization, due to aging, contribute to the loss of the growth suppression and induced apoptosis effect of collagen in luminal breast carcinoma. MT1-MMP-dependent degradation and aging of collagen have no additive effects on these processes.
Directory of Open Access Journals (Sweden)
Yan Guo
Full Text Available DDR2 gene, playing an essential role in regulating osteoblast differentiation and chondrocyte maturation, may influence bone mineral density (BMD and osteoporosis, but the genetic variations actually leading to the association remain to be elucidated. Therefore, the aim of this study was to investigate whether the genetic variants in DDR2 are associated with BMD and fracture risk. This study was performed in three samples from two ethnicities, including 1,300 Chinese Han subjects, 700 Chinese Han subjects (350 with osteoporotic hip fractures and 350 healthy controls and 2,286 US white subjects. Twenty-eight SNPs in DDR2 were genotyped and tested for associations with hip BMD and fractures. We identified 3 SNPs in DDR2 significantly associated with hip BMD in the Chinese population after multiple testing adjustments, which were rs7521233 (P = 1.06×10-4, β: -0.018 for allele C, rs7553831 (P = 1.30×10-4, β: -0.018 for allele T, and rs6697469 (P = 1.59×10-3, β: -0.015 for allele C, separately. These three SNPs were in high linkage disequilibrium. Haplotype analyses detected two significantly associated haplotypes, including one haplotype in block 2 (P = 9.54×10-4, β: -0.016 where these three SNPs located. SNP rs6697469 was also associated with hip fractures (P = 0.043, OR: 1.42 in the Chinese population. The effect on fracture risk was consistent with its association with lower BMD. However, in the white population, we didn't observe significant associations with hip BMD. eQTL analyses revealed that SNPs associated with BMD also affected DDR2 mRNA expression levels in Chinese. Our findings, together with the prior biological evidence, suggest that DDR2 could be a new candidate for osteoporosis in Chinese population. Our results also reveal an ethnic difference, which highlights the need for further genetic studies in each ethnic group.
Directory of Open Access Journals (Sweden)
Joanne Richards
2016-09-01
Full Text Available Although it is common for armed groups to splinter (or “fragment” during contexts of multi-party civil war, current guidance on Disarmament, Demobilization, and Reintegration (DDR does not address the challenges that arise when recalcitrant fighters, unwilling to report to DDR, break ranks and form new armed groups. This Practice Note addresses this issue, drawing lessons from the multi-party context of the DRC and from the experiences of former members of three armed groups: the Rally for Congolese Democracy-Goma (RCD-Goma, the National Congress for the Defense of the People (CNDP, and the DRC national army (FARDC. While the findings indicate that the fragmentation of armed groups may encourage desertion and subsequent participation in DDR, they also show that active armed groups may monitor DDR programs and track those who demobilize. Remobilization may follow, either as active armed groups target ex-combatants for forced re-recruitment or as ex-combatants remobilize in armed groups of their own choice. Given these dynamics, practitioners in settings of partial peace may find it useful to consider non-traditional methods of DDR such as the use of mobile patrols and mobile disarmament units. The temporary relocation of ex-combatants to safe areas free from armed groups, or to protected transitional assistance camps, may also help to minimize remobilization during the reintegration phase.
Directory of Open Access Journals (Sweden)
A. Acharyya
2013-06-01
Full Text Available Large-signal simulation is carried out in this paper to investigate the prospects and potentiality of Double-Drift Region (DDR Impact Avalanche Transit Time (IMPATT device based on semiconducting type-IIb diamond as millimeter-wave source operating at 94 GHz atmospheric window frequency. Large-signal simulation method developed by the authors and presented in this paper is based on non-sinusoidal voltage excitation. The simulation is carried out to obtain the large-signal characteristics such as RF power output, DC to RF conversion efficiency etc. of DDR diamond IMPATT device designed to operate at 94 GHz. The results show that the device is capable of delivering a peak RF power output of 7.01 W with 10.18% DC to RF conversion efficiency for a bias current density of 6.0×10^8 A m^-2 and voltage modulation of 60% at 94 GHz; whereas for the same voltage modulation 94 GHz DDR Si IMPATT can deliver only 693.82 mW RF power with 8.74 efficiency for the bias current density of 3.4×10^8 A m^-2.
Microarray data reveal relationship between Jag1 and Ddr1 in mouse liver.
Directory of Open Access Journals (Sweden)
Lara A Underkoffler
Full Text Available Alagille syndrome is an autosomal dominant disorder involving bile duct paucity and cholestasis in addition to cardiac, skeletal, ophthalmologic, renal and vascular manifestations. Mutations in JAG1, encoding a ligand in the Notch signaling pathway, are found in 95% of patients meeting clinical criteria for Alagille syndrome. In order to define the role of Jag1 in the bile duct developmental abnormalities seen in ALGS, we previously created a Jag1 conditional knockout mouse model. Mice heterozygous for the Jag1 conditional and null alleles demonstrate abnormalities in postnatal bile duct growth and remodeling, with portal expansion and increased numbers of malformed bile ducts. In this study we report the results of microarray analysis and identify genes and pathways differentially expressed in the Jag1 conditional/null livers as compared with littermate controls. In the initial microarray analysis, we found that many of the genes up-regulated in the Jag1 conditional/null mutant livers were related to extracellular matrix (ECM interactions, cell adhesion and cell migration. One of the most highly up-regulated genes was Ddr1, encoding a receptor tyrosine kinase (RTK belonging to a large RTK family. We have found extensive co-localization of Jag1 and Ddr1 in bile ducts and blood vessels in postnatal liver. In addition, co-immunoprecipitation data provide evidence for a novel protein interaction between Jag1 and Ddr1. Further studies will be required to define the nature of this interaction and its functional consequences, which may have significant implications for bile duct remodeling and repair of liver injury.
Willems, R.C.; Kleingeld, J.; van Leeuwen, M
2010-01-01
The report is based on 10 weeks of field research in Burundi between April and June 2010, and looks at the linkages between community security and DDR. It opens with a discussion of local experiences with DDR programmes, analyzing the impact of its different components, and analyzing the local
Halveti-Şâbânî Şeyhi Mustafa Kemâleddîn Bekrî ve Hediyyetü’l-Ahbâb Adlı Eseri
Directory of Open Access Journals (Sweden)
Halim Gül
2013-03-01
Full Text Available AbstractThis article studies the life and woks of Kemaleddin Bekrî, who affiliated himself to Khalvati-Shabani Sheikh Abdullatîf b. Hüsameddîn el-Halebî, and who was growed up under Abd al-Ghani al-Nabulsi’s control. His work “Hadiyyat al-Ahbab fi ma li’l-Khalveti min al-Şuruti va’l-Adab”, which explains the conditions and rules of “khalvet” was also studied. The work consists of preface, eight parts and an epilogue and all parts examined in detail.ÖzetBu makalede, Abdülganî Nablusî’nin (ö.1143/1730 gözetiminde yetişen, halvetî-Şabânî şeyhi Abdullatîf b. Hüsameddîn el-Halebî’ye intisap eden Mustafa Kemaleddin Bekrî’nin hayatı ve eserleri incelenmiştir. Bu çerçevede onun tasavvufi bir kavram olan halvetin âdab ve şartlarını izah eden “Hediyyetü’l ahbâb fî mâ li’l-halveti mine’ş-şurûti ve’l-âdâb” adlı risalesinin incelenmesi ve değerlendirmesi üzerinde durulmuştur. Söz konusu eser, mukaddime sekiz bölüm ve bir hatimeden oluşmaktadır.Le Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî et son Traité qui s’intitule Hadiyya al-ahbâbRésuméDans cet article, on va étudier d’abord la vie et les œuvres du Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî qui a été éduqué par le célèbre soufi ‘Abd al-Ghanî Nablûsî (m. 1143/1730 et a été initié par ‘Abd al-Latîf b. Husâm al-Dîn al-Halabî. Puis, plus particulièrement, on va analyser son traité qui s’intitule ‘Hadiyya al-ahbâb fî mâ li’l-khalwatî min al-shurût wa’l-âdâb’. Ce traité – qui a été composé de dix-huit chapitres et d’une conclusion – étudie les convenances et les conditions de la retraite spirituelle, khalwa, une des notions soufies importantes
International Nuclear Information System (INIS)
Ford, B. H.
1999-01-01
This report describes the fiscal year (FY) 1999 field activities associated with installing 12 groundwater monitoring wells in the vicinity of the 100-D Area chromium plume west of the 100-D/DR Reactors (100-HR-3 Operable Unit [OU]). The wells were installed to further investigate the extent of the hexavalent chromium hot spot west of the 100-D/DR Reactors and to support future remedial action decisions associated with the 100-HR-3 OU. These wells were designed for multi-purpose use (i.e., monitoring, extraction, and injection). In addition, one of the wells was installed to support the initial deployment of the In Situ Redox Manipulation (ISRM) technology to remediate the chromium plume
UV/Fenton photo-oxidation of Drimarene Dark Red (DDR) containing textile-dye wastewater
Hudaya, T.; Anthonios, J.; Septianto, E.
2016-11-01
Textile dye wastewater contains organic pollutants which are non-biodegradable, characterized by low BOD/COD ratio of typically Advanced Oxidation Processes (AOPs). One of the AOPs method which is the UV/H2O2/Fe2+ (or UV/Fenton) offers not only relatively low cost but also quite effective (in terms of color removal and reaction time) treatment. This particular research aimed to optimize the conditions of UV/Fenton photo-oxidation process for Drimarene Dark Red containing textile- dye wastewater. The two main operating conditions to be optimized were the initial concentration of H2O2 ranged between 0.022-0.078 %-w and the mol ratio of Fe2+: H2O2 was varied from 1: 13 up to 1: 45, using the Central Composite Design experimental matrix. The photo-oxidation was carried out at the optimum pH of 3 from some previous experiments. The best processing conditions of the photo-oxidation of Drimarene Dark Red (DDR) were found at the initial concentration of H2O2 at 0.050%-w and the mole ratio Fe2+: H2O2 of 1: 22. Under these conditions, the measured 2nd order pseudo-rate constantwas 0.021 M-1.min-1. The DDR color removal of 90% was surprisingly achievable within only 10 minutes reaction time.
Hemoglobin is essential for normal growth of Arabidopsis organs
DEFF Research Database (Denmark)
Hebelstrup, Kim Henrik; Hunt, Peter; Dennis, Elizabeth
2006-01-01
In Arabidopsis thaliana, the class I hemoglobin AHb1 is transiently expressed in the hydathodes of leaves and in floral buds from young inflorescences. Nitric oxide (NO) accumulates to high levels in these organs when AHb1 is silenced, indicating an important role in metabolizing NO. AHb1-silenced...... lines are viable but show a mutant phenotype affecting the regions where AHb1 is expressed. Arabidopsis lines with an insertional knockout or overexpression of AHb2, a class II 3-on-3 hemoglobin, were generated. Seedlings overexpressing AHb2 show enhanced survival of hypoxic stress. The AHb2 knockout...... lines develop normally. However, when AHb2 knockout is combined with AHb1 silencing, seedlings die at an early vegetative stage suggesting that the two 3-on-3 hemoglobins, AHb1 and AHb2, together play an essential role for normal development of Arabidopsis seedlings. In conclusion, these results...
Directory of Open Access Journals (Sweden)
Eva Kaufmann
2001-11-01
Full Text Available Seit den 1960er Jahren produzierten Schriftstellerinnen in der DDR wie Christa Wolf, Irmtraud Morgner, Sarah Kirsch, Brigitte Reimann, Charlotte Worgitzky, Lia Pirskawetz, und Maya Wiens eine vielfältige Literatur zu frauenrelevanten Themen. Den Obertitel „The Promised Land“ (das gelobte Land hat Lorna Martens Irmtraud Morgner entlehnt, der Autorin, die sie neben Christa Wolf als wichtigste Zeugin für „feminist writing“ in der DDR betrachtet. In Morgners Roman Leben und Abenteuer der Trobadora Beatriz steht der Begriff „gelobtes Land“ bezogen auf die DDR in einem ironischen Zusammenhang. Mit simplem Jaja oder Neinnein ist diesem „Ort des Wunderbaren“ (Morgner nicht beizukommen. Vergleichbares signalisiert auch das Fragezeichen, das Martens hinter den Begriff „Promised Land“ setzt. Der anspielungsreiche Verweis auf das Land erscheint auch insofern nützlich, als die Eigenart feministischen Schreibens genauer zu fassen ist, wenn über das Land selbst, namentlich seine Frauenpolitik, Auskünfte gegeben werden. Lorna Martens möchte herausfinden, wie Schriftstellerinnen in der DDR feministisches Bewusstsein artikuliert haben, d.h. feministisches Bewusstsein unter den vom Staatssozialismus geschaffenen Bedingungen.From the 1960s on, women writers in the German Democratic Republic (GDR, including Christa Wolf, Irmtraud Morgner, Sarah Kirsch, Brigitte Reimann, Charlotte Worgitzky, Lia Pirskawetz, and Maya Wiens, produced a large body of writing on women’s issues. Martens wants to investigate how these women authors in the GDR have articulated their feminist consciousness under the conditions of state socialism. Martens’ use of the title The Promised Land is an allusion to a book by Irmtraud Morgner, an author whom, along with Christa Wolf, Martens considers one of the most important witnesses of feminist writing in the GDR. In Morgner’s book The Life and Adventures of Troubadour Beatriz the term “promised land” is being
Experimental study on heavy-ion single event effect on nanometer DDR SRAM
International Nuclear Information System (INIS)
Luo Yinhong; Zhang Fengqi; Guo Hongxia; Zhou Hui; Wang Yanping; Zhang Keying
2013-01-01
Single event effect experimental study on 90 nm and 65 nm DDR SRAM were carried out, single event upset (SEU) cross section was discussed as a function of several parameters such as feature size, test pattern, incidence angle, supply voltage. Key influence factors and effect rule were analyzed. Feasibility of the current test method was discussed. Results indicate that, SEU cross section reduces as technologies scale down; the influence of test pattern and power supply on SEU cross section is small; tilt angle increases SEU cross section due to multiple upset increasement. The applicability of cosine tilt test method is correlative to ion species and linear energy transfer (LET) values. (authors)
Technical basis for the ITER detailed design report, cost review and safety analysis (DDR)
International Nuclear Information System (INIS)
1997-01-01
The ITER Detailed Design Report (DDR), Cost Review and Safety Analysis is the 3rd major milestone representing the progress made in the ITER Engineering Design Activities. With the approval of the Interim Design Report (IDR), it has been possible to freeze the main concepts and system approaches for ITER and to develop the design in more detail for the individual components and sub-systems. This report, although designed to be fully understandable as a separate document, focusses particularly on the main changes since the IDR
Waste Management Plan for the Drilling Within the Chromium Plume West of 100-D/DR Reactors
International Nuclear Information System (INIS)
R.E. Peterson
1997-01-01
This waste management plan provides guidance for managing drilling spoils generated during the installation of groundwater wells in the 100-D/DR Area, which is part of the 100-HR-3 Operable Unit. The wells are being installed to meet two objectives: (1) better define the nature and extent of a previously identified chromium plume in the area, and (2) act as groundwater extraction wells if the contamination warrants
Weibliche Arbeitserfahrungen in der DDR Women’s Work experiences in the GDR
Directory of Open Access Journals (Sweden)
Albrecht Wiesener
2001-11-01
Full Text Available Annegret Schüle kommt in ihrer Untersuchung zu dem Ergebnis, dass die DDR-Diktatur das Leben von Frauen mehr veränderte als das der Männer. Ihre auf Interviews basierende Untersuchung fokussiert den (Berufs-Alltag von Frauen in der Leipziger Baumwollspinnerei. Anhand der drei Kategorien „Generation“, „Frauenarbeit“ und „Vergemeinschaftung im Betrieb“ diskutiert sie die geführten Interviews , die Förderung weiblicher Erwerbstätiger einerseits und das Negativimage des Textilbetriebs andererseits. Die Autorin legt eine überzeugende Studie zur Erfahrungsgeschichte weiblicher Industriearbeit vor und zeigt am konkreten Beispiel, wie die DDR-Gesellschaft in einer von Frauen getragenen familiarisierten Betriebskultur nicht aufgebrochen, sondern in einer eigentümlichen Verbindung von Geborgenheit und Unterordnung reproduziert wurde.Schüle argues that the Eastern German dictatorship had a greater impact on the lives of women than on those of their male counterparts. Her research, based on interviews with female workers in a in a cotton-spinning factory in Leipzig, portrays women’s everyday-life and work, and offers a convincing study of the experience of female industrial workers. Using the three categories “cohort,” “women’s work,” and a discourse of “factory-as-community,” Schüle discusses her interviews with respect to the promotion of female textile workers on the one hand and the negative stereotypes associated with working in the textile industry on the other hand. Using concrete examples, Schüle demonstrates how a factory organised by women did not undermine the patriarchal frame in which it was embedded but how existing power differentials were reproduced as part of a discourse of family, security, and subordination.
Technical basis for the ITER detailed design report, cost review and safety analysis (DDR)
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
The ITER Detailed Design Report (DDR), Cost Review and Safety Analysis is the 3rd major milestone representing the progress made in the ITER Engineering Design Activities. With the approval of the Interim Design Report (IDR), it has been possible to freeze the main concepts and system approaches for ITER and to develop the design in more detail for the individual components and sub-systems. This report, although designed to be fully understandable as a separate document, focusses particularly on the main changes since the IDR. Refs, figs, tabs
Hemoglobin is essential for normal growth of Arabidopsis organs
DEFF Research Database (Denmark)
Hebelstrup, Kim Henrik; Hunt, Peter; Dennis, Elizabeth
2006-01-01
In Arabidopsis thaliana, the class I hemoglobin AHb1 is transiently expressed in the hydathodes of leaves and in floral buds from young inflorescences. Nitric oxide (NO) accumulates to high levels in these organs when AHb1 is silenced, indicating an important role in metabolizing NO. AHb1-silence...... suggests that 3-on-3 hemoglobins apart from a role in hypoxic stress play a general role under non-stressed conditions where they are essential for normal development by controlling the level of NO which tends to accumulate in floral buds and leaf hydathodes of plants......In Arabidopsis thaliana, the class I hemoglobin AHb1 is transiently expressed in the hydathodes of leaves and in floral buds from young inflorescences. Nitric oxide (NO) accumulates to high levels in these organs when AHb1 is silenced, indicating an important role in metabolizing NO. AHb1-silenced...... lines are viable but show a mutant phenotype affecting the regions where AHb1 is expressed. Arabidopsis lines with an insertional knockout or overexpression of AHb2, a class II 3-on-3 hemoglobin, were generated. Seedlings overexpressing AHb2 show enhanced survival of hypoxic stress. The AHb2 knockout...
Energy Technology Data Exchange (ETDEWEB)
Chen, Xiaowen; Jennings, Ed; Shekiro, Joe; Kuhn, Erik M.; O' Brien, Marykate; Wang, Wei; Schell, Daniel J.; Himmel, Mike; Elander, Richard T.; Tucker, Melvin P.
2015-04-03
Distilling and purifying ethanol, butanol, and other products from second and later generation lignocellulosic biorefineries adds significant capital and operating cost for biofuels production. The energy costs associated with distillation affects plant gate and life cycle analysis costs. Lower titers in fermentation due to lower sugar concentrations from pretreatment increase both energy and production costs. In addition, higher titers decrease the volumes required for enzymatic hydrolysis and fermentation vessels. Therefore, increasing biofuels titers has been a research focus in renewable biofuels production for several decades. In this work, we achieved over 200 g/L of monomeric sugars after high solids enzymatic hydrolysis using the novel deacetylation and disc refining (DDR) process on corn stover. The high sugar concentrations and low chemical inhibitor concentrations from the DDR process allowed ethanol titers as high as 82 g/L in 22 hours, which translates into approximately 10 vol% ethanol. To our knowledge, this is the first time that 10 vol% ethanol in fermentation derived from corn stover without any sugar concentration or purification steps has been reported. Techno-economic analysis shows the higher titer ethanol achieved from the DDR process could significantly reduce the minimum ethanol selling price from cellulosic biomass.
Smith, S.T.; Sherrington, C.; Studenski, S.A.; Schoene, D.; Lord, S.R.
2011-01-01
OBJECTIVE: This series of studies was conducted to develop and establish characteristics of exercise videogame play in older adults. The videogame was a modified version of the popular Dance Dance Revolution (DDR; Konomi). METHODS: Participants aged >/=70 were asked to make simple step movements in
Egan, Jan B.; Barrett, Michael T.; Champion, Mia D.; Middha, Sumit; Lenkiewicz, Elizabeth; Evers, Lisa; Francis, Princy; Schmidt, Jessica; Shi, Chang-Xin; Van Wier, Scott; Badar, Sandra; Ahmann, Gregory; Kortuem, K. Martin; Boczek, Nicole J.; Fonseca, Rafael; Craig, David W.; Carpten, John D.; Borad, Mitesh J.; Stewart, A. Keith
2014-01-01
Liposarcoma is the most common soft tissue sarcoma, but little is known about the genomic basis of this disease. Given the low cell content of this tumor type, we utilized flow cytometry to isolate the diploid normal and aneuploid tumor populations from a well-differentiated liposarcoma prior to array comparative genomic hybridization and whole genome sequencing. This work revealed massive highly focal amplifications throughout the aneuploid tumor genome including MDM2, a gene that has previously been found to be amplified in well-differentiated liposarcoma. Structural analysis revealed massive rearrangement of chromosome 12 and 11 gene fusions, some of which may be part of double minute chromosomes commonly present in well-differentiated liposarcoma. We identified a hotspot of genomic instability localized to a region of chromosome 12 that includes a highly conserved, putative L1 retrotransposon element, LOC100507498 which resides within a gene cluster (NAV3, SYT1, PAWR) where 6 of the 11 fusion events occurred. Interestingly, a potential gene fusion was also identified in amplified DDR2, which is a potential therapeutic target of kinase inhibitors such as dastinib, that are not routinely used in the treatment of patients with liposarcoma. Furthermore, 7 somatic, damaging single nucleotide variants have also been identified, including D125N in the PTPRQ protein. In conclusion, this work is the first to report the entire genome of a well-differentiated liposarcoma with novel chromosomal rearrangements associated with amplification of therapeutically targetable genes such as MDM2 and DDR2. PMID:24505276
Directory of Open Access Journals (Sweden)
Jan B Egan
Full Text Available Liposarcoma is the most common soft tissue sarcoma, but little is known about the genomic basis of this disease. Given the low cell content of this tumor type, we utilized flow cytometry to isolate the diploid normal and aneuploid tumor populations from a well-differentiated liposarcoma prior to array comparative genomic hybridization and whole genome sequencing. This work revealed massive highly focal amplifications throughout the aneuploid tumor genome including MDM2, a gene that has previously been found to be amplified in well-differentiated liposarcoma. Structural analysis revealed massive rearrangement of chromosome 12 and 11 gene fusions, some of which may be part of double minute chromosomes commonly present in well-differentiated liposarcoma. We identified a hotspot of genomic instability localized to a region of chromosome 12 that includes a highly conserved, putative L1 retrotransposon element, LOC100507498 which resides within a gene cluster (NAV3, SYT1, PAWR where 6 of the 11 fusion events occurred. Interestingly, a potential gene fusion was also identified in amplified DDR2, which is a potential therapeutic target of kinase inhibitors such as dastinib, that are not routinely used in the treatment of patients with liposarcoma. Furthermore, 7 somatic, damaging single nucleotide variants have also been identified, including D125N in the PTPRQ protein. In conclusion, this work is the first to report the entire genome of a well-differentiated liposarcoma with novel chromosomal rearrangements associated with amplification of therapeutically targetable genes such as MDM2 and DDR2.
Description of work for the drilling within the chromium plume west of 100-D/DR Reactors
International Nuclear Information System (INIS)
Peterson, R.E.; Walker, L.D.
1997-07-01
This document describes the work scope associated with installing four new monitoring wells in the 100-D/DR Area (100-HR-3 Operable Unit). The strategy relies on estimates for flow paths that might have existed during operation of the 100-D Reactor and on experience gained during the recent installation of well 199-D4-1. A Data Quality Objectives (DQO) workshop was held to evaluate data collection needs during well installation. The workshop included input from key project team members and the lead regulatory agency. Decisions concerning data resulting from the DQO process have been incorporated into this document
Comparative Analysis of Liver Injury-Associated Cytokines in Acute Hepatitis A and B.
Shin, So Youn; Jeong, Sook-Hyang; Sung, Pil Soo; Lee, Jino; Kim, Hyung Joon; Lee, Hyun Woong; Shin, Eui-Cheol
2016-05-01
Acute hepatitis A (AHA) and acute hepatitis B (AHB) are caused by an acute infection of the hepatitis A virus and the hepatitis B virus, respectively. In both AHA and AHB, liver injury is known to be mediated by immune cells and cytokines. In this study, we measured serum levels of various cytokines and T-cell cytotoxic proteins in patients with AHA or AHB to identify liver injury-associated cytokines. Forty-six patients with AHA, 16 patients with AHB, and 14 healthy adults were enrolled in the study. Serum levels of 17 cytokines and T-cell cytotoxic proteins were measured by enzyme-linked immunosorbent assays or cytometric bead arrays and analyzed for correlation with serum alanine aminotransferase (ALT) levels. Interleukin (IL)-18, IL-8, CXCL9, and CXCL10 were significantly elevated in both AHA and AHB. IL-6, IL-22, granzyme B, and soluble Fas ligand (sFasL) were elevated in AHA but not in AHB. In both AHA and AHB, the serum level of CXCL10 significantly correlated with the peak ALT level. Additionally, the serum level of granzyme B in AHA and the serum level of sFasL in AHB correlated with the peak ALT level. We identified cytokines and T-cell cytotoxic proteins associated with liver injury in AHA and AHB. These findings deepen the existing understanding of immunological mechanisms responsible for liver injury in acute viral hepatitis.
International Nuclear Information System (INIS)
Wu Ming-Zhong; Bai Cheng-Ming
2015-01-01
A compatible Lie algebra is a pair of Lie algebras such that any linear combination of the two Lie brackets is a Lie bracket. We construct a bialgebra theory of compatible Lie algebras as an analogue of a Lie bialgebra. They can also be regarded as a “compatible version” of Lie bialgebras, that is, a pair of Lie bialgebras such that any linear combination of the two Lie bialgebras is still a Lie bialgebra. Many properties of compatible Lie bialgebras as the “compatible version” of the corresponding properties of Lie bialgebras are presented. In particular, there is a coboundary compatible Lie bialgebra theory with a construction from the classical Yang–Baxter equation in compatible Lie algebras as a combination of two classical Yang–Baxter equations in Lie algebras. Furthermore, a notion of compatible pre-Lie algebra is introduced with an interpretation of its close relation with the classical Yang–Baxter equation in compatible Lie algebras which leads to a construction of the solutions of the latter. As a byproduct, the compatible Lie bialgebras fit into the framework to construct non-constant solutions of the classical Yang–Baxter equation given by Golubchik and Sokolov. (paper)
Ledyard, John O.
1987-01-01
Incentive compatibility is described and discussed. A summary of the current state of understanding is provided. Key words are: incentive compatibility, game theory, implementation, mechanism, Bayes, Nash, and revelation.
A variant reference data set for the Africanized honeybee, Apis mellifera.
Kadri, Samir M; Harpur, Brock A; Orsi, Ricardo O; Zayed, Amro
2016-11-08
The Africanized honeybee (AHB) is a population of Apis mellifera found in the Americas. AHBs originated in 1956 in Rio Clara, Brazil where imported African A. m. scutellata escaped and hybridized with local populations of European A. mellifera. Africanized populations can now be found from Northern Argentina to the Southern United States. AHBs-often referred to as 'Killer Bees'- are a major concern to the beekeeping industry as well as a model for the evolutionary genetics of colony defence. We performed high coverage pooled-resequencing of 360 diploid workers from 30 Brazilian AHB colonies using Illumina Hi-Seq (150 bp PE). This yielded a high density SNP data set with an average read depth at each site of 20.25 reads. With 3,606,720 SNPs and 155,336 SNPs within 11,365 genes, this data set is the largest genomic resource available for AHBs and will enable high-resolution studies of the population dynamics, evolution, and genetics of this successful biological invader, in addition to facilitating the development of SNP-based tools for identifying AHBs.
ATCA/AXIe compatible board for fast control and data acquisition in nuclear fusion experiments
International Nuclear Information System (INIS)
Batista, A.J.N.; Leong, C.; Bexiga, V.; Rodrigues, A.P.; Combo, A.; Carvalho, B.B.; Fortunato, J.; Correia, M.; Teixeira, J.P.; Teixeira, I.C.; Sousa, J.; Gonçalves, B.; Varandas, C.A.F.
2012-01-01
Highlights: ► High performance board for fast control and data acquisition. ► Large IO channel number per board with galvanic isolation. ► Optimized for high reliability and availability. ► Targeted for nuclear fusion experiments with long duration discharges. ► To be used on the ITER Fast Plant System Controller prototype. - Abstract: An in-house development of an Advanced Telecommunications Computing Architecture (ATCA) board for fast control and data acquisition, with Input/Output (IO) processing capability, is presented. The architecture, compatible with the ATCA (PICMG 3.4) and ATCA eXtensions for Instrumentation (AXIe) specifications, comprises a passive Rear Transition Module (RTM) for IO connectivity to ease hot-swap maintenance and simultaneously to increase cabling life cycle. The board complies with ITER Fast Plant System Controller (FPSC) guidelines for rear IO connectivity and redundancy, in order to provide high levels of reliability and availability to the control and data acquisition systems of nuclear fusion devices with long duration plasma discharges. Simultaneously digitized data from all Analog to Digital Converters (ADC) of the board can be filtered/decimated in a Field Programmable Gate Array (FPGA), decreasing data throughput, increasing resolution, and sent through Peripheral Component Interconnect (PCI) Express to multi-core processors in the ATCA shelf hub slots. Concurrently the multi-core processors can update the board Digital to Analog Converters (DAC) in real-time. Full-duplex point-to-point communication links between all FPGAs, of peer boards inside the shelf, allow the implementation of distributed algorithms and Multi-Input Multi-Output (MIMO) systems. Support for several timing and synchronization solutions is also provided. Some key features are onboard ADC or DAC modules with galvanic isolation, Xilinx Virtex 6 FPGA, standard Dual Data Rate (DDR) 3 SODIMM memory, standard CompactFLASH memory card, Intelligent
El-Registan, G. I.; Mulyukin, A. L.; Nikolaev, Yu. A.; Stepanenko, I. Yu.; Shanenko, E. A.; Strakhovskaya, M. G.; Revina, A. A.
Low-molecular-weight cell-to-cell communication factors are produced by various pro- and eukaryotes and involved in autoregulation of the growth and development of microbial cultures. As for some bacterial and yeast species, these factors were identified as isomers and homologs of alkylhydroxybenzenes (AHBs). Depending on the concentration, they participate in controlling the transition to stationary phase, entering the resting state, and stress resistance of vegetative cells to gamma-irradiation, photooxidation (singlet oxygen), heat shock. Chemical analogs of microbial AHBs protected microbial cultures from stressful situations and prolonged starvation and exerted (1) the stabilizing activity toward biomacromolecules and supermolecular structures (cell membranes) and (2) the ability to scavenge active oxygen species. The stabilizing effect of AHBs as chemical chaperones resulted from their complex formation with protected macromolecules due to intermolecular hydrogen bonds, hydrophobic and electrostatic interactions and was demonstrated on models of individual enzymes (trypsin, amylase, etc.). The action of AHBs as active oxygen species scavengers was related to their oxidative conversion to water-insoluble polymeric products. Particularly, AHBs protected the yeast from the action of (a) active oxygen species formed during gamma-irradiation (50 krad, 196 rad/sec) or (b) singlet oxygen generated in cells photosensitized by chlorin e6 (10 mkg/L). It is important that microbial AHBs were not species-specific and defended cultured animal cells (ras-transformed fibroblasts) from the action of organic toxicants. The use of AHBs as protectants and adaptogens will be discussed as well as perspectives of further investigations.
El-Registan, Galina I.; Mulyukin, Andrey L.; Nikolaev, Yuri A.; Stepanenko, Irina Yu.; Kozlova, Alla N.; Martirosova, Elena I.; Shanenko, Elena F.; Strakhovskaya, Marina G.; Revina, Aleksandra A.
Low-molecular-weight cell-to-cell communication factors are produced by various pro- and eukaryotes and involved in autoregulation of the growth and development of microbial cultures. As for some bacterial and yeast species, these factors were identified as isomers and homologues of alkylhydroxybenzenes (AHB). Depending on the concentration, they participate in controlling the transition to stationary phase, entering the resting state, and stress resistance of vegetative cells to gamma-irradiation, photooxidation (singlet oxygen), and heat shock. Chemical analogues of microbial AHB protected microbial cultures from stressful situations and exerted (1) the stabilizing activity toward macromolecules and (2) the ability to scavenge active oxygen species. The stabilizing effect of AHBs resulted from their complex formation with protected macromolecules due to intermolecular hydrogen bonds, hydrophobic and electrostatic interactions and was demonstrated on models of individual enzymes (trypsin). Particularly, AHBs protected the yeast from the action of (a) active oxygen species formed during gamma-irradiation (500 Gy, 1.96 Gy/s) or (b) singlet oxygen generated in cells photosensitized by chlorin e 6 (10 μg/L). It is important that microbial AHBs were not species-specific and defended cultured microbial and animal cells from the action of organic toxicants. The use of AHBs as protectants and adaptogens is discussed as well as perspectives of further investigations.
Han, Y-N
2009-01-01
This study aimed to identify acute self-limited hepatitis B (ASL-HB) among patients presenting with hepatitis B virus (HBV)-related acute hepatitis. Data were available for 220 patients diagnosed with HBV-related acute hepatitis, of whom 164 had acute hepatitis B (AHB). Of these, 160 were confirmed as ASL-HB: three (1.9%) evolved to chronic hepatitis B and one (0.6%) developed fulminant hepatitis and died. Comparisons were also made between AHB and acute infections with hepatitis A (HA) and hepatitis E (HE) viruses. During the study period, the number of patients with AHB exceeded the sum of those with acute HA and acute HE infections. There was no distinct seasonal peak for AHB infection, whereas both acute HA and acute HE infections occurred more frequently in the spring. Clinical symptoms and physical signs were similar for all three types of hepatitis, but significant differences were seen in some biochemical parameters. In conclusion, this study suggests that symptomatic AHB is not rare in China but it seldom evolves to chronic hepatitis B.
NITRITE REDUCTASE ACTIVITY OF NON-SYMBIOTIC HEMOGLOBINS FROM ARABIDOPSIS THALIANA†
Tiso, Mauro; Tejero, Jesús; Kenney, Claire; Frizzell, Sheila; Gladwin, Mark T.
2013-01-01
Plant non-symbiotic hemoglobins possess hexa-coordinate heme geometry similar to the heme protein neuroglobin. We recently discovered that deoxygenated neuroglobin converts nitrite to nitric oxide (NO), an important signaling molecule involved in many processes in plants. We sought to determine whether Arabidopsis thaliana non-symbiotic hemoglobins class 1 and 2 (AHb1 and AHb2) might function as nitrite reductases. We found that the reaction of nitrite with deoxygenated AHb1 and AHb2 generates NO gas and iron-nitrosyl-hemoglobin species. The bimolecular rate constants for nitrite reduction to NO are 19.8 ± 3.2 and 4.9 ± 0.2 M−1s−1, at pH = 7.4 and 25°C, respectively. We determined the pH dependence of these bimolecular rate constants and found a linear correlation with the concentration of protons, indicating the requirement for one proton in the reaction. Release of free NO gas during reaction in anoxic and hypoxic (2% oxygen) conditions was confirmed by chemiluminescence detection. These results demonstrate that deoxygenated AHb1 and AHb2 reduce nitrite to form NO via a mechanism analogous to that observed for hemoglobin, myoglobin and neuroglobin. Our findings suggest that during severe hypoxia and in the anaerobic plant roots, especially in water submerged species, non-symbiotic hemoglobins provide a viable pathway for NO generation via nitrite reduction. PMID:22620259
Directory of Open Access Journals (Sweden)
Liu Bo
2011-05-01
Full Text Available Abstract Background The goal of this study is to observe changes in HBcAg-specific cytotoxic T lymphocytes (CTLs, natural killer (NK and natural killer T (NKT cells from peripheral blood and to relate such changes on viral clearance and liver injury in patients with acute hepatitis B (AHB. Methods Dynamic profiles on the frequency of HLA-A0201-restricted HBcAg18-27 pentamer complex (MHC-Pentamer-specific CTLs and lymphocyte subsets in AHB patients were analyzed in addition to liver function tests, HBV serological markers, and HBV DNA levels. ELISPOT was used to detect interferon-gamma (INF-γ secretion in specific CTLs stimulated with known T cell epitope peptides associated with HBV surface protein, polymerase, and core protein. Results HBV-specific CTL frequencies in AHB patients were much higher than in patients with chronic hepatitis B (CHB (p +CD8+ T cell numbers in AHB patients was more than observed in the healthy control group from the first to the fourth week after admission (p = 0.008 and 0.01, respectively; the number of CD3+CD8+ T cells and frequency of HBcAg18-27-specific CTLs in AHB patients reached peak levels at the second week after admission. NK and NKT cell numbers were negatively correlated with the frequency of HBcAg-specific CTLs (r = -0.266, p = 0.05. Conclusions Patients with AHB possess a higher frequency of HBcAg-specific CTLs than CHB patients. The frequency of specific CTLs in AHB patients is correlated with HBeAg clearance indicating that HBV-specific CTLs play an important role in viral clearance and the self-limited process of the disease. Furthermore, NK and NKT cells are likely involved in the early, non-specific immune response to clear the virus.
Directory of Open Access Journals (Sweden)
A. Acharyya
2014-06-01
Full Text Available The optimum position of the optical window (OW of illuminated lateral double-drift region (DDR impact avalanche transit time (IMPATT device has been determined subject to achieve the finest optical control of both DC and RF properties of the device. The OW is a tiny hole that has to be created on the oxide layer through which the light energy of appropriate wavelength can be coupled to the space charge region of the device. A non-sinusoidal voltage is assumed to be applied across the diode and the corresponding terminal current response is obtained from a two-dimensional (2-D large-signal (L-S simulation technique developed by the authors for illuminated lateral DDR IMPATT diode. Both the DC and L-S properties of the illuminated device based on Si, designed to operate at W-band frequencies (75 – 110 GHz are obtained from the said L-S simulation. Simulation is carried out for different incident optical power levels of different wavelengths (600 – 1000 nm by varying the position of the fixed sized OW on the oxide layer along the direction of electrical conduction of the device. Results show that, the most favorable optical tuning can be achieved when the OW is entirely created over the p-type depletion layer, i.e. when the photocurrent is purely electron dominated. Also the 700 nm wavelength is found to be most suitable wavelength for obtaining the maximum optical modulation of both DC and RF properties of the device.
The homeostasis solution – Mechanical homeostasis in architecturally homeostatic buildings
International Nuclear Information System (INIS)
Wang, Lin-Shu; Ma, Peizheng
2016-01-01
Highlights: • Architectural homeostatic buildings (AHBs) make sense because of the laws of physics. • However, high efficiency can be obtained only with AHBs and equipment considered as systems. • Mechanical homeostasis facilitates AHB-equipment system synergy with heat extraction. • Entropically speaking a building needs neither energy nor a fixed amount of heat, but its homeostatic existence. • Homeostatic buildings can reduce building energy consumption from 80% to 90%. - Abstract: We already know, for energy-saving potential, the necessary architectural features in well-designed buildings: high performance building envelope, sufficient interior thermal mass, and hydronic-network activated radiant surfaces for cooling and heating. Buildings with these features may be referred to as architecturally homeostatic buildings (AHBs); such a building-system is thermally semi-autonomous in the sense that its temperature variation stays within a certain range even without conditioning equipment, and, with conditioning equipment in operation, its thermal regulation is handled by its hydronic heat-distribution-network for controlling the temperature level of the building. At the present time conventional HVAC equipment is used for maintaining the heat-distribution-network: this arrangement, however, has resulted in great energy saving only for AHBs with accessible natural water bodies. In operation of general AHBs, a case is made here for a new kind of mechanical equipment having the attribute of mechanical homeostasis (MH). MH is a new energy transformation concept in a triadic framework. Superlative energy efficiency is predicted as a result of combined improvements in higher triadCOPs and lower total (inducted + removed) heat rates—evincing existence of synergy in architectural and mechanical homeostasis, which together will be referred to as the homeostasis solution.
Behmer, Lawrence P; Fournier, Lisa R
2016-11-01
Questions regarding the malleability of the mirror neuron system (MNS) continue to be debated. MNS activation has been reported when people observe another person performing biological goal-directed behaviors, such as grasping a cup. These findings support the importance of mapping goal-directed biological behavior onto one's motor repertoire as a means of understanding the actions of others. Still, other evidence supports the Associative Sequence Learning (ASL) model which predicts that the MNS responds to a variety of stimuli after sensorimotor learning, not simply biological behavior. MNS activity develops as a consequence of developing stimulus-response associations between a stimulus and its motor outcome. Findings from the ideomotor literature indicate that stimuli that are more ideomotor compatible with a response are accompanied by an increase in response activation compared to less compatible stimuli; however, non-compatible stimuli robustly activate a constituent response after sensorimotor learning. Here, we measured changes in the mu-rhythm, an EEG marker thought to index MNS activity, predicting that stimuli that differ along dimensions of ideomotor compatibility should show changes in mirror neuron activation as participants learn the respective stimulus-response associations. We observed robust mu-suppression for ideomotor-compatible hand actions and partially compatible dot animations prior to learning; however, compatible stimuli showed greater mu-suppression than partially or non-compatible stimuli after explicit learning. Additionally, non-compatible abstract stimuli exceeded baseline only after participants explicitly learned the motor responses associated with the stimuli. We conclude that the empirical differences between the biological and ASL accounts of the MNS can be explained by Ideomotor Theory. © 2016 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.
Vogel, Pieter Johannes
2011-01-01
Met toepassing van de sociaal-constructivistische theorie van Wendt en de neo-institutionele theorie van Sabatier e.a. onderzocht Peter Vogel de situatie binnen het Politbüro en de regering in de nadagen (1985- 1989) van de DDR. Hij keek daarbij in hoeverre en in welke mate mentale constructies,
Electromagnetic Compatibility Design of the Computer Circuits
Zitai, Hong
2018-02-01
Computers and the Internet have gradually penetrated into every aspect of people’s daily work. But with the improvement of electronic equipment as well as electrical system, the electromagnetic environment becomes much more complex. Electromagnetic interference has become an important factor to hinder the normal operation of electronic equipment. In order to analyse the computer circuit compatible with the electromagnetic compatibility, this paper starts from the computer electromagnetic and the conception of electromagnetic compatibility. And then, through the analysis of the main circuit and system of computer electromagnetic compatibility problems, we can design the computer circuits in term of electromagnetic compatibility. Finally, the basic contents and methods of EMC test are expounded in order to ensure the electromagnetic compatibility of equipment.
Role of value compatibility in IT adoption
DEFF Research Database (Denmark)
Bunker, Deborah; Kautz, Karlheinz; Nguyen, Anne Luu Thanh
2007-01-01
Compatibility has been recognised as an important element in the adoption of IT innovations in organisations but as a concept it has been generally limited to technical or functional factors. Compatibility is also significant, however, with regard to value compatibility between the organisation......, and the adopted IT innovation. We propose a framework to determine value compatibility analysing the organisation's and information system's structure, practices and culture, and explore the value compatibility of an organisation with its adopted self-service computer-based information system. A case study......-service acceptance and training issues experienced by the case organisation. These findings add insight into the problems experienced with value compatibility and the adoption of the information systems, and show the potential use of the proposed framework in the detection of such problems.Journal of Information...
Socio-compatible energy policies
International Nuclear Information System (INIS)
Renn, O.; Albrecht, G.; Kotte, U.; Peters, H.P.; Stegelmann, H.U.
1985-01-01
The socio-compatibility project comprises three central analytical elements: 1) The arborescent value analysis: Eminent social groups (such as the trade-unions or the ecological institutes) were questioned on their values and criteria applied to evaluate different energy systems. 2) The energy system and scenario impact analysis: Indicators deduced from the arborescent value analysis serve to approximately cover the value dimensions affected by above criteria. 3) Impact analysis weighing executed by a group of arbitrarily chosen citizens. All reflections considered, it is evident that none of the energy policies discussed may claim the title 'socio-compatible'. The individual, i.e. neither scientist nor politician, cannot decide upon the socio-compatibility of one or the other concept. An altogether socially compatible solution accepted and classified as such by different social groups may only crystallize and be set against different options by the political formation of opinion. The studys' primary concern lies in furnishing information, i.e. aids for politicians having to decide on energy policies. Above all the study aimed at finding out about reactions, social protest, opposition or approval to be coped with by those who, having the say in political matters, want to speak up for one of the energy policies under public discussion. (orig./HSCH) [de
Socially compatible technology management
International Nuclear Information System (INIS)
Tschiedel, R.
1989-01-01
The public has a critical eye on the impacts of technology, and there is a growing awareness of the social impacts in addition to health hazards and economic and ecologic impacts. 'Socially compatible technology management' is the magic formula frequently used which has emerged as a political demand in the course of the social controversy about the hazards of large-scale technology. It marks a position in the conflict between those who declare existing market and policy instruments to be sufficient regulatory tools, and those who understand the incidents ranging from inadequacy to desaster as a warning, and call for more precaution in decisions with an impact on the future. The concept of 'social compatibility' has to be given shape by elaborating criteria and methods for achieving this goal. The book shows that social compatibility cannot sufficiently be defined either as a quality of a technology and of a socio-technical system (acceptability), or as the willingness of the people concerned to accept a technology (acceptance). The investigation explains by means of empirical analysis and examples that participation is the only way to combine acceptability and acceptance into a socially compatibly designed technology. The leading theoretical and political formula developed for this purpose is 'acquisition'. To put it in a provocative way: Man has to learn to manage and master technical systems as if they were an integral part of themselves. Which means, man has to acquire the required knowledge and skill in the changing social structures, and the real power of disposal. Sociology of technology is a branch of research that can and should give support in the process of designing and managing technological systems in a way compatible with social needs. (orig./HP) [de
Inheritance of graft compatibility in Douglas fir.
D.L. Copes
1973-01-01
Graft compatibility of genetically related and unrelated rootstock-scion combinations was compared. Scion clones were 75% compatible when grafted on half-related rootstocks but only 56% compatible when grafted on unrelated rootstocks. Most variance associated with graft incompatibility in Douglas-fir appears to be caused by multiple genes.
Compatibility of Mating Preferences
Bingol, Haluk O.; Basar, Omer
2016-01-01
Human mating is a complex phenomenon. Although men and women have different preferences in mate selection, there should be compatibility in these preferences since human mating requires agreement of both parties. We investigate how compatible the mating preferences of men and women are in a given property such as age, height, education and income. We use dataset of a large online dating site (N = 44, 255 users). (i) Our findings are based on the "actual behavior" of users trying to find a dat...
Ion implantation and bio-compatibility
Energy Technology Data Exchange (ETDEWEB)
Suzuki, Yoshiaki; Kusakabe, Masahiro [Sony Corp., Tokyo (Japan). Corporate Research Labs.; Iwaki, Masaya
1992-07-01
Surface modification of polymers by ion implantation has been carried out to control surface properties such as conductivity, wettability, blood and tissue compatibility. Ion implantation into silicone rubber, polystyrene and segmented polyurethane was performed at 150 keV with doses ranging from 1 x 10[sup 15] to 3 x 10[sup 17] ions/cm[sup 2] to improve bio-compatibility. The platelet accumulation on ion implanted silicone rubber decreased and non-thrombogenicity of ion implanted specimens were improved. The ion implanted polystyrene and segmented polyurethane have been found to exhibit remarkably higher adhesion and spreading of endothelial cells compared to the non-implanted case. It is concluded that ion implantation into polymers is effective in controlling their bio-compatibility. (author).
Directory of Open Access Journals (Sweden)
Manuel Alberto Alonso Espinal
2008-07-01
Full Text Available El artículo realiza una descripción general y un balance del proceso de Desmovilización, Desarme y Reinserción (DDR de los bloques Cacique Nutibara y Héroes de Granada en la ciudad de Medellín. El primero, desmovilizado el 9 de diciembre de 2003, con 868 excombatientes y 467 armas entregadas; el segundo, el 1 de agosto de 2005, con 2.033 excombatientes y 1.120 armas entregadas. El artículo describe y analiza el proceso local, con base en las variables propuestas por Gleichman y su grupo de trabajo en el año de 2004, y lo contrapone con el nacional, a la vez que construye una serie hipótesis que se deben tener presentes a la hora de caracterizar la naturaleza del paramilitarismo en la ciudad. El resultado es un programa con fortalezas y logros, pero también con vacíos y limitaciones.This article carries out a general description and an overview of the processes of De-mobilization, Disarmament and Re-insertion (DDR in the Cacique Nutibara y Héroes de Granada blocks in the city of Medellín. The first of these areas, was demobilized December 9, 2003, with 868 ex-combatants and 467 weapons delivered; the second, August 1, 2005, with 2,033 ex-combatants and 1,120 weapons delivered. The article describes and analyzes the local processes, based on the variables proposed by Gleichman and his working group in the year 2004, it and contrasts them with the national one, at the same time building a series of hypotheses that should be kept in mind at the moment of characterizing the nature of para-militarism in the city. The result is a program with strengths and achievements, but also with empty spaces and limitations.
The Effect of Birth Order on Roommate Compatibility
Schuh, John H.; Williams, Ondre J.
1977-01-01
A group of students were matched on the basis of compatible birth order; another was matched on the basis of conflicting birth order. After a month's experience in a residence hall their compatibility was examined. Students with conflicting birth order were more compatible than those with the same birth order. (Author)
[Magnetic resonance compatibility research for coronary mental stents].
Wang, Ying; Liu, Li; Wang, Shuo; Shang, Ruyao; Wang, Chunren
2015-01-01
The objective of this article is to research magnetic resonance compatibility for coronary mental stents, and to evaluate the magnetic resonance compatibility based on laboratory testing results. Coronary stents magnetic resonance compatibility test includes magnetically induced displacement force test, magnetically induced torque test, radio frequency induced heating and evaluation of MR image. By magnetic displacement force and torque values, temperature, and image distortion values to determine metal coronary stent demagnetization effect. The methods can be applied to test magnetic resonance compatibility for coronary mental stents and evaluate its demagnetization effect.
Blood compatibility--a perspective.
Ratner, B D
2000-01-01
This perspective on blood- materials interactions is intended to introduce the set of papers stemming from the symposium, "Devices and Diagnostics in Contact with Blood: Issues in Blood Compatibility at the Close of the 20th Century," organized on August 4-6, 1999 at the University of Washington by the University of Washington Engineered Biomaterials (UWEB) Engineering Research Center. This article outlines some of the history of blood contacting materials, overviews the work that has originated at the University of Washington over the past 28 years, speculates on the origins of the controversies on blood compatibility and considers the issues that should be addressed in future studies.
Quadratic Poisson brackets compatible with an algebra structure
Balinsky, A. A.; Burman, Yu.
1994-01-01
Quadratic Poisson brackets on a vector space equipped with a bilinear multiplication are studied. A notion of a bracket compatible with the multiplication is introduced and an effective criterion of such compatibility is given. Among compatible brackets, a subclass of coboundary brackets is described, and such brackets are enumerated in a number of examples.
Tank Farm Waste Transfer Compatibility Program
International Nuclear Information System (INIS)
FOWLER, K.D.
2001-01-01
The compatibility program described in this document formalizes the process for determining waste compatibility. The primary goal of the program is to ensure that sufficient controls are in place to prevent the formation of incompatible mixtures during future operations. The process described involves characterizing waste, comparing characteristics with criteria, resolving potential incompatibilities and documenting the process
9 CFR 3.7 - Compatible grouping.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Compatible grouping. 3.7 Section 3.7... Cats 1 Animal Health and Husbandry Standards § 3.7 Compatible grouping. Dogs and cats that are housed...; (c) Puppies or kittens 4 months of age or less may not be housed in the same primary enclosure with...
Tank Farm Waste Transfer Compatibility Program
International Nuclear Information System (INIS)
FOWLER, K.D.
2000-01-01
The compatibility program described in this document formalizes the process for determining waste compatibility. The primary goal of the program is to ensure that sufficient controls are in place to prevent the formation of incompatible mixtures during future operations. The process described involves characterizing waste, comparing characteristics with criteria, resolving potential incompatibilities and documenting the process
Compatible Spatial Discretizations for Partial Differential Equations
Energy Technology Data Exchange (ETDEWEB)
Arnold, Douglas, N, ed.
2004-11-25
From May 11--15, 2004, the Institute for Mathematics and its Applications held a hot topics workshop on Compatible Spatial Discretizations for Partial Differential Equations. The numerical solution of partial differential equations (PDE) is a fundamental task in science and engineering. The goal of the workshop was to bring together a spectrum of scientists at the forefront of the research in the numerical solution of PDEs to discuss compatible spatial discretizations. We define compatible spatial discretizations as those that inherit or mimic fundamental properties of the PDE such as topology, conservation, symmetries, and positivity structures and maximum principles. A wide variety of discretization methods applied across a wide range of scientific and engineering applications have been designed to or found to inherit or mimic intrinsic spatial structure and reproduce fundamental properties of the solution of the continuous PDE model at the finite dimensional level. A profusion of such methods and concepts relevant to understanding them have been developed and explored: mixed finite element methods, mimetic finite differences, support operator methods, control volume methods, discrete differential forms, Whitney forms, conservative differencing, discrete Hodge operators, discrete Helmholtz decomposition, finite integration techniques, staggered grid and dual grid methods, etc. This workshop seeks to foster communication among the diverse groups of researchers designing, applying, and studying such methods as well as researchers involved in practical solution of large scale problems that may benefit from advancements in such discretizations; to help elucidate the relations between the different methods and concepts; and to generally advance our understanding in the area of compatible spatial discretization methods for PDE. Particular points of emphasis included: + Identification of intrinsic properties of PDE models that are critical for the fidelity of numerical
Mycelial compatibility groups and pathogenicity of Sclerotinia ...
African Journals Online (AJOL)
... was determined by mycelial compatibility grouping (MCG) and isolate aggressiveness comparisons. MCG, host specificity and aggressiveness of S. sclerotiorum isolates were assessed. Isolate pairs were designated compatible when no barrage zone formed at sites of contact. They were designated incompatible when a ...
47 CFR 76.1622 - Consumer education program on compatibility.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Consumer education program on compatibility. 76... SERVICES MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Notices § 76.1622 Consumer education program on compatibility. Cable system operators shall provide a consumer education program on compatibility matters to...
International Nuclear Information System (INIS)
Mochizuki, Akira; Ogawa, Tatsuhisa; Okamoto, Keishi; Nakatani, Tatsuyuki; Nitta, Yuki
2011-01-01
From the knowledge that zwitterion-type polymers show good blood compatibility, the introduction of both cationic and anionic functional groups onto diamond-like carbon (DLC) surface is expected to improve blood compatibility. Thus, DLC films were treated with oxygen and ammonia gas plasmas. The surfaces were characterized in terms of chemical composition by XPS, contact angle, and zeta potential. XPS analysis showed the introductions of a carboxyl group by oxygen plasma treatment and nitrogen atoms by ammonia plasma treatment. The evaluation of blood compatibility for the DLC surfaces was carried out in terms of platelets and the coagulation system. Excellent improvement of platelet compatibility was observed by the treatment with the gas plasmas, regardless of the plasma species. As for the compatibility with the coagulation system, DLC surfaces with a high concentration of carboxyl groups (COOH) markedly activated the system via the intrinsic pathway. However, the surfaces treated with ammonia plasma did not activate the system even though they had high COOH concentration. Measurement of the zeta potential revealed that the ammonia plasma treatment raised the potential from a negative value to a positive one. Though the introduction of amino groups to the surface was not detected directly, the treatment of ammonia plasma changed the electrical state of the DLC surface having COOH group, causing a difference in blood compatibility among the DLCs obtained by various plasma conditions.
fMRI-compatible rehabilitation hand device
Directory of Open Access Journals (Sweden)
Tzika Aria
2006-10-01
Full Text Available Abstract Background Functional magnetic resonance imaging (fMRI has been widely used in studying human brain functions and neurorehabilitation. In order to develop complex and well-controlled fMRI paradigms, interfaces that can precisely control and measure output force and kinematics of the movements in human subjects are needed. Optimized state-of-the-art fMRI methods, combined with magnetic resonance (MR compatible robotic devices for rehabilitation, can assist therapists to quantify, monitor, and improve physical rehabilitation. To achieve this goal, robotic or mechatronic devices with actuators and sensors need to be introduced into an MR environment. The common standard mechanical parts can not be used in MR environment and MR compatibility has been a tough hurdle for device developers. Methods This paper presents the design, fabrication and preliminary testing of a novel, one degree of freedom, MR compatible, computer controlled, variable resistance hand device that may be used in brain MR imaging during hand grip rehabilitation. We named the device MR_CHIROD (Magnetic Resonance Compatible Smart Hand Interfaced Rehabilitation Device. A novel feature of the device is the use of Electro-Rheological Fluids (ERFs to achieve tunable and controllable resistive force generation. ERFs are fluids that experience dramatic changes in rheological properties, such as viscosity or yield stress, in the presence of an electric field. The device consists of four major subsystems: a an ERF based resistive element; b a gearbox; c two handles and d two sensors, one optical encoder and one force sensor, to measure the patient induced motion and force. The smart hand device is designed to resist up to 50% of the maximum level of gripping force of a human hand and be controlled in real time. Results Laboratory tests of the device indicate that it was able to meet its design objective to resist up to approximately 50% of the maximum handgrip force. The detailed
Is Religious Education Compatible with Science Education?
Mahner, Martin; Bunge, Mario
1996-01-01
Addresses the problem of the compatibility of science and religion, and its bearing on science and religious education, challenges the popular view that science and religion are compatible or complementary. Discusses differences at the doctrinal, metaphysical, methodological, and attitudinal levels. Argues that religious education should be kept…
47 CFR 76.1621 - Equipment compatibility offer.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Equipment compatibility offer. 76.1621 Section... MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Notices § 76.1621 Equipment compatibility offer. Cable system... offer to supply each subscriber with special equipment that will enable the simultaneous reception of...
Multiparty Compatibility for Concurrent Objects
Directory of Open Access Journals (Sweden)
Roly Perera
2016-06-01
Full Text Available Objects and actors are communicating state machines, offering and consuming different services at different points in their lifecycle. Two complementary challenges arise when programming such systems. When objects interact, their state machines must be "compatible", so that services are requested only when they are available. Dually, when objects refine other objects, their state machines must be "compliant", so that services are honoured whenever they are promised. In this paper we show how the idea of multiparty compatibility from the session types literature can be applied to both of these problems. We present an untyped language in which concurrent objects are checked automatically for compatibility and compliance. For simple objects, checking can be exhaustive and has the feel of a type system. More complex objects can be partially validated via test cases, leading to a methodology closer to continuous testing. Our proof-of-concept implementation is limited in some important respects, but demonstrates the potential value of the approach and the relationship to existing software development practices.
Kinematical Compatibility Conditions for Vorticity Across Shock Waves
Baty, Roy
2015-11-01
This work develops the general kinematical compatibility conditions for vorticity across arbitrary shock waves in compressible, inviscid fluids. The vorticity compatibility conditions are derived from the curl of the momentum equation using singular distributions defined on two-dimensional shock wave surfaces embedded in three-dimensional flow fields. The singular distributions are represented as generalized differential operators concentrated on moving shock wave surfaces. The derivation of the compatibility conditions for vorticity requires the application of second-order generalized derivatives and elementary tensor algebra. The well-known vorticity jump conditions across a shock wave are then shown to follow from the general kinematical compatibility conditions for vorticity by expressing the flow field velocity in vectorial components normal and tangential to a shock surface.
International Nuclear Information System (INIS)
Silkworth, J.B.; Antrim, L.A.; Sack, G.
1986-01-01
Halogenated aromatic hydrocarbons act through the aromatic hydrocarbon (Ah) receptor in mice to produce a series of toxic effects of the immune system. The receptor protein is a product of the Ah gene locus. Ah responsive (Ahb/Ahb) mice express a high affinity receptor in both lymphoid and nonlymphoid tissues whereas nonresponsive Ahd/Ahd mice express a poor affinity receptor. To determine the role of the Ah receptor of lymphoid tissue relative to that of nonlymphoid tissue in the induction of immune impairment, bone marrow was used to reconstitute lethally irradiated mice of the same or opposite Ah phenotype. All mice were given 3,3',4,4'-tetrachlorobiphenyl (35 and 350 mumol/kg) ip 2 days before immunization with sheep erythrocytes (SRBC). The immune response to this T dependent antigen and organ weights were determined 5 or 7 days later in normal or chimeric mice, respectively. Monoclonal Lyt 1.1 and Lyt 1.2 antibodies were used to establish the origin of the cells which repopulated the chimeric thymuses. The immune responses of both BALB/cBy (Ahb/Ahb) and the BALB/cBy X DBA/2 hybrid, CByD2F1 (Ahb/Ahd), were significantly suppressed but DBA/2 mice were unaffected. The immune responses of chimeric BALB/cBy----BALB/cBy and BALB/cBy----DBA/2 (donor----recipient) mice were also significantly suppressed and thymic atrophy was observed in both cases. The serum anti-SRBC antibody titers of DBA/2----BALB/cBy chimeras were also significantly decreased although not to the same extent as in BALB/cBy----DBA/2 mice. Chimeric DBA/2----DBA/2 mice were not affected. These results indicate that the sensitivity to Ah receptor mediated suppression of the antibody response is primarily determined by the Ah phenotype of the lymphoid tissue
Studies on compatibility of energetic materials by thermal methods
Directory of Open Access Journals (Sweden)
Maria Alice Carvalho Mazzeu
2010-04-01
Full Text Available The chemical compatibility of explosives, pyrotechnics and propellants with those materials is studied to evaluate potential hazards when in contact with other materials during production, storage and handling. Compatibility can be studied by several thermal methods as DSC (differential scanning calorimetry, TG (Thermogravimetry, VST (Vacuum stability test and others. The test methods and well defined criteria are the most important elements when a compatibility study is being accomplished. In this paper, the compatibility of two very important high explosives used in ammunition, RDX (Cyclo-1,3,5-trimethylene-2,4,6-trinitramine and HMX (Cyclotetramethylene tetranitramine was studied with the materials: fluoroelastomer (Viton and powdered aluminum (Al, using DSC and VST methods. The criteria to judge the compatibility between materials is based on a standardization agreement (STANAG 4147, 2001, and the final conclusion is that explosives and this materials are compatible, but in DSC it was observed that the peak of decomposition temperature of the admixture of RDX with Al decreased in 3º C and another peak appeared after the decomposition peak.
Common Fixed Points for Weakly Compatible Maps
Indian Academy of Sciences (India)
The purpose of this paper is to prove a common fixed point theorem, from the class of compatible continuous maps to a larger class of maps having weakly compatible maps without appeal to continuity, which generalized the results of Jungck [3], Fisher [1], Kang and Kim [8], Jachymski [2], and Rhoades [9].
Deformation compatibility control for engineering structures methods and applications
Zhu, Hanhua; Chen, Mengchong; Deng, Jianliang
2017-01-01
This book presents essential methods of deformation compatibility control, and explicitly addresses the implied conditions on the methods’ deformation compatibility. Consequently, these conditions can be considered in engineering structure design, while the conditions on stable equilibrium can be taken into account in the design method. Thus, the designed deformation and the actual deformation of the respective structure are approximately identical, guaranteeing both the flexibility of the construction material in force transmission and the equilibrium of force in the structure. Though equilibrium theory in engineering structures has been extensively studied, there has been comparatively little research on compatibility. In the limited researches available, the topics are primarily the theories and assumptions on the deformation compatibility, while few systematic works focus on the mechanical theoretical principles and methods of deformation compatibility control. As such, the flexibility of the constructi...
Preformulation compatibility screening of dika fat-drug mixtures ...
African Journals Online (AJOL)
Differential scanning calorimetry (DSC) was used as screening technique for assessing compatibility between dika fat and drug substances. Dika fat was found to be compatible with aspirin, ascorbic acid, paracetamol, sulphanilamide, phenylpropanolamine hydrochloride, bromopheniramine maleate, chlorpheniramire ...
Application of remote handling compatibility on ITER plant
International Nuclear Information System (INIS)
Sanders, S.; Rolfe, A.; Mills, S.F.; Tesini, A.
2011-01-01
The ITER plant will require fully remote maintenance during its operational life. For this to be effective, safe and efficient the plant will have to be developed in accordance with remote handling (RH) compatibility requirements. A system for ensuring RH compatibility on plant designed for Tokamaks was successfully developed and applied, inter alia, by the authors when working at the JET project. The experience gained in assuring RH compatibility of plant at JET is now being applied to RH relevant ITER plant. The methodologies required to ensure RH compatibility of plant include the standardization of common plant items, standardization of RH features, availability of common guidance on RH best practice and a protocol for design and interface review and approval. The protocol in use at ITER is covered by the ITER Remote Maintenance Management System (IRMMS) defines the processes and utilization of management controls including Plant Definition Forms (PDF), Task Definition Forms (TDFs) and RH Compatibility Assessment Forms (RHCA) and the ITER RH Code of Practice. This paper will describe specific examples where the authors have applied the methodology proven at JET to ensure remote handling compatibility on ITER plant. Examples studied are: ·ELM coils (to be installed in-vessel behind the Blanket Modules) - handling both in-vessel, in Casks and at the Hot Cell as well as fully remote installation and connection (mechanical and electrical) in-vessel. ·Neutral beam systems (in-vessel and in the NB Cell) - beam sources, cesium oven, beam line components (accessed in the NB Cell) and Duct Liner (remotely replaced from in-vessel). ·Divertor (in-vessel) - cooling pipe work and remotely operated electrical connector. The RH compatibility process can significantly affect plant design. This paper should therefore be of interest to all parties who develop ITER plant designs.
Psychological compatibility of women's handball team
Directory of Open Access Journals (Sweden)
Shalar O.G.
2010-02-01
Full Text Available The results of study of psychological compatibility of womanish handball commands are presented. The psychological climate of command is investigational. Certain and adapted methods of estimation of psychological compatibility in the command playing types of sport. Psychological tests allow to expose the strong and weak sides of psychology of sportsmen. These information can be used for more effective program of psychological preparation of sportsmen development. It is necessary to improve determination of separate individual qualities of personality of sportsmen.
Multi-disciplinary System Engineering and the Compatibility Modeling Language (UCML
Directory of Open Access Journals (Sweden)
Carolin Eckl
2009-04-01
Full Text Available Over time, technical systems such as automobiles or spacecraft have grown more complex due to the incorporation of increasingly more and different components. The integration of these components, which are frequently designed and constructed within separate departments and companies may lead to malfunctioning systems as their interplay cannot be tested within the earlier phases of development. This paper introduces compatibility management as one solution to the problems of late component integration. Compatibility management is carried out on a common crossdomain model of the system and therefore allows to test compatibility early on. We show how compatibility management can be embedded into the phased development of ECSS-M-30A and present the (Unified Compatibility Modeling Language ((UCML, which is used for the underlying cross-domain model. A case study demonstrates the application of (UCML in the development of a small satellite and explains different degrees of compatibility.
Energy Technology Data Exchange (ETDEWEB)
Bonnemay, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
The first theory deals with the compatible optimization in coupled systems. A game theory for two players and with a non-zero sum is first developed. The conclusions are then extended to the case of a game with any finite number of players. After this essentially static study, the dynamic aspect of the problem is applied to the case of games which evolve. By applying PONTRYAGIN maximum principle it is possible to derive a compatible optimisation theorem which constitutes a necessary condition. (author) [French] La premiere these traite de l'optimalisation compatible des systemes couples. Une theorie du jeu a deux joueurs et a somme non nulle est d'abord developpee. Ses conclusions sont etendues ensuite au jeu a un nombre fini quelconque de joueurs. Apres cette etude essentiellement statique, l'aspect dynamique du probleme est introduit dans les jeux evolutifs. L'application du principe du maximum de PONTRYAGIN permet d'enoncer un theoreme d'optimalite compatible qui constitue une condition necessaire. (auteur)
Fully CMOS-compatible titanium nitride nanoantennas
Energy Technology Data Exchange (ETDEWEB)
Briggs, Justin A., E-mail: jabriggs@stanford.edu [Department of Applied Physics, Stanford University, 348 Via Pueblo Mall, Stanford, California 94305 (United States); Department of Materials Science and Engineering, Stanford University, 496 Lomita Mall, Stanford, California 94305 (United States); Naik, Gururaj V.; Baum, Brian K.; Dionne, Jennifer A. [Department of Materials Science and Engineering, Stanford University, 496 Lomita Mall, Stanford, California 94305 (United States); Petach, Trevor A.; Goldhaber-Gordon, David [Department of Physics, Stanford University, 382 Via Pueblo Mall, Stanford, California 94305 (United States)
2016-02-01
CMOS-compatible fabrication of plasmonic materials and devices will accelerate the development of integrated nanophotonics for information processing applications. Using low-temperature plasma-enhanced atomic layer deposition (PEALD), we develop a recipe for fully CMOS-compatible titanium nitride (TiN) that is plasmonic in the visible and near infrared. Films are grown on silicon, silicon dioxide, and epitaxially on magnesium oxide substrates. By optimizing the plasma exposure per growth cycle during PEALD, carbon and oxygen contamination are reduced, lowering undesirable loss. We use electron beam lithography to pattern TiN nanopillars with varying diameters on silicon in large-area arrays. In the first reported single-particle measurements on plasmonic TiN, we demonstrate size-tunable darkfield scattering spectroscopy in the visible and near infrared regimes. The optical properties of this CMOS-compatible material, combined with its high melting temperature and mechanical durability, comprise a step towards fully CMOS-integrated nanophotonic information processing.
New Commitment Options: Compatibility with Emissions Trading
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
This paper considers different options for quantitative greenhouse gas emission commitments from the standpoint of their technical compatibility with emissions trading. These are dynamic targets, binding targets with price caps, non-binding targets, sector-wide targets/mechanisms, action targets, allowances and endowments, and long-term permits. This paper considers these options from the standpoint of their compatibility with emissions trading.
Detergent-compatible proteases: microbial production, properties, and stain removal analysis.
Niyonzima, Francois Niyongabo; More, Sunil
2015-01-01
Proteases are one of the most important commercial enzymes used in various industrial domains such as detergent and leather industries. The alkaline proteases as well as other detergent-compatible enzymes such as lipases and amylases serve now as the key components in detergent formulations. They break down various stains during fabric washing. The search for detergent-compatible proteases with better properties is a continuous exercise. The current trend is to use detergent-compatible proteases that are stable over a wide temperature range. Although the proteases showing stability at elevated pH have the capacity to be used in detergent formulations, their usage can be significant if they are also stable and compatible with detergent and detergent ingredients, and also able to remove protein stains. Despite the existence of some reviews on alkaline proteases, there is no specification for the use of alkaline proteases as detergent additives. The present review describes the detergent-compatible proteases tested as detergent additives. An overview was provided for screening, optimization, purification, and properties of detergent compatible proteases, with an emphasis on the stability and compatibility of the alkaline proteases with the detergent and detergent compounds, as well as stain removal examination methods.
Compatibility Grab Sampling and Analysis Plan for FY 2000
International Nuclear Information System (INIS)
SASAKI, L.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for grab samples obtained to address waste compatibility. It is written in accordance with requirements identified in Data Quality Objectives for Tank Farms Waste Compatibility Program (Mulkey et al. 1999) and Tank Farm Waste Transfer Compatibility Program (Fowler 1999). In addition to analyses to support Compatibility, the Waste Feed Delivery program has requested that tank samples obtained for Compatibility also be analyzed to confirm the high-level waste and/or low-activity waste envelope(s) for the tank waste (Baldwin 1999). The analytical requirements to confirm waste envelopes are identified in Data Quality Objectives for TWRS Privatization Phase I: Confirm Tank T is an Appropriate Feed Source for Low-Activity Waste Feed Batch X (Nguyen 1999a) and Data Quality Objectives for RPP Privatization Phase I: Confirm Tank T is an Appropriate Feed Source for High-Level Waste Feed Batch X (Nguyen 1999b)
Compatibility and testing of electronic components
Jowett, C E
2013-01-01
Compatibility and Testing of Electronic Components outlines the concepts of component part life according to thresholds of failure; the advantages that result from identifying such thresholds; their identification; and the various tests used in their detection. The book covers topics such as the interconnection of miniature passive components; the integrated circuit compatibility and its components; the semiconductor joining techniques; and the thin film hybrid approach in integrated circuits. Also covered are topics such as thick film resistors, conductors, and insulators; thin inlays for el
Generate tri-directional spectra-compatible time histories using HHT method
Energy Technology Data Exchange (ETDEWEB)
Li, Bo; Xie, Wei-Chau, E-mail: xie@uwaterloo.ca; Pandey, Mahesh D.
2016-11-15
Highlights: • Hilbert–Huang Transform are applied to modify real earthquake records. • Generate tri-directional time histories compatible with target spectra. • Both GRS and FRS are considered as target spectra. • Target spectra with multiple damping ratios are considered. - Abstract: This paper proposes two algorithms to generate spectrum-compatible time histories based on two approaches recommended by USNRC Standard Review Plan 3.7.1. Hilbert–Huang Transform technique is used to analyze frequency contents and amplitudes of seed motions. Through adjusting the frequency contents and amplitudes of seed motions, spectrum-compatible time histories are obtained. The first algorithm is to generate tri-directional time histories compatible with multi-damping target design spectra (ground response spectra or floor response spectra). The second algorithm is to generate tri-directional time histories compatible with single-damping target design spectra. Examples are presented to demonstrate versatility of these two proposed algorithms to generate spectra-compatible time histories.
Generate tri-directional spectra-compatible time histories using HHT method
International Nuclear Information System (INIS)
Li, Bo; Xie, Wei-Chau; Pandey, Mahesh D.
2016-01-01
Highlights: • Hilbert–Huang Transform are applied to modify real earthquake records. • Generate tri-directional time histories compatible with target spectra. • Both GRS and FRS are considered as target spectra. • Target spectra with multiple damping ratios are considered. - Abstract: This paper proposes two algorithms to generate spectrum-compatible time histories based on two approaches recommended by USNRC Standard Review Plan 3.7.1. Hilbert–Huang Transform technique is used to analyze frequency contents and amplitudes of seed motions. Through adjusting the frequency contents and amplitudes of seed motions, spectrum-compatible time histories are obtained. The first algorithm is to generate tri-directional time histories compatible with multi-damping target design spectra (ground response spectra or floor response spectra). The second algorithm is to generate tri-directional time histories compatible with single-damping target design spectra. Examples are presented to demonstrate versatility of these two proposed algorithms to generate spectra-compatible time histories.
Fertilization compatibility of spawning corals
National Oceanic and Atmospheric Administration, Department of Commerce — This data set includes experimental results of fertilization assays to characterize genetic compatibility between individual parental genotypes. Targeted species...
Compatibility of Segments of Thermoelectric Generators
Snyder, G. Jeffrey; Ursell, Tristan
2009-01-01
A method of calculating (usually for the purpose of maximizing) the power-conversion efficiency of a segmented thermoelectric generator is based on equations derived from the fundamental equations of thermoelectricity. Because it is directly traceable to first principles, the method provides physical explanations in addition to predictions of phenomena involved in segmentation. In comparison with the finite-element method used heretofore to predict (without being able to explain) the behavior of a segmented thermoelectric generator, this method is much simpler to implement in practice: in particular, the efficiency of a segmented thermoelectric generator can be estimated by evaluating equations using only hand-held calculator with this method. In addition, the method provides for determination of cascading ratios. The concept of cascading is illustrated in the figure and the definition of the cascading ratio is defined in the figure caption. An important aspect of the method is its approach to the issue of compatibility among segments, in combination with introduction of the concept of compatibility within a segment. Prior approaches involved the use of only averaged material properties. Two materials in direct contact could be examined for compatibility with each other, but there was no general framework for analysis of compatibility. The present method establishes such a framework. The mathematical derivation of the method begins with the definition of reduced efficiency of a thermoelectric generator as the ratio between (1) its thermal-to-electric power-conversion efficiency and (2) its Carnot efficiency (the maximum efficiency theoretically attainable, given its hot- and cold-side temperatures). The derivation involves calculation of the reduced efficiency of a model thermoelectric generator for which the hot-side temperature is only infinitesimally greater than the cold-side temperature. The derivation includes consideration of the ratio (u) between the
Military electronic equipment shelter electrical wiring design of electromagnetic compatibility
International Nuclear Information System (INIS)
Yang Xuemei
2012-01-01
Electromagnetic compatibility is the military electronics shelter design is an important indicator of the shelter's electrical wiring is the key to the design of electromagnetic compatibility. Introduces the basic concepts of electromagnetic compatibility, and focusing on the shelter layout design problems that need attention, and to solve these problems. (authors)
30 CFR 57.6400 - Compatibility of electric detonators.
2010-07-01
... Electric Blasting-Surface and Underground § 57.6400 Compatibility of electric detonators. All electric detonators to be fired in a round shall be from the same manufacturer and shall have similar electrical... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compatibility of electric detonators. 57.6400...
30 CFR 56.6400 - Compatibility of electric detonators.
2010-07-01
... Electric Blasting § 56.6400 Compatibility of electric detonators. All electric detonators to be fired in a round shall be from the same manufacturer and shall have similar electrical firing characteristics. ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compatibility of electric detonators. 56.6400...
Fusion-reactor blanket and coolant material compatibility
International Nuclear Information System (INIS)
Jeppson, D.W.; Keough, R.F.
1981-01-01
Fusion reactor blanket and coolant compatibility tests are being conducted to aid in the selection and design of safe blanket and coolant systems for future fusion reactors. Results of scoping compatibility tests to date are reported for blanket material and water interactions at near operating temperatures. These tests indicate the quantitative hydrogen release, the maximum temperature and pressures produced and the rates of interactions for selected blanket materials
An MR-compatible neonatal incubator.
Paley, M N J; Hart, A R; Lait, M; Griffiths, P D
2012-07-01
To develop a neonatal MR-compatible incubator for transporting babies between a neonatal intensive care unit and an MRI unit that is within the same hospital but geographically separate. The system was strapped to a standard MR-compatible patient trolley, which provides space for resuscitation outside the incubator. A constant-temperature exothermic heat pad was used to maintain temperature together with a logging fluoro-optic temperature monitor and alarm system. The system has been designed to accommodate standard knee-sized coils from the major MR manufacturers. The original incubator was constructed from carbon fibre, but this required modification to prevent radiofrequency shading artefacts due to the conducting properties of the carbon fibre. A high-tensile polyester material was used, which combined light weight with high impact strength. The system could be moved onto the patient bed with the coils and infant in place by one technologist. Studies in eight neonatal patients produced high quality 1.5 T MR images with low motion artefacts. The incubator should also be compatible with imaging in 3 T MR systems, although further work is required to establish this. Images were acquired using both rapid and high-resolution sequences, including three-dimensional volumes, proton spectra and diffusion weighting. The incubator provides a safe, quiet environment for neonates during transport and imaging, at low cost.
Coproduction of detergent compatible bacterial enzymes and stain removal evaluation.
Niyonzima, Francois N; More, Sunil S
2015-10-01
Most of the detergents that are presently produced contain the detergent compatible enzymes to improve and accelerate the washing performance by removing tough stains. The process is environment friendly as the use of enzymes in the detergent formulation reduces the utilization of toxic detergent constituents. The current trend is to use the detergent compatible enzymes that are active at low and ambient temperature in order to save energy and maintain fabric quality. As the detergent compatible bacterial enzymes are used together in the detergent formulation, it is important to co-produce the detergent enzymes in a single fermentation medium as the enzyme stability is assured, and production cost gets reduced enormously. The review reports on the production, purification, characterization and application of detergent compatible amylases, lipases, and proteases are available. However, there is no specific review or minireview on the concomitant production of detergent compatible amylases, lipases, and proteases. In this minireview, the coproduction of detergent compatible enzymes by bacterial species, enzyme stability towards detergents and detergent components, and stain release analysis were discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Weijie Li
Full Text Available BACKGROUND: This study aimed to investigate the relationships of intrahepatic cccDNA with serum HBsAg and with HBV DNA in treatment-naive patients throughout acute and chronic HBV infection. METHODS: A total of 120 patients who had a liver biopsy were enrolled, including 19 with acute hepatitis B (AHB, and 101 patients with chronic HBV infection (CHB of whom were 10 in immune-tolerant (IT phase, 59 in immune-clearance (IC phase, 8 in low-replicative (LR phase, and 24 in HBeAg-negative hepatitis (ENH phase. Intrahepatic cccDNA, serum HBsAg and serum HBV DNA levels were comparatively analyzed. RESULTS: The median intrahepatic cccDNA levels were 0.18 4.80, 3.81, 0.22 and 0.97 copies/cell for patients with AHB, CHB-IT, CHB-IC, CHB-LR, and CHB-ENH, respectively. In AHB patients, intrahepatic cccDNA was positively correlated with serum HBsAg (r = 0.665, P = 0.003, as well as serum HBV DNA (r = 0.536, P = 0.022. In CHB patients, intrahepatic cccDNA was positively correlated with serum HBsAg in the IC phase (r = 0.392, P = 0.005, and with serum HBV DNA in the IC phase (r = 0.301, P = 0.036 and ENH phase (r = 0.588, P = 0.013. HBV replicative efficiency, defined as the ratio of serum HBV DNA to intrahepatic cccDNA, was obviously lower in AHB and CHB-LR patients than in CHB-IT, CHB-IC and CHB-ENH patients (0.70 and 0.53 vs. 1.12, 1.09 and 0.99, P<0.001, values were logarithmic transformed for analysis. In CHB-IC patients, HBV replicative efficiency was positively correlated with histological activity index of liver inflammation (r = 0.308, P = 0.009. CONCLUSION: Serum HBsAg and HBV DNA levels may reflect the amount of active intrahepatic cccDNA in treatment-naive AHB and CHB-IC patients. Reduced intrahepatic cccDNA and HBV replicative efficiency may imply effective immune control of HBV infection.
Fusion-reactor blanket-material safety-compatibility studies
International Nuclear Information System (INIS)
Jeppson, D.W.; Muhlestein, L.D.; Keough, R.F.; Cohen, S.
1982-11-01
Blanket material selection for fusion reactors is strongly influenced by the desire to minimize safety and environmental concerns. Blanket material safety compatibility studies are being conducted to identify and characterize blanket-coolant-material interactions under postulated reactor accident conditions. Recently completed scoping compatibility tests indicate that : (1) ternary oxides (LiAlO 2 , Li 2 ZrO 3 , Li 2 SiO 3 , Li 4 SiO 4 and LiTiO 3 ) at postulated blanket operating temperatures are compatible with water coolant, while liquid lithium and Li 7 Pb 2 alloy reactions with water generate heat, aerosol and hydrogen; (2) lithium oxide and Li 17 Pb 83 alloy react mildly with water requiring special precautions to control hydrogen release; (3) liquid lithium reacts substantially, while Li 17 Pb 83 alloy reacts mildly with concrete to produce hydrogen; and (4) liquid lithium-air reactions present some major safety concerns
Development of materials with blood compatibility by radiation processing
International Nuclear Information System (INIS)
Roesinger, S.; Fischer, J.P.; Fuhge, P.
1982-01-01
Biomedical applications, for example for rendering plastic materials blood compatible, have become a very important problem in recent years. Surface-grafted materials for blood compatibility have attracted attention for intra- and extracorporal applications. Numerous aspects of grafting monomers on to polymer surfaces by different grafting methods have been given. A large amount of work has been done during the last ten years, but nobody has prepared materials with properties that are desirable for long-term medical application in the human body, for example as replacements for small arteries or veins. The evaluation of blood compatibility of different plastic materials, and the search for correlations between blood compatibility and physical properties of the plastic materials surfaces, are well-known problems in the biomedical applications of polymers. This paper briefly reviews an approach to help solving these problems. (author)
[Compatible biomass models of natural spruce (Picea asperata)].
Wang, Jin Chi; Deng, Hua Feng; Huang, Guo Sheng; Wang, Xue Jun; Zhang, Lu
2017-10-01
By using nonlinear measurement error method, the compatible tree volume and above ground biomass equations were established based on the volume and biomass data of 150 sampling trees of natural spruce (Picea asperata). Two approaches, controlling directly under total aboveground biomass and controlling jointly from level to level, were used to design the compatible system for the total aboveground biomass and the biomass of four components (stem, bark, branch and foliage), and the total ground biomass could be estimated independently or estimated simultaneously in the system. The results showed that the R 2 of the one variable and bivariate compatible tree volume and aboveground biomass equations were all above 0.85, and the maximum value reached 0.99. The prediction effect of the volume equations could be improved significantly when tree height was included as predictor, while it was not significant in biomass estimation. For the compatible biomass systems, the one variable model based on controlling jointly from level to level was better than the model using controlling directly under total above ground biomass, but the bivariate models of the two methods were similar. Comparing the imitative effects of the one variable and bivariate compatible biomass models, the results showed that the increase of explainable variables could significantly improve the fitness of branch and foliage biomass, but had little effect on other components. Besides, there was almost no difference between the two methods of estimation based on the comparison.
47 CFR 76.630 - Compatibility with consumer electronics equipment.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Compatibility with consumer electronics equipment. 76.630 Section 76.630 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST... Compatibility with consumer electronics equipment. (a) Cable system operators shall not scramble or otherwise...
DUPIC fuel compatibility assessment
Energy Technology Data Exchange (ETDEWEB)
Choi, Hang Bok; Rho, G. H.; Park, J. W. [and others
2000-03-01
The purpose of this study is to assess the compatibility of DUPIC(Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The phase 1 study of this project includes the feasibility analysis on applicability of the current core design method, the feasibility analysis on operation of the DUPIC fuel core, the compatibility analysis on individual reactor system, the sensitivity analysis on the fuel composition, and the economic analysis on DUPIC fuel cycle. The results of the validation calculations have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of core simulations have shown that both natural uranium and DUPIC fuel cores are almost the same from the viewpoint of the operational performance. For individual reactor system including reactively devices, the functional requirements of each system are satisfied in general. However, because of the pronounced power flattening in the DUPIC core, the radiation damage on the critical components increases, which should be investigated more in the future. The DUPIC fuel composition heterogeneity dose not to impose any serious effect on the reactor operation if the fuel composition is adjusted. The economics analysis has been performed through conceptual design studies on the DUPIC fuel fabrication, fuel handling in a plant, and spent fuel disposal, which has shown that the DUPIC fuel cycle is comparable to the once-trough fuel cycle considering uncertainties associated with unit costs of the fuel cycle components. The results of Phase 1 study have shown that it is feasible to use the DUPIC fuel in CANDU reactors without major changes in hardware. However further studies are required to confirm the safety of the reactor under accident condition.
DUPIC fuel compatibility assessment
International Nuclear Information System (INIS)
Choi, Hang Bok; Rho, G. H.; Park, J. W. and others
2000-03-01
The purpose of this study is to assess the compatibility of DUPIC(Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The phase 1 study of this project includes the feasibility analysis on applicability of the current core design method, the feasibility analysis on operation of the DUPIC fuel core, the compatibility analysis on individual reactor system, the sensitivity analysis on the fuel composition, and the economic analysis on DUPIC fuel cycle. The results of the validation calculations have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of core simulations have shown that both natural uranium and DUPIC fuel cores are almost the same from the viewpoint of the operational performance. For individual reactor system including reactively devices, the functional requirements of each system are satisfied in general. However, because of the pronounced power flattening in the DUPIC core, the radiation damage on the critical components increases, which should be investigated more in the future. The DUPIC fuel composition heterogeneity dose not to impose any serious effect on the reactor operation if the fuel composition is adjusted. The economics analysis has been performed through conceptual design studies on the DUPIC fuel fabrication, fuel handling in a plant, and spent fuel disposal, which has shown that the DUPIC fuel cycle is comparable to the once-trough fuel cycle considering uncertainties associated with unit costs of the fuel cycle components. The results of Phase 1 study have shown that it is feasible to use the DUPIC fuel in CANDU reactors without major changes in hardware. However further studies are required to confirm the safety of the reactor under accident condition
[Compatibility of family and medical profession].
Bundy, B D; Bellemann, N; Weber, M-A
2011-09-01
The compatibility of family and profession is especially difficult for employees in medical professions because of shift work and overtime. It seems that in the future women are going to represent the majority of medical professionals. Hence, with the manifest lack of physicians social aspects will also play a bigger role in the choice of the place of employment. In most families the classic role model prevails although women are well educated and men also set a high value on the compatibility of family and profession and would like to take parental leave and work in flexible working hours. This represents a chance, especially for radiology.
Compatibility of anhydride cured epoxies with hexanitroazobenzene (HNAB) and hexanitrostilbene (HNS)
International Nuclear Information System (INIS)
Massis, T.M.; Wischmann, K.B.
1985-01-01
The explosives HNAB (hexanitroazobenzene) and HNS (hexanitrostilbene) have compatibility problems with amine-cured epoxy systems. A program was instituted to find compatible polymeric substitutes for use with these explosives. These polymeric materials must have rigid structures after curing for both adhesive and encapsulant applications. A promising class of epoxy materials using anhydride curing agents with various catalysts to trigger the cure reaction were developed. These polymeric systems have very good compatibility with HNS. Of those tested with HNAB, the anhydride epoxy system that used uranyl nitrate as the catalyst was found to be marginally compatible while the others were incompatible. These results indicated further studies are needed. The CRT (chemical reactivity test) was used to evaluate the compatibility of these materials. 6 references, 2 figures, 5 tables
Detergent-compatible bacterial amylases.
Niyonzima, Francois N; More, Sunil S
2014-10-01
Proteases, lipases, amylases, and cellulases are enzymes used in detergent formulation to improve the detergency. The amylases are specifically supplemented to the detergent to digest starchy stains. Most of the solid and liquid detergents that are currently manufactured contain alkaline enzymes. The advantages of using alkaline enzymes in the detergent formulation are that they aid in removing tough stains and the process is environmentally friendly since they reduce the use of toxic detergent ingredients. Amylases active at low temperature are preferred as the energy consumption gets reduced, and the whole process becomes cost-effective. Most microbial alkaline amylases are used as detergent ingredients. Various reviews report on the production, purification, characterization, and application of amylases in different industry sectors, but there is no specific review on bacterial or fungal alkaline amylases or detergent-compatible amylases. In this mini-review, an overview on the production and property studies of the detergent bacterial amylases is given, and the stability and compatibility of the alkaline bacterial amylases in the presence of the detergents and the detergent components are highlighted.
Conceptual design of CFETR divertor remote handling compatible structure
International Nuclear Information System (INIS)
Dai, Huaichu; Yao, Damao; Cao, Lei; Zhou, Zibo; Li, Lei
2016-01-01
Highlights: • Conceptual design for the CFETR divertor have been proposed, especially the divertor remote handling compatible structure. • The degrees of freedom of the divertor are analyzed in order to validate the design the divertor supports structure. • Besides the ITER-like scheme, a new scheme for the divertor remote handling compatible supports is proposed, that is the rack and pinion mechanism. • The installation/removel process is verified through simulation in Delmia in order to check design quality for remote handling requirements. - Abstract: Divertor is one of key components of tokamak fusion reactor. The CFETR is China Fusion Engineering Test Reactor. Its divertor will expose to tritium environment and neutron radiation. Materials of the divertor will be radioactived, and cannot be handled by personnel directly. To develop structure which compatible with robots handle for installation, maintenance and removing is required. This paper introduces a conceptual design of CFETR divertor module which compatible with remote handling end-effectors. The divertor module is confined by inner and outer support. The inner support is only confined divertor module radial, toroidal and vertical moving freedom degrees, but not confined rotating freedom degrees. The outer support is the structure that can confine rotating freedom degrees and should also be compatible with remote handling end-effectors.
Conceptual design of CFETR divertor remote handling compatible structure
Energy Technology Data Exchange (ETDEWEB)
Dai, Huaichu, E-mail: yaodm@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei (China); Yao, Damao; Cao, Lei; Zhou, Zibo; Li, Lei [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)
2016-11-15
Highlights: • Conceptual design for the CFETR divertor have been proposed, especially the divertor remote handling compatible structure. • The degrees of freedom of the divertor are analyzed in order to validate the design the divertor supports structure. • Besides the ITER-like scheme, a new scheme for the divertor remote handling compatible supports is proposed, that is the rack and pinion mechanism. • The installation/removel process is verified through simulation in Delmia in order to check design quality for remote handling requirements. - Abstract: Divertor is one of key components of tokamak fusion reactor. The CFETR is China Fusion Engineering Test Reactor. Its divertor will expose to tritium environment and neutron radiation. Materials of the divertor will be radioactived, and cannot be handled by personnel directly. To develop structure which compatible with robots handle for installation, maintenance and removing is required. This paper introduces a conceptual design of CFETR divertor module which compatible with remote handling end-effectors. The divertor module is confined by inner and outer support. The inner support is only confined divertor module radial, toroidal and vertical moving freedom degrees, but not confined rotating freedom degrees. The outer support is the structure that can confine rotating freedom degrees and should also be compatible with remote handling end-effectors.
Analysis and Application of Antagonism Compound Prescription Compatibility
Li, Mengyan; Wang, Can; Bai, Ming; Miao, Mingsan
2018-01-01
Deer horn glue is deer family animals deer or red deer horn made of solid plastic animal medicine, according to Chinese medicine “seven emotions together” theory, the antler and other Chinese herbal medicines compatibility can be better play its Medicinal value. In this paper, the chemical composition, pharmacological effects, compatibility analysis, clinical application and classic ancient prescriptions of antler are reviewed in recent years.
47 CFR 20.19 - Hearing aid-compatible mobile handsets.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Hearing aid-compatible mobile handsets. 20.19... COMMERCIAL MOBILE RADIO SERVICES § 20.19 Hearing aid-compatible mobile handsets. (a) Scope of section..., consistent with its own marketing practices. However, if a manufacturer assigns different model device...
Gregorc, Ales; Silva-Zacarin, Elaine C M; Carvalho, Stephan Malfitano; Kramberger, Doris; Teixeira, Erica W; Malaspina, Osmar
2016-03-01
Multiple stressors, such as chemicals and pathogens, are likely to be detrimental for the health and lifespan of Apis mellifera, a bee species frequently exposed to both factors in the field and inside hives. The main objective of the present study was to evaluate comparatively the health of Carniolan and Africanized honey bees (AHB) co-exposed to thiamethoxam and Nosema ceranae (N. ceranae) spores. Newly-emerged worker honey bees were exposed solely with different sublethal doses of thiamethoxam (2% and 0.2% of LD50 for AHB), which could be consumed by bees under field conditions. Toxicity tests for the Carniolan bees were performed, and the LD50 of thiamethoxam for Carniolan honey bees was 7.86 ng bee(-1). Immunohistological analyses were also performed to detect cell death in the midgut of thiamethoxam and/or N. ceranae treated bees. Thiamethoxam exposure had no negative impact on Nosema development in experimental conditions, but it clearly inhibited cell death in the midgut of thiamethoxam and Nosema-exposed bees, as demonstrated by immunohistochemical data. Indeed, thiamethoxam exposure only had a minor synergistic toxic effect on midgut tissue when applied as a low dose simultaneously with N. ceranae to AHB and Carniolan honey bees, in comparison with the effect caused by both stressors separately. Our data provides insights into the effects of the neonicotenoid thiamethoxam on the AHB and Carniolan honey bee life span, as well as the effects of simultaneous application of thiamethoxam and N. ceranae spores to honey bees. Copyright © 2016. Published by Elsevier Ltd.
Compatibility and kidney transplantation: The way to go.
Directory of Open Access Journals (Sweden)
Ilias I.N. eDoxiadis
2012-05-01
Full Text Available Long lasting debates in the past questioned the relevance of any sort of compatibility in post mortal kidney transplantation. It is for no say that fully compatible transplants have the highest chances for a long patient and graft survival. In the present report the use of HLA-DR as a representative of the Major Histocompatibility Complex class II genes in the allocation of organs is discussed. The major arguments are the easiness to offer to patients a compatible graft in a relatively short waiting time, an increase in graft survival, the less sensitization during the transplantation period, and the lower waiting time for a retransplant. Even if the number of organ donors remains the same a lowering of the mean waiting time is expected because of the longer period of graft survival.
Energy Technology Data Exchange (ETDEWEB)
Bonnemay, A. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
The first theory deals with the compatible optimization in coupled systems. A game theory for two players and with a non-zero sum is first developed. The conclusions are then extended to the case of a game with any finite number of players. After this essentially static study, the dynamic aspect of the problem is applied to the case of games which evolve. By applying PONTRYAGIN maximum principle it is possible to derive a compatible optimisation theorem which constitutes a necessary condition. (author) [French] La premiere these traite de l'optimalisation compatible des systemes couples. Une theorie du jeu a deux joueurs et a somme non nulle est d'abord developpee. Ses conclusions sont etendues ensuite au jeu a un nombre fini quelconque de joueurs. Apres cette etude essentiellement statique, l'aspect dynamique du probleme est introduit dans les jeux evolutifs. L'application du principe du maximum de PONTRYAGIN permet d'enoncer un theoreme d'optimalite compatible qui constitue une condition necessaire. (auteur)
Compatibility Between Electric Components in Wind Farms
DEFF Research Database (Denmark)
Holdyk, Andrzej; Holbøll, Joachim; Arana Aristi, Iván
2011-01-01
The paper describes a method for investigation of the compatibility between electric components in wind farms by identifying critical resonances at different points of an offshore wind farm (OWF), based on systematic variation of critical parameters. In this way, the design of future OWF can...... be improved at a very early stage of the process. It is also revealed what parameters are the most important ones when considering compatibility. It was observed that a change of capacitance in the collection grid shifts the resonance peaks. A change in WT transformer capacitances influences the admittance...
The study on compatibility of polymer matrix resins with liquid oxygen
International Nuclear Information System (INIS)
Wang Ge; Li Xiaodong; Yan Rui; Xing Suli
2006-01-01
Liquid oxygen (LOX) polymer composite tank is very important in the development of next generation of launch vehicles. To study LOX compatible polymeric matrix resins, three kinds of epoxy resins were studied. LOX impact test was used to evaluate polymers' compatibility with LOX. Thermogravimetric analysis was used to analyze polymers' oxidation. It seemed that polymers with better anti-oxidation properties, characterized by lower oxidation weight gain, lower weight loss and lower flash point, behaved better LOX compatibility. Fourier transform infrared attenuated total reflection spectroscopy confirmed the chemical reactions during the LOX impact process on the surface of polymers were similar to the oxidation reaction in gaseous oxygen (GOX) at high temperatures, which indicated the chemical mechanism of LOX compatibility of polymers was just oxidation reaction. In this way, two new epoxy resins with desirable LOX compatibility were acquired by modification
Materials compatibility information data bank
International Nuclear Information System (INIS)
Mead, K.E.
1977-01-01
A major concern in the design of weapons systems is the compatibility of the materials used with each other and with the enclosed environment. Usually these systems require long term storage with a high reliability for proper function at the end of this storage period. Materials selection is then based on both past experience and laboratory accelerated aging experiments to assure this long term reliability. To assist in the task of materials selection a computerized materials compatibility data bank is being established. This data bank will provide a source of annotated information and references to personnel and documents for both the designer and materials engineer to draw on for guidance in materials selection. The data bank storage and information retrieval philosophy will be discussed and procedures for information gathering outlined. Examples of data entries and search routines will be presented to demonstrate the usefulness and versatility of the proposed system
Dissociating Compatibility Effects and Distractor Costs in the Additional Singleton Paradigm
Directory of Open Access Journals (Sweden)
Charles eFolk
2013-07-01
Full Text Available The interpretation of identity compatibility effects associated with irrelevant items outside the nominal focus of attention has fueled much of the debate over early versus late selection and perceptual load theory. However, compatibility effects have also played a role in the debate over the extent to which the involuntary allocation of spatial attention (i.e., attentional capture is completely stimulus-driven or whether it is contingent on top-down control settings. For example, in the context of the additional singleton paradigm, irrelevant color singletons have been found to produce not only an overall cost in search performance but also significant compatibility effects. This combination of search costs and compatibility effects has been taken as evidence that spatial attention is indeed allocated in a bottom-up fashion to the salient but irrelevant singletons. However, it is possible that compatibility effects in the additional singleton paradigm reflect parallel processing of identity associated with low perceptual load rather than an involuntary shift of spatial attention. In the present experiments, manipulations of load were incorporated into the traditional additional singleton paradigm. Under low load conditions, both search costs and compatibility effects were obtained, replicating previous studies. Under high load conditions, search costs were still present, but compatibility effects were eliminated. This dissociation suggests that the costs associated with irrelevant singletons may reflect filtering processes rather than the allocation of spatial attention.
The compatibility between extension aims of staff and their ...
African Journals Online (AJOL)
This pilot investigation was done to investigate the compatibility between extension aims of extension staff and those of their employer. It shows that only 50 percent of respondents have an acceptable understanding of the official aims (vision), and that none of the components of the official vision has sufficient compatibility ...
Waste compatibility assessments to support project W-320
International Nuclear Information System (INIS)
BLAAK, T.M.
1999-01-01
The intent of this internal memo is to provide a recommendation for the transfer of tank 241-C-106 waste, Attachment 2, to tank 241-AY-102. This internal memo also identifies additional requirements which have been deemed necessary for safely receiving and storing the waste documented in Attachment 2 from tank 241-C-106 in tank 241-AY-102. This waste transfer is planned in support of tank 241-C-106 solids sluicing activities. Approximately 200,000 gallons of waste and flush water are expected to be pumped from tank 241-C-106 into tank 241-AY-102. Several transfers will be necessary to complete the sluicing of tank 241-C-106 solids. To assure ourselves that this waste transfer will not create any compatibility concerns, a waste compatibility assessment adhering to current waste compatibility requirements has been performed
Carroll, Judith E; Cole, Steven W; Seeman, Teresa E; Breen, Elizabeth C; Witarama, Tuff; Arevalo, Jesusa M G; Ma, Jeffrey; Irwin, Michael R
2016-01-01
Age-related disease risk has been linked to short sleep duration and sleep disturbances; however, the specific molecular pathways linking sleep loss with diseases of aging are poorly defined. Key cellular events seen with aging, which are thought to contribute to disease, may be particularly sensitive to sleep loss. We tested whether one night of partial sleep deprivation (PSD) would increase leukocyte gene expression indicative of DNA damage responses (DDR), the senescence-associated secretory phenotype (SASP), and senescence indicator p16(INK4a) in older adult humans, who are at increased risk for cellular senescence. Community-dwelling older adults aged 61-86years (n=29; 48% male) underwent an experimental partial sleep deprivation (PSD) protocol over 4 nights, including adaptation, an uninterrupted night of sleep, partial sleep deprivation (sleep restricted 3-7AM), and a subsequent full night of sleep. Blood samples were obtained each morning to assess peripheral blood mononuclear cell (PBMC) gene expression using Illumina HT-12 arrays. Analyses of microarray results revealed that SASP (psleep deprivation activates PBMC gene expression patterns consistent with biological aging in this older adult sample. PSD enhanced the SASP and increased the accumulation of damage that initiates cell cycle arrest and promotes cellular senescence. These findings causally link sleep deprivation to the molecular processes associated with biological aging. Copyright © 2015 Elsevier Inc. All rights reserved.
Mechanical compatibility and stress analyses in composite materials
International Nuclear Information System (INIS)
Schimmoeller, H.; Ruge, J.
1976-01-01
This paper gives a short description of the problem of mechanical interactions and mechanical compatibility in composite bodies. The formation of stress-strain states, caused by the mechanical compatibility by bonding of the interfaces, is discussed. The difference between the continuous and discontinuous type of material transition in the interface is described. Flat laminated materials are at first considered. For this type of composite bodies thermal stresses and thermal residual stresses are elastically-plastically calculated. (orig.) [de
Chemical compatibility between cladding alloys and advanced fuels
International Nuclear Information System (INIS)
Fee, D.C.; Johnson, C.E.
1975-05-01
The National Advanced Fuels Program requires chemical, mechanical, and thermophysical properties data for cladding alloys. The compatibility behavior of cladding alloys with advanced fuels is critically reviewed. in carbide fuel pins, the principal compatibility problem is cladding carburization, diffusion of carbon into the cladding matrix accompanied by carbide precipitation. Carburization changes the mechanical properties of the cladding alloy. The extent of carburization increases in sodium (versus gas) bonded fuels. The depth of carburization increases with increasing sesquicarbide (M 2 C 3 ) content of the fuel. In nitride fuel pins, the principal compatibility problem is cladding nitriding, diffusion of nitrogen into the cladding matrix accompanied by nitride precipitation. Nitriding changes the mechanical properties of the cladding alloy. In both carbide and nitride fuel pins, fission products do not migrate appreciably to the cladding and do not appear to contribute to cladding attack. 77 references. (U.S.)
The Construal (In)compatibility Effect
DEFF Research Database (Denmark)
Yang, Xiaojing; Ringberg, Torsten; Mao, Huifang
2011-01-01
incompatible with their mental construal, while ad claims construed at a level compatible with consumers' mental construal are more effective for those who possess a less creative mindset. We document that such differences in persuasion are driven by the fact that consumers with a creative (less creative) mind...
Direct coordinate-free derivation of the compatibility equation for finite strains
Ryzhak, E. I.
2014-07-01
The compatibility equation for the Cauchy-Green tensor field (squared tensor of pure extensionwith respect to the reference configuration) is directly derived from the well-known relation expressing this tensor via the vector field determining the mapping (transformation) of the reference configuration into the actual one. The derivation is based on the use of the apparatus of coordinatefree tensor calculus and does not apply any notions and relations of Riemannian geometry at all. The method is illustrated by deriving the well-known compatibility equation for small strains. It is shown that when the obtained compatibility equation for finite strains is linearized, it becomes the compatibility equation for small strains which indirectly confirms its correctness.
DOD Offshore Wind Mission Compatibility Assessments
National Oceanic and Atmospheric Administration, Department of Commerce — This data set represents the results of analyses conducted by the Department of Defense to assess the compatibility of offshore wind development with military assets...
Double Retort System for Materials Compatibility Testing
International Nuclear Information System (INIS)
V. Munne; EV Carelli
2006-01-01
With Naval Reactors (NR) approval of the Naval Reactors Prime Contractor Team (NRPCT) recommendation to develop a gas cooled reactor directly coupled to a Brayton power conversion system as the Space Nuclear Power Plant (SNPP) for Project Prometheus (References a and b) there was a need to investigate compatibility between the various materials to be used throughout the SNPP. Of particular interest was the transport of interstitial impurities from the nickel-base superalloys, which were leading candidates for most of the piping and turbine components to the refractory metal alloys planned for use in the reactor core. This kind of contamination has the potential to affect the lifetime of the core materials. This letter provides technical information regarding the assembly and operation of a double retort materials compatibility testing system and initial experimental results. The use of a double retort system to test materials compatibility through the transfer of impurities from a source to a sink material is described here. The system has independent temperature control for both materials and is far less complex than closed loops. The system is described in detail and the results of three experiments are presented
Electromagnetic compatibility methods, analysis, circuits, and measurement
Weston, David A
2016-01-01
Revised, updated, and expanded, Electromagnetic Compatibility: Methods, Analysis, Circuits, and Measurement, Third Edition provides comprehensive practical coverage of the design, problem solving, and testing of electromagnetic compatibility (EMC) in electrical and electronic equipment and systems. This new edition provides novel information on theory, applications, evaluations, electromagnetic computational programs, and prediction techniques available. With sixty-nine schematics providing examples for circuit level electromagnetic interference (EMI) hardening and cost effective EMI problem solving, this book also includes 1130 illustrations and tables. Including extensive data on components and their correct implementation, the myths, misapplication, misconceptions, and fallacies that are common when discussing EMC/EMI will also be addressed and corrected.
Sluis, J. van der
2000-01-01
In this report, a literature review is given on the subject of crash compatibility and incompatibility between cars. The study is based on scientific publications on this subject published over the last 15 years. The compatibility problem is described from three points of view: statistical,
Analysis of Advanced CI Applications
1981-03-01
rner Street Boston, ,/iA 021 10 Atcn« L,r. Fred Quelle AF^L/Of (ianscum AHB, MA 01/31 Atun « ./r. John Oanny AF..L/AL0 Kirtiand AHB...M d/11 / Atun « .jr. J. d. Hoyye ArJC/OL Andrew^ Ar’d, DO 20.334 Atv,n« oapt Oyole AFdC/X^rU Andrews Af-d, ÜO 20334 8 10 II...8217’■ ..:., ■■ . >. ■ — Ini Mil/Li;icoin Lab H. ). üux l-i Le ; in ji-on, MA U^l /.j Atun » iJr. ü. üreenwooj 4U Naval
Rust transformation/rust compatible primers
Emeric, Dario A.; Miller, Christopher E.
1993-01-01
Proper surface preparation has been the key to obtain good performance by a surface coating. The major obstacle in preparing a corroded or rusted surface is the complete removal of the contaminants and the corrosion products. Sandblasting has been traditionally used to remove the corrosion products before painting. However, sandblasting can be expensive, may be prohibited by local health regulations and is not applicable in every situation. To get around these obstacles, Industry developed rust converters/rust transformers and rust compatible primers (high solids epoxies). The potential use of these products for military equipment led personnel of the Belvoir Research, Development and Engineering Center (BRDEC) to evaluate the commercially available rust transformers and rust compatible primers. Prior laboratory experience with commercially available rust converters, as well as field studies in Hawaii and Puerto Rico, revealed poor performance, several inherent limitations, and lack of reliability. It was obvious from our studies that the performance of rust converting products was more dependent on the amount and type of rust present, as well as the degree of permeability of the coating, than on the product's ability to form an organometallic complex with the rust. Based on these results, it was decided that the Military should develop their own rust converter formulation and specification. The compound described in the specification is for use on a rusted surface before the application of an organic coating (bituminous compounds, primer or topcoat). These coatings should end the need for sandblasting or the removing of the adherent corrosion products. They also will prepare the surface for the application of the organic coating. Several commercially available rust compatible primers (RCP) were also tested using corroded surfaces. All of the evaluated RCP failed our laboratory tests for primers.
Nonclassical Symmetries for Nonlinear Partial Differential Equations via Compatibility
International Nuclear Information System (INIS)
El-Sabbagh, Mostafa F.; Ahmad, Ali T.
2011-01-01
The determining equations for the nonclassical symmetry reductions of nonlinear partial differential equations with arbitrary order can be obtained by requiring the compatibility between the original equations and the invariant surface conditions. The (2+1)-dimensional shallow water wave equation, Boussinesq equation, and the dispersive wave equations in shallow water serve as examples illustrating how compatibility leads quickly and easily to the determining equations for their nonclassical symmetries. (general)
Electromagnetic compatibility in power electronics
Costa , François; Revol , Bertrand
2014-01-01
Scientists largely attribute the recent deterioration of the electromagnetic environment to power electronics. This realization has spurred the study of methodical approaches to electromagnetic compatibility designs as explored in this text. The book addresses major challenges, such as handling numerous parameters vital to predicting electro magnetic effects and achieving compliance with line-harmonics norms, while proposing potential solutions.
Discoidin Domain Receptor 1 Mediates Myosin-Dependent Collagen Contraction
Directory of Open Access Journals (Sweden)
Nuno M. Coelho
2017-02-01
Full Text Available Discoidin domain receptor 1 (DDR1 is a tyrosine kinase collagen adhesion receptor that mediates cell migration through association with non-muscle myosin IIA (NMIIA. Because DDR1 is implicated in cancer fibrosis, we hypothesized that DDR1 interacts with NMIIA to enable collagen compaction by traction forces. Mechanical splinting of rat dermal wounds increased DDR1 expression and collagen alignment. In periodontal ligament of DDR1 knockout mice, collagen mechanical reorganization was reduced >30%. Similarly, cultured cells with DDR1 knockdown or expressing kinase-deficient DDR1d showed 50% reduction of aligned collagen. Tractional remodeling of collagen was dependent on DDR1 clustering, activation, and interaction of the DDR1 C-terminal kinase domain with NMIIA filaments. Collagen remodeling by traction forces, DDR1 tyrosine phosphorylation, and myosin light chain phosphorylation were increased on stiff versus soft substrates. Thus, DDR1 clustering, activation, and interaction with NMIIA filaments enhance the collagen tractional remodeling that is important for collagen compaction in fibrosis.
46 CFR 153.436 - Heat transfer fluids: compatibility with cargo.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Heat transfer fluids: compatibility with cargo. 153.436... Equipment Cargo Temperature Control Systems § 153.436 Heat transfer fluids: compatibility with cargo. A heat transfer fluid separated from the cargo by only one wall (for example, the heat transfer fluid in a coil...
Compatibility of heat resistant alloys with boron carbide, 5
International Nuclear Information System (INIS)
Baba, Shinichi; Kurasawa, Toshimasa; Endow, Taichi; Someya, Hiroyuki; Tanaka, Isao.
1986-08-01
This paper includes an experimental result of out-of-pile compatibility and capsule design for irradiation test in Japan Materials Testing Reactor (JMTR). The compatibility between sheath material and neutron absorber materials for control rod devices (CRD) was examined for potential use in a very high temperature reactor (VHTR) which is under development at JAERI. The purpose of the compatibility tests are preliminary evaluation of safety prior to irradiation tests. Preliminary compatibility evaluation was concerned with three items as follows : 1) Lithium effects on the penetrating reaction of Incoloy 800H alloy in contact with a mixture of boronated graphite and lithium hydroxide powders, 2) Short term tensile properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite and fracture mode analysis, 3) Reaction behavior of both alloys under transient power conditions of a VHTR. It was clear that the reaction rate constant of the Incoloy 800H alloy was accelerated by doping lithium hydroxide into the boron carbide and graphite powder. The mechanical properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite were decreased. Ultimate tensile strength and tensile ductilities at temperatures over 850 deg C were reduced, but there was no change in the proof (yield) stress. Both alloys exhibited a brittle intergranular fracture mode during transient power conditions of a VHTR and also exhibited severe penetration. Irradiation capsules for compatibility test were designed to simulate three irradiation conditions of VHTR: 1) steady state for VHTR, 2) Transient power condition, 3) Service limited life of CRD. Capsule irradiation experiments have been carried out satisfactorily and thus confirm the validity of the capsule design procedure. (author)
Synthesis of artificial spectrum-compatible seismic accelerograms
International Nuclear Information System (INIS)
Vrochidou, E; Alvanitopoulos, P F; Andreadis, I; Mallousi, K; Elenas, A
2014-01-01
The Hilbert–Huang transform is used to generate artificial seismic signals compatible with the acceleration spectra of natural seismic records. Artificial spectrum-compatible accelerograms are utilized instead of natural earthquake records for the dynamic response analysis of many critical structures such as hospitals, bridges, and power plants. The realistic estimation of the seismic response of structures involves nonlinear dynamic analysis. Moreover, it requires seismic accelerograms representative of the actual ground acceleration time histories expected at the site of interest. Unfortunately, not many actual records of different seismic intensities are available for many regions. In addition, a large number of seismic accelerograms are required to perform a series of nonlinear dynamic analyses for a reliable statistical investigation of the structural behavior under earthquake excitation. These are the main motivations for generating artificial spectrum-compatible seismic accelerograms and could be useful in earthquake engineering for dynamic analysis and design of buildings. According to the proposed method, a single natural earthquake record is deconstructed into amplitude and frequency components using the Hilbert–Huang transform. The proposed method is illustrated by studying 20 natural seismic records with different characteristics such as different frequency content, amplitude, and duration. Experimental results reveal the efficiency of the proposed method in comparison with well-established and industrial methods in the literature. (paper)
Wood, Benjamin T.; Quinn, Claire H.; Stringer, Lindsay C.; Dougill, Andrew J.
2017-09-01
Governments and donors are investing in climate compatible development in order to reduce climate and development vulnerabilities. However, the rate at which climate compatible development is being operationalised has outpaced academic enquiry into the concept. Interventions aiming to achieve climate compatible development "wins" (for development, mitigation, adaptation) can also create negative side-effects. Moreover, benefits and negative side-effects may differ across time and space and have diverse consequences for individuals and groups. Assessments of the full range of outcomes created by climate compatible development projects and their implications for distributive justice are scarce. This article develops a framework using a systematic literature review that enables holistic climate compatible development outcome evaluation over seven parameters identified. Thereafter, we explore the outcomes of two donor-funded projects that pursue climate compatible development triple-wins in Malawi using this framework. Household surveys, semi-structured interviews and documentary material are analysed. Results reveal that uneven outcomes are experienced between stakeholder groups and change over time. Although climate compatible development triple-wins can be achieved through projects, they do not represent the full range of outcomes. Ecosystem—and community-based activities are becoming popularised as approaches for achieving climate compatible development goals. However, findings suggest that a strengthened evidence base is required to ensure that these approaches are able to meet climate compatible development goals and further distributive justice.
Breeding graft-compatible Douglas-fir rootstocks (Pseudotsuga menziesii (Mirb.) Franco).
D.L. Copes
1999-01-01
A study encompassing 24 years was conducted to determine if a breeding program could produce highly graft-compatible rootstocks. Twenty-seven trees of apparent high graft compatibility were selected and crossed to produce 226 control-pollinated families. Seedlings were grown, field planted, and grafted with test scions. Graft unions from field tests were evaluated...
Application of Hilbert-Huang Transform in Generating Spectrum-Compatible Earthquake Time Histories
Ni, Shun-Hao; Xie, Wei-Chau; Pandey, Mahesh
2011-01-01
Spectrum-compatible earthquake time histories have been widely used for seismic analysis and design. In this paper, a data processing method, Hilbert-Huang transform, is applied to generate earthquake time histories compatible with the target seismic design spectra based on multiple actual earthquake records. Each actual earthquake record is decomposed into several components of time-dependent amplitude and frequency by Hilbert-Huang transform. The spectrum-compatible earthquake time history ...
Stephan, Denise Nadine; Koch, Iring
2010-01-01
Two experiments examined the role of compatibility of input and output (I-O) modality mappings in task switching. We define I-O modality compatibility in terms of similarity of stimulus modality and modality of response-related sensory consequences. Experiment 1 included switching between 2 compatible tasks (auditory-vocal vs. visual-manual) and…
Energetic materials standards – Chemical compatibility
Tuukkanen, I.M.; Bouma, R.H.B.
2014-01-01
Subgroup A Energetic Materials Team, SG/A (EMT), develops and maintains standards that are relevant to all life-cycle phases of ammunition/weapon systems. STANAG 4147 is the standard regarding chemical compatibility of explosives with munition components, and is a document of prime importance.
Biochemical mechanisms determine the functional compatibility of heterologous genes
DEFF Research Database (Denmark)
Porse, Andreas; Schou, Thea S.; Munck, Christian
2018-01-01
-gene libraries have suggested that sequence composition is a strong barrier for the successful integration of heterologous genes. Here we sample 200 diverse genes, representing >80% of sequenced antibiotic resistance genes, to interrogate the factors governing genetic compatibility in new hosts. In contrast...... factors governing the functionality and fitness of antibiotic resistance genes. These findings emphasize the importance of biochemical mechanism for heterologous gene compatibility, and suggest physiological constraints as a pivotal feature orienting the evolution of antibiotic resistance....
Backward compatibility as a key measure for smooth upgrades to the LHC control system
International Nuclear Information System (INIS)
Baggiolini, V.; Csikos, D.; Tarasenko, P.; Zaharieva, Z.; Arruat, M.; Gorbosonov, R.
2012-01-01
It is a big challenge to smoothly upgrade the control system of a large operational accelerator such as the LHC without causing unnecessary downtime. We have identified backward compatibility as a key measure to achieve this, because a backward compatible component can be easily upgraded. This document describes the work the CERN Accelerator Controls group does to provide methods and tools supporting backward compatibility. We have identified four areas for which we want to provide tools: (1) dependency analysis to identify incoming dependencies, (2) backward compatibility validation to verify that API (Application Program Interface) changes are really backward compatible, (3) version upgrading with rules to clearly inform the dependent clients if a modification is backward compatible, and (4) API consolidation to clearly specify classes and methods belonging to the API and to enforce their appropriate usage
Compatibility of niobium, titanium, and vanadium metals with LMFBR cladding
International Nuclear Information System (INIS)
Wilson, C.N.
1975-10-01
A series of laboratory capsule annealing experiments were conducted to assess the compatibility of niobium, vanadium, and titanium with 316 stainless steel cladding in the temperature range of 700 to 800 0 C. Niobium, vanadium, and titanium are cantidate oxygen absorber materials for control of oxygen chemistry in LMFBR fuel pins. Capsule examination indicated good compatibility between niobium and 316 stainless steel at 800 0 C. Potential compatibility problems between cladding and vanadium or titanium were indicated at 800 0 C under reducing conditions. In the presence of Pu/sub 0.25/U/sub 0.75/O/sub 1.98/ fuel (Δanti G 02 congruent to -160 kcal/mole) no reaction was observed between vanadium or titanium and cladding at 800 0 C
Compatibility of Motion Facilitates Visuomotor Synchronization
Hove, Michael J.; Spivey, Michael J.; Krumhansl, Carol L.
2010-01-01
Prior research indicates that synchronized tapping performance is very poor with flashing visual stimuli compared with auditory stimuli. Three finger-tapping experiments compared flashing visual metronomes with visual metronomes containing a spatial component, either compatible, incompatible, or orthogonal to the tapping action. In Experiment 1,…
A JPEG backward-compatible HDR image compression
Korshunov, Pavel; Ebrahimi, Touradj
2012-10-01
High Dynamic Range (HDR) imaging is expected to become one of the technologies that could shape next generation of consumer digital photography. Manufacturers are rolling out cameras and displays capable of capturing and rendering HDR images. The popularity and full public adoption of HDR content is however hindered by the lack of standards in evaluation of quality, file formats, and compression, as well as large legacy base of Low Dynamic Range (LDR) displays that are unable to render HDR. To facilitate wide spread of HDR usage, the backward compatibility of HDR technology with commonly used legacy image storage, rendering, and compression is necessary. Although many tone-mapping algorithms were developed for generating viewable LDR images from HDR content, there is no consensus on which algorithm to use and under which conditions. This paper, via a series of subjective evaluations, demonstrates the dependency of perceived quality of the tone-mapped LDR images on environmental parameters and image content. Based on the results of subjective tests, it proposes to extend JPEG file format, as the most popular image format, in a backward compatible manner to also deal with HDR pictures. To this end, the paper provides an architecture to achieve such backward compatibility with JPEG and demonstrates efficiency of a simple implementation of this framework when compared to the state of the art HDR image compression.
A research project to encourage system-compatible design of end-use appliances
International Nuclear Information System (INIS)
Dorr, D.; Key, T.; Sitzlar, G.
1995-01-01
Cooperative system compatibility research sponsored by the Canadian Electrical Association (CEA) and the Electric Power Research Institute (EPRI) for improving appliance performance deficiencies was described. Power producer and end-user compatibility concerns was addressed through the development of a System Compatibility Research Project. A list of project tasks was provided. The CEA and EPRI initiated a project to establish flicker response of various lighting systems, which included physical tests. Results of this project were presented and discussed. The incentives for developing switch mode power supplies with enhanced immunity to voltage fluctuations and short interruptions was discussed. It was concluded that power quality studies currently underway will provide designers with a profile of the expected utility environment for their products. System compatibility research will identify areas that should be addressed by standards bodies so that designers can apply applicable criteria objectives early in the appliance design process. These efforts were expected to encourage appropriate manufacturer criteria for compatibility by convincing buyers and sellers that there is a real pay back for this investment. 13 refs., 6 figs., 4 tabs
2014-09-18
Approach to DOT GPS Adjacent Band Compatibility Assessment. Identify forums and provide public outreach to make sure the progress and work are as open and transparent as possible. Develop an implementation plan that incorporates aspects from the DOT ...
Stiffness compatibility of coralline hydroxyapatite bone substitute under dynamic loading
Institute of Scientific and Technical Information of China (English)
REN ChaoFeng; HOU ZhenDe; ZHAO Wei
2009-01-01
When hydroxyapatite bone substitutes are implanted in human bodies, bone tissues will grow into their porous structure, which will reinforce their strength and stiffness. The concept of mechanical com-patibility of bone substitutes implies that their mechanical properties are similar to the bone tissues around, as if they were part of the bone. The mechanical compatibility of bone substitutes includes both static and dynamic behavior, due to the mechanical properties of bone depending on the strain rate. In this study, split Hopkinson pressure bar technique (SHPB) was employed to determine the dy-namic mechanical properties of coralline hydroxyapatite, bones with and bones without organic com-ponents, and their dynamic stress-strain curves of the three materials were obtained. The mechanical effects of collagens in bone were assessed, by comparing the difference between the Young's moduli of the three materials. As the implanted bone substitute becomes a part of bone, it can be regarded as an inclusion composite. The effective modulus of the composite was also evaluated in order to estimate its mechanical compatibility on stiffness. The evaluated result shows that the suitable porosity of HA is0.8, which is in favor of both static and dynamic stiffness compatibility.
Mating compatibility in the parasitic protist Trypanosoma brucei.
Peacock, Lori; Ferris, Vanessa; Bailey, Mick; Gibson, Wendy
2014-02-21
Genetic exchange has been described in several kinetoplastid parasites, but the most well-studied mating system is that of Trypanosoma brucei, the causative organism of African sleeping sickness. Sexual reproduction takes place in the salivary glands (SG) of the tsetse vector and involves meiosis and production of haploid gametes. Few genetic crosses have been carried out to date and consequently there is little information about the mating compatibility of different trypanosomes. In other single-celled eukaryotes, mating compatibility is typically determined by a system of two or more mating types (MT). Here we investigated the MT system in T. brucei. We analysed a large series of F1, F2 and back crosses by pairwise co-transmission of red and green fluorescent cloned cell lines through experimental tsetse flies. To analyse each cross, trypanosomes were cloned from fly SG containing a mixture of both parents, and genotyped by microsatellites and molecular karyotype. To investigate mating compatibility at the level of individual cells, we directly observed the behaviour of SG-derived gametes in intra- or interclonal mixtures of red and green fluorescent trypanosomes ex vivo. Hybrid progeny were found in all F1 and F2 crosses and most of the back crosses. The success of individual crosses was highly variable as judged by the number of hybrid clones produced, suggesting a range of mating compatibilities among F1 progeny. As well as hybrids, large numbers of recombinant genotypes resulting from intraclonal mating (selfers) were found in some crosses. In ex vivo mixtures, red and green fluorescent trypanosome gametes were observed to pair up and interact via their flagella in both inter- and intraclonal combinations. While yellow hybrid trypanosomes were frequently observed in interclonal mixtures, such evidence of cytoplasmic exchange was rare in the intraclonal mixtures. The outcomes of individual crosses, particularly back crosses, were variable in numbers of both
A low-cost MRI compatible keyboard
DEFF Research Database (Denmark)
Jensen, Martin Snejbjerg; Heggli, Ole Adrian; Alves da Mota, Patricia
2017-01-01
, presenting a challenging environment for playing an instrument. Here, we present an MRI-compatible polyphonic keyboard with a materials cost of 850 $, designed and tested for safe use in 3T (three Tesla) MRI-scanners. We describe design considerations, and prior work in the field. In addition, we provide...
Automation of electromagnetic compatability (EMC) test facilities
Harrison, C. A.
1986-01-01
Efforts to automate electromagnetic compatibility (EMC) test facilities at Marshall Space Flight Center are discussed. The present facility is used to accomplish a battery of nine standard tests (with limited variations) deigned to certify EMC of Shuttle payload equipment. Prior to this project, some EMC tests were partially automated, but others were performed manually. Software was developed to integrate all testing by means of a desk-top computer-controller. Near real-time data reduction and onboard graphics capabilities permit immediate assessment of test results. Provisions for disk storage of test data permit computer production of the test engineer's certification report. Software flexibility permits variation in the tests procedure, the ability to examine more closely those frequency bands which indicate compatibility problems, and the capability to incorporate additional test procedures.
CMOS-compatible photonic devices for single-photon generation
Directory of Open Access Journals (Sweden)
Xiong Chunle
2016-09-01
Full Text Available Sources of single photons are one of the key building blocks for quantum photonic technologies such as quantum secure communication and powerful quantum computing. To bring the proof-of-principle demonstration of these technologies from the laboratory to the real world, complementary metal–oxide–semiconductor (CMOS-compatible photonic chips are highly desirable for photon generation, manipulation, processing and even detection because of their compactness, scalability, robustness, and the potential for integration with electronics. In this paper, we review the development of photonic devices made from materials (e.g., silicon and processes that are compatible with CMOS fabrication facilities for the generation of single photons.
Inhibition of HIV-1 infection by synthetic peptides derived CCR5 fragments
International Nuclear Information System (INIS)
Imai, Masaki; Baranyi, Lajos; Okada, Noriko; Okada, Hidechika
2007-01-01
HIV-1 infection requires interaction of viral envelope protein gp160 with CD4 and a chemokine receptor, CCR5 or CXCR4 as entry coreceptor. We designed HIV-inhibitory peptides targeted to CCR5 using a novel computer program (ANTIS), which searched all possible sense-antisense amino acid pairs between proteins. Seven AHBs were found in CCR5 receptor. All AHB peptides were synthesized and tested for their ability to prevent HIV-1 infection to human T cells. A peptide fragment (LC5) which is a part of the CCR5 receptor corresponding to the loop between the fifth and sixth transmembrane regions (amino acids 222-240) proved to inhibit HIV-1 IIIB infection of MT-4 cells. Interaction of these antisense peptides could be involved in sustaining HIV-1 infectivity. LC5 effectively indicated dose-dependent manner, and the suppression was enhanced additively by T20 peptide, which inhibits infection in vitro by disrupting the gp41 conformational changes necessary for membrane fusion. Thus, these results indicate that CCR5-derived AHB peptides could provide a useful tool to define the mechanism(s) of HIV infection, and may provide insight which will contribute to the development of an anti-HIV-1 reagent
Semugoma, Paul; Beyrer, Chris; Baral, Stefan
2012-01-01
Uganda's response to the HIV epidemic has been lauded for its robustness and achievements. However, a key component of HIV prevention programming has been missing, for men who have sex with men (MSM). The main reason cited has been criminalization of male homosexual behavior. In 2009, the Anti-Homosexuality Bill (AHB) was introduced in the parliament to enhance existing anti-homosexuality law. A multi-disciplinary team made a Health Impact Assessment of the proposed AHB. The bill as tabled would severely increase punishments, increased closeting. Social capital of MSM would be eroded by clauses mandating reporting by friends, relatives, and acquaintances. Health-care professionals would have to inform on homosexuals. Mandatory HIV testing would be a blow to programming. Probable disclosure of HIV status in a public space (court) would also be a deterrent. Heftier punishments for those testing positive increases stigma and hobbles subsequent care. The AHB argues for exclusion, and more discrimination targeting persons living with HIV and sexual minorities. It will exacerbate the negative public health consequences of the existing legislation. The government of Uganda should review guidance documents published by authoritative bodies including the World Bank, World Health Organization to develop and bring to scale Human rights-affirming HIV prevention, treatment, and care responses.
Directory of Open Access Journals (Sweden)
Xue-Song Liang
2012-05-01
Full Text Available Abstract Background Many studies suggest that in chronic hepatitis B virus (HBV infection regulate T (Treg cells and interlukin-17-producing T help cells (Th17 are mutually antagonistic in the immune response. This study is aimed to reveal the cell differentiation environment and the significance of Treg and Th17 balance in the development of acute and chronic HBV infection. Methods Ten patients with acute HBV infection (AHB and forty-eight patients with chronic HBV infection, including 12 asymptomatic HBV carriers (HBV carriers, 18 chronic hepatitis B patients (CHB and 18 acute-on-chronic HBV-related liver failure (ACHBLF were enrolled. Treg and Th17 cells differentiation related cytokine levels were detected by using ELISA. Flow cytometry was employed to count the Treg and Th17 frequency in peripheral blood. Results Compared to health controls both AHB and ACHBLF patients favoured Th17 cell differentiation, accompanied by a higher proportion of peripheral Th17 cells (P Conclusions Th17 cells are involved in acute and chronic HBV infection, especially in AHB and ACHBLF. CHB and ACHBLF patients manifested obvious Treg/Th17 ratio imbalance, which might be linked to disease progression and the continuous HBV infection.
Compatibility grab sampling and analysis plan for fiscal year 1999
International Nuclear Information System (INIS)
SASAKI, L.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for grab samples obtained to address waste compatibility. Analytical requirements are taken from two revisions of the Compatibility data quality objectives (DQOs). Revision 1 of the DQO (Fowler 1995) listed analyses to be performed to meet both safety and operational data needs for the Compatibility program. Revision 2A of the DQO (Mulkey and Miller 1998) addresses only the safety-related requirements; the operational requirements of Fowler (1995) have not been superseded by Mulkey and Miller (1998). Therefore, safety-related data needs are taken from Mulkey and Miller (1998) and operational-related data needs are taken from Fowler (1995). Ammonia and total alpha analyses are also performed in accordance with Fowler (1998a, 1998b)
Elements of a compatible optimization theory for coupled systems
International Nuclear Information System (INIS)
Bonnemay, A.
1969-01-01
The first theory deals with the compatible optimization in coupled systems. A game theory for two players and with a non-zero sum is first developed. The conclusions are then extended to the case of a game with any finite number of players. After this essentially static study, the dynamic aspect of the problem is applied to the case of games which evolve. By applying PONTRYAGIN maximum principle it is possible to derive a compatible optimisation theorem which constitutes a necessary condition. (author) [fr
Improvement of crash compatibility between cars
Huibers, J.A.H.M.; Faerber, E.; Cesari, D.; Hobbs, A.C.; Kampen, B. van; Paez, J.; Wykes, N.J.
1998-01-01
This paper will provide an overview of the research work of the European Enhanced Vehicle-safety Committee (EEVC) in the field of crash compatibility between passenger cars. Since July 1997 the EC Commission is partly funding the research work of EEVC. The running period of this project will be two
Are Naturalism and Moral Realism Compatible?
Peels, H.D.
2014-01-01
In a recent paper, Alvin Plantinga has argued that there is good reason to think that naturalism and moral realism are incompatible. He has done so by arguing that the most important argument for the compatibility of these two theses, which has been provided by Frank Jackson, fails and that any
Directory of Open Access Journals (Sweden)
Fábio Pinto
2016-04-01
Resumo. As abelhas africanizadas (AHB são conhecidas por sua alta produtividade e tolerância a patógenos e parasitas como o ácaro Varroa destructor. Em contraste à s caracterÃsticas vantajosas, as AHB são consideradas altamente defensivas necessitando de certos cuidados em seu manejo. Entretanto, poucos estudos relatam caracterÃsticas especÃficas sobre os padrões de comportamento de AHB na apicultura brasileira. Nesse contexto, o objetivo do trabalho foi avaliar o repertório do comportamento defensivo (DB em AHB, identificando a importância de condições climáticas e estÃmulos visuais nesta caracterÃstica, bem como gradiente de agressividade dentre as colônias. Os aspectos relacionados ao comportamento defensivo foram avaliados pelo método de Stort com adaptações. Foram encontradas diferenças entre as colônias em relação à velocidade do primeiro ataque e intensidade de ataque (p<0.05%, por outro lado os padrões de DB não foram afetados pela variação de temperatura durante os perÃodos de avaliação. Todos os ataques se iniciaram pela parte preta da esfera alvo, contudo após o primeiro ataque ambos os lados (preto e branco sofreram ataques. Tal fato indica que embora as pistas visuais possuam um papel relavente na defesa das colônias, sinais quÃmicos (feromônios de alarme atuam na manutenção e aumento do possÃvel alvo. Pôde-se também identificar uma grande variação nos padrões defensivos dentre as colônias estudadas, fator esperado devido a grande variabilidade genética presente em AHB. Por sua vez, a avaliação do DB possui um importante papel na seleção e melhoramento de colônias visando à seleção de caracterÃsticas benéficas como alta produtividade de mel e baixa agressividade durante o manejo.
The Effect of Image Compatibility and Escalation of Commitment on Decision Performance
Directory of Open Access Journals (Sweden)
Harris K. Turino
2012-04-01
Full Text Available This study aims at empirically examining the extent to which Image Theory, initially developed as a theoretical basis for selecting a strategy or a decision, can be a theoretical basis for predicting a decision performance in two opposite frames: positive and negative. Image compatibility are employed to operationalize such a theory and the decision under study is progress decision represented by escalation of commitment. Thus, this study also empirically examines the connection between image compatibility and escalation of commitment as well as escalation of commitment as a mediator of the relationship between image compatibility and decision performance. The research context is Indonesia Stock Exchange (IDX that suffered from crisis in the past year (negative frame yet has been recovered recently (positive frame. The respondents are 229 individual investors in IDX. They are involved in day-to-day decision making (progress decision making with regard to their investment portofolio. The results of this study show that high image compatibility tends to lead to better decision performance in both frames. However, image compatibility may only positively affect the escalation of commitment in positive frame
Conflicting Multi-Objective Compatible Optimization Control
Xu, Lihong; Hu, Qingsong; Hu, Haigen; Goodman, Erik
2010-01-01
Based on ideas developed in addressing practical greenhouse environmental control, we propose a new multi-objective compatible control method. Several detailed algorithms are proposed to meet the requirements of different kinds of problem: 1) A two-layer MOCC framework is presented for problems with a precise model; 2) To deal with situations
Preparation of refractory cermet structures for lithium compatibility testing
Heestand, R. L.; Jones, R. A.; Wright, T. R.; Kizer, D. E.
1973-01-01
High-purity nitride and carbide cermets were synthesized for compatability testing in liquid lithium. A process was developed for the preparation of high-purity hafnium nitride powder, which was subsequently blended with tungsten powder or tantalum nitride and tungsten powders and fabricated into 3 in diameter billets by uniaxial hot pressing. Specimens were then cut from the billets for compatability testing. Similar processing techniques were applied to produce hafnium carbide and zirconium carbide cermets for use in the testing program. All billets produced were characterized with respect to chemistry, structure, density, and strength properties.
Stiffness compatibility of coralline hydroxyapatite bone substitute under dynamic loading
Institute of Scientific and Technical Information of China (English)
无
2009-01-01
When hydroxyapatite bone substitutes are implanted in human bodies,bone tissues will grow into their porous structure,which will reinforce their strength and stiffness.The concept of mechanical com-patibility of bone substitutes implies that their mechanical properties are similar to the bone tissues around,as if they were part of the bone.The mechanical compatibility of bone substitutes includes both static and dynamic behavior,due to the mechanical properties of bone depending on the strain rate.In this study,split Hopkinson pressure bar technique(SHPB) was employed to determine the dy-namic mechanical properties of coralline hydroxyapatite,bones with and bones without organic com-ponents,and their dynamic stress-strain curves of the three materials were obtained.The mechanical effects of collagens in bone were assessed,by comparing the difference between the Young’s moduli of the three materials.As the implanted bone substitute becomes a part of bone,it can be regarded as an inclusion composite.The effective modulus of the composite was also evaluated in order to estimate its mechanical compatibility on stiffness.The evaluated result shows that the suitable porosity of HA is 0.8,which is in favor of both static and dynamic stiffness compatibility.
Blood compatibility assessment of graft copolymer (NR-g-DMAA) tubes
International Nuclear Information System (INIS)
Razzak, M.T.; Otsuhata, Kazushige; Tabata, Yoneho; Ohashi, Fumio; Takeuchi, Atsuki
1992-01-01
Graft copolymer (NR-g-DMAA) tubes have been prepared using simultaneous radiation induced grafting of N,N-dimethyl-acrylamide, (DMAA) onto natural rubber (NR) tubes. The blood compatibility of the NR-g-DMAA tubes was assessed with three methods, namely in vitro test, ex vivo once through test and ex vivo loops test. In the case of the in vitro test, a simple whole blood contacting procedure has been employed. The ex vivo once through test involves the exposing of NR-g-DMAA tubes with once through flow of fresh canine blood and then it was inspected for any evidence of clot. In the case of ex vivo loops test, the NR-g-DMAA tube was implanted at external jugular vein of a mongrel canine and the blood flow in the NR-g-DMAA tube was detected with an ultrasonic flow meter. It was found that the blood compatibility of NR-g-DMAA tubes is improved significantly with the increasing degree of grafting. All the NR-g-DMAA tubes having a degree of grafting of about 30 wt% or more exhibit good blood compatibility. It was found that the blood compatibility of the NR-g-DMAA tube is better than that of a medical grade silicon rubber (SiR) tube. (Author)
On The compatibility and dynamic vulcanization of Pom/Nbr blends
International Nuclear Information System (INIS)
Mortezaee, M.; Naveed Family, M.H.; Mehrabzadeh, M.
2001-01-01
Polymer blends based on polyacetal butadiene rubber were prepared by melt blending technique. The mixing parameters such ad temperature, time and speed of mixing were varied to obtain a wide range of properties. The mixing parameters were optimized by evaluating the mechanical properties of the blend over a wide range of mixing conditions. The morphology of the blend indicated a two-phase structure. This study describes an attempt to improve the tensile strength of Pom/Nbr blends by means of compatibility and dynamic vulcanization. A commercial compatibility, maleic anhydride (Ma), has been used to control the phase morphology of the blend system. Dicumyl peroxide is used to dynamically vulcanize the Nbr elastomer in the blend. The tensile strength of the compatibility systems showed improvement. Dynamic vulcanization raises elastic recovery and tensile modulus of the blends, but the elongation at break decreases
High-Field MRI-Compatible Needle Placement Robot for Prostate Interventions
SU, Hao; CAMILO, Alex; COLE, Gregory A.; HATA, Nobuhiko; TEMPANY, Clare M.; FISCHER, Gregory S.
2014-01-01
This paper presents the design of a magnetic resonance imaging (MRI) compatible needle placement system actuated by piezoelectric actuators for prostate brachytherapy and biopsy. An MRI-compatible modular 3 degree-of-freedom (DOF) needle driver module coupled with a 3-DOF x-y-z stage is proposed as a slave robot to precisely deliver radioactive brachytherapy seeds under interactive MRI guidance. The needle driver module provides for needle cannula rotation, needle insertion and cannula retraction to enable the brachytherapy procedure with the preloaded needles. The device mimics the manual physician gesture by two point grasping (hub and base) and provides direct force measurement of needle insertion force by fiber optic force sensors. The fabricated prototype is presented and an experiment with phantom trials in 3T MRI is analyzed to demonstrate the system compatibility. PMID:21335868
Espino, Orlando; Byrne, Ruth M J
2013-11-01
A new theory explains how people make hypothetical inferences from a premise consistent with several alternatives to a conclusion consistent with several alternatives. The key proposal is that people rely on a heuristic that identifies compatible possibilities. It is tested in 7 experiments that examine inferences between conditionals and disjunctions. Participants accepted inferences between conditionals and inclusive disjunctions when a compatible possibility was immediately available, in their binary judgments that a conclusion followed or not (Experiment 1a) and ternary judgments that included it was not possible to know (Experiment 1b). The compatibility effect was amplified when compatible possibilities were more readily available, e.g., for 'A only if B' conditionals (Experiment 2). It was eliminated when compatible possibilities were not available, e.g., for 'if and only if A B' bi-conditionals and exclusive disjunctions (Experiment 3). The compatibility heuristic occurs even for inferences based on implicit negation e.g., 'A or B, therefore if C D' (Experiment 4), and between universals 'All A's are B's' and disjunctions (Experiment 5a) and universals and conditionals (Experiment 5b). The implications of the results for alternative theories of the cognitive processes underlying hypothetical deductions are discussed. Copyright © 2013. Published by Elsevier Inc.
High-Field MRI-Compatible Needle Placement Robot for Prostate Interventions
SU, Hao; CAMILO, Alex; COLE, Gregory A.; HATA, Nobuhiko; TEMPANY, Clare M.; FISCHER, Gregory S.
2011-01-01
This paper presents the design of a magnetic resonance imaging (MRI) compatible needle placement system actuated by piezoelectric actuators for prostate brachytherapy and biopsy. An MRI-compatible modular 3 degree-of-freedom (DOF) needle driver module coupled with a 3-DOF x-y-z stage is proposed as a slave robot to precisely deliver radioactive brachytherapy seeds under interactive MRI guidance. The needle driver module provides for needle cannula rotation, needle insertion and cannula retrac...
Assessment of DUPIC fuel compatibility with CANDU-6
Energy Technology Data Exchange (ETDEWEB)
Choi, H B; Roh, G H; Jeong, C J; Rhee, B W; Choi, J W [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1997-07-01
The compatibility of DUPIC fuel with the existing CANDU reactor was assessed. The technical issues of DUPIC fuel compatibility were chosen based on the CANDU physics design requirements and inherent characteristics of DUPIC fuel. The compatibility was assessed for the reference DUPIC fuel composition which was determined to reduce the composition heterogeneity and improve the spent PWR fuel utilization. Preliminary studies on a CANDU core loaded with DUPIC fuel have shown that the nominal power distribution is flatter than that of a natural uranium core when a 2-bundle shift refueling scheme is used, which reduces the reactivity worths of devices in the core and, therefore, the performance of reactivity devices was assessed. The safety of the core was assessed by a LOCA simulation and it was found that the power pulse upon LOCA can be maintained below that in the natural uranium core when a poison material is used in the DUPIC fuel. For the feasibility of handling DUPIC fuel in the plant, it will be necessary to introduce new equipment to load the DUPIC fuel in the refueling magazine. The radiation effect of DUPIC fuel on both the reactor hardware and the environment will require a quantitative analysis later. (author).
ENGINEERING SPECIALTY ASSESSMENT OF TANK WASTE COMPATIBILITY REPORTING
International Nuclear Information System (INIS)
KNIGHT, M.A.
2003-01-01
This Engineering Specialty Assessment was conducted to review the Tank Farm Waste Transfer Compatibility Program to assess whether the program meets the needs of accelerated retrieval and closure and waste feed delivery and to identify areas and methods for streamlining the program. The assessment was conducted in June 2003 and resulted in two findings and thirteen observations. The assessment results indicate that significant opportunities exist for streamlining the program by reducing the number of criteria requiring evaluation from 21 to 11, with only six of the criteria requiring evaluation for the majority of transfers. The assessment identified areas where existing criteria require strengthening to ensure that the risks of undesirable solids precipitation, from either waste mixing or waste transfer, are minimized. The assessment further identified opportunities for using existing engineering tools to simplify the calculations involved with preparation of waste compatibility assessments. The need to ensure that a revision to the waste compatibility program is prepared to align the program criteria with those that will be implemented with the DSA approval was also identified. Finally, the assessment identified that corrective actions are required to implement a tank-by-tank PCB inventory within the Best Basis Inventory and to ensure that sample data from external waste generators is entered into the TWINS database
Screening for attractants compatible with entomopathogenic fungus ...
African Journals Online (AJOL)
RACHEL
2016-04-27
Apr 27, 2016 ... Several thrips attractants were screened for compatibility with Metarhizium anisopliae (Metchnikoff). Sorokin (Hypocreales: Clavicipitaceae) and a subset of these for attraction to Megalurothrips sjostedti. Trybom (Thysanoptera: Thripidae). Conidial germination and germ tube length of M. anisopliae were.
Eco-Anthropic Compatibility - a Multidisciplinary Model in Urban Ecology
Directory of Open Access Journals (Sweden)
MARIANO L. BIANCA
2010-01-01
Full Text Available In this paper I propose a multidisciplinary model of urban development which goes beyond the notion of ecological sustainability, by building on the concept of eco-anthropic compatibility. First of all I will sketch the historical development of human aggregations and I will underline the difference between ancient and modern aggregations. On the basis of this analysis, I will take into consideration the notion of sustainability and its possible application to present conurbations. I will underline several limits of the notion of sustainable development and I will propose a multidisciplinary model grounded on a broader and new notion: the eco-anthropic compatibility. Using this notion, which includes the idea of sustainability, it is possible to handle, within the model, the human factors and human living conditions inside an urban aggregation. Finally, I will state that the actual urban model is decaying and therefore, sooner or later, we will have to face the end of urban civilization; for this reason we can start imagining new future ways for human aggregations on the planet based on the notion of eco-anthropic compatibility.
Mixed waste chemical compatibility: A testing program for plastic packaging components
International Nuclear Information System (INIS)
Nigrey, P.J.
1995-01-01
The purpose of hazardous and radioactive materials packaging is to enable these materials to be transported without posing a threat to the health or property of the general public. To achieve this aim, regulations in the United States have been written establishing general design requirements for such packagings. While no regulations have been written specifically for mixed waste packaging, regulations for the constituents of mixed wastes, i.e., hazardous and radioactive substances, have been codified by the US Department of Transportation (DOT, 49 CFR 173) and the US Nuclear Regulatory Commission (NRC, 10 CFR 71). The design requirements for both hazardous [49 CFR 173.24 (e)(1)] and radioactive [49 CFR 173.412 (g)] materials packaging specify packaging compatibility, i.e., that the materials of the packaging at sign d any contents be chemically compatible with each other. Furthermore, Type A [49 CFR 173.412 (g)] and Type B (10 CFR 71.43) packaging design requirements stipulate that there be no significant chemical, galvanic, or other reaction between the materials and contents of the package. Based on these requirements, a Chemical Compatibility Testing Program was developed in the Transportation Systems Department at Sandia National Laboratories (SNL). The program attempts to assure any regulatory body that the issue of packaging material compatibility towards hazardous and radioactive materials has been addressed. This program has been described in considerable detail in an internal SNL document, the Chemical Compatibility Test Plan ampersand Procedure Report (Nigrey 1993)
The effect of strong intermolecular and chemical interactions on the compatibility of polymers
International Nuclear Information System (INIS)
Askadskii, Andrei A
1999-01-01
The data on compatibility and on the properties of polymer blends are generalised. The emphasis is placed on the formation of strong intermolecular interactions (dipole-dipole interaction and hydrogen bonding) between the components of blends, as well as on the chemical reactions between them. A criterion for the prediction of compatibility of polymers is described in detail. Different cases of compatibility are considered and the dependences of the glass transition temperatures on the composition of blends are analysed. The published data on the effect of strong intermolecular interactions between the blend components on the glass transition temperature are considered. The preparation of interpolymers is described whose macromolecules are composed of incompatible polymers, which leads to the so-called 'forced compatibility.' The bibliography includes 80 references.
DNA Damage Repair System in Plants: A Worldwide Research Update.
Gimenez, Estela; Manzano-Agugliaro, Francisco
2017-10-30
Living organisms are usually exposed to various DNA damaging agents so the mechanisms to detect and repair diverse DNA lesions have developed in all organisms with the result of maintaining genome integrity. Defects in DNA repair machinery contribute to cancer, certain diseases, and aging. Therefore, conserving the genomic sequence in organisms is key for the perpetuation of life. The machinery of DNA damage repair (DDR) in prokaryotes and eukaryotes is similar. Plants also share mechanisms for DNA repair with animals, although they differ in other important details. Plants have, surprisingly, been less investigated than other living organisms in this context, despite the fact that numerous lethal mutations in animals are viable in plants. In this manuscript, a worldwide bibliometric analysis of DDR systems and DDR research in plants was made. A comparison between both subjects was accomplished. The bibliometric analyses prove that the first study about DDR systems in plants (1987) was published thirteen years later than that for other living organisms (1975). Despite the increase in the number of papers about DDR mechanisms in plants in recent decades, nowadays the number of articles published each year about DDR systems in plants only represents 10% of the total number of articles about DDR. The DDR research field was done by 74 countries while the number of countries involved in the DDR & Plant field is 44. This indicates the great influence that DDR research in the plant field currently has, worldwide. As expected, the percentage of studies published about DDR systems in plants has increased in the subject area of agricultural and biological sciences and has diminished in medicine with respect to DDR studies in other living organisms. In short, bibliometric results highlight the current interest in DDR research in plants among DDR studies and can open new perspectives in the research field of DNA damage repair.
Alternative Work Schedules: Designing Compatible Work Systems
Steen, Pamela L.
1977-01-01
Attempts to improve the quality of working life through changes in environmental factors, such as flexible hours, are likely to bring limited and short-term advantages unless the work process itself is well-designed and compatible with the environmental changes. (Author/LBH)
77 FR 14461 - Approval of Noise Compatibility Program for W.K. Airport, Battle Creek, MI
2012-03-09
....K. Kellogg Airport noise compatibility program. All of the recommendations of the program were... Noise Compatibility Program for W.K. Kellogg Airport is February 16, 2012. FOR FURTHER INFORMATION... the Noise Compatibility Program for W.K. Kellogg Airport, effective February 16, 2012. Under section...
2010-03-12
... meet applicable regulations and which depict non-compatible land uses as of the date of submission of... the Act. These functions are inseparable from the ultimate land use control and planning...-compatible land uses and preventing the introduction of additional non-compatible land uses. Interested...
Compatibility and Marital Satisfaction in Disabled Couples Compared to Healthy Ones
Directory of Open Access Journals (Sweden)
Azam Abed
2015-06-01
Full Text Available Objectives: The aim of current study was the evaluation and comparison of compatibility and marital satisfaction between handicapped couples and healthy ones. Methods: In this study, 50 handicapped couples and 50 healthy couples were examined with Enrich’s marital satisfaction questionnaire and Bell’s adjustment questionnaire. The data were analyzed, using SPSS 15, correlation tests and ANOVA. Results: The results showed that there was no significant difference between handicapped and healthy couples in compatibility and marital satisfaction. Discussion: It is concluded that people who were handicapped before their marriage and those who decided to marry them were suitably aware of the issue, therefore accepting a handicapped person was not so hard. What is important in marital compatibility is accepting a partner.
Progress of the DUPIC Fuel Compatibility Analysis (IV) - Fuel Performance
International Nuclear Information System (INIS)
Choi, Hang Bok; Ryu, Ho Jin; Roh, Gyu Hong; Jeong, Chang Joon; Park, Chang Je; Song, Kee Chan; Lee, Jung Won
2005-10-01
This study describes the mechanical compatibility of the direct use of spent pressurized water reactor (PWR) fuel in Canada deuterium uranium (CANDU) reactors (DUPIC) fuel, when it is loaded into a CANDU reactor. The mechanical compatibility can be assessed for the fuel management, primary heat transport system, fuel channel, and the fuel handling system in the reactor core by both the experimental and analytic methods. Because the physical dimensions of the DUPIC fuel bundle adopt the CANDU flexible (CANFLEX) fuel bundle design which has already been demonstrated for a commercial use in CANDU reactors, the experimental compatibility analyses focused on the generation of material property data and the irradiation tests of the DUPIC fuel, which are used for the computational analysis. The intermediate results of the mechanical compatibility analysis have shown that the integrity of the DUPIC fuel is mostly maintained under the high power and high burnup conditions even though some material properties like the thermal conductivity is a little lower compared to the uranium fuel. However it is required to slightly change the current DUPIC fuel design to accommodate the high internal pressure of the fuel element. It is also strongly recommended to perform more irradiation tests of the DUPIC fuel to accumulate a database for the demonstration of the DUPIC fuel performance in the CANDU reactor
Progress of the DUPIC Fuel Compatibility Analysis (IV) - Fuel Performance
Energy Technology Data Exchange (ETDEWEB)
Choi, Hang Bok; Ryu, Ho Jin; Roh, Gyu Hong; Jeong, Chang Joon; Park, Chang Je; Song, Kee Chan; Lee, Jung Won
2005-10-15
This study describes the mechanical compatibility of the direct use of spent pressurized water reactor (PWR) fuel in Canada deuterium uranium (CANDU) reactors (DUPIC) fuel, when it is loaded into a CANDU reactor. The mechanical compatibility can be assessed for the fuel management, primary heat transport system, fuel channel, and the fuel handling system in the reactor core by both the experimental and analytic methods. Because the physical dimensions of the DUPIC fuel bundle adopt the CANDU flexible (CANFLEX) fuel bundle design which has already been demonstrated for a commercial use in CANDU reactors, the experimental compatibility analyses focused on the generation of material property data and the irradiation tests of the DUPIC fuel, which are used for the computational analysis. The intermediate results of the mechanical compatibility analysis have shown that the integrity of the DUPIC fuel is mostly maintained under the high power and high burnup conditions even though some material properties like the thermal conductivity is a little lower compared to the uranium fuel. However it is required to slightly change the current DUPIC fuel design to accommodate the high internal pressure of the fuel element. It is also strongly recommended to perform more irradiation tests of the DUPIC fuel to accumulate a database for the demonstration of the DUPIC fuel performance in the CANDU reactor.
Compatibility of copper-electroplated cells with Metal Wrap Through module materials
Energy Technology Data Exchange (ETDEWEB)
Bennett, I.J.; Geerligs, L.J.; Olson, C.L.; Goris, M.J.A.A. [ECN Solar Energy, Petten (Netherlands)
2013-10-16
As part of the European FP7 RandD project 'Cu-PV', the compatibility of copper-electroplated metal wrapthrough (MWT) cells with conductive adhesives has been investigated. The objectives of this project include to reduce, by the use of copper plating, the amount of silver utilized in cell manufacturing, and to demonstrate the compatibility of high-power n-type back-contact module technology with copper-plated cells. The overall goal is to reduce the impact on the environment of cell and module manufacture. MWT module technology as developed by ECN uses conductive adhesive to make the interconnection between cells and a conductive backsheet foil. These adhesives have been proved to result in very reliable modules in the case of cells with fired silver metallization. To determine the compatibility of conductive adhesive with copper-plated cells, component tests were performed, followed by the manufacture of modules with copperplated cells and conductive adhesive interconnections. Climate chamber testing of these modules showed that the adhesive is compatible with the copper-plated cells. The next steps include further optimization of the plating process and additional testing at the module level.
Aarnink, Alice; Mee, Edward T; Savy, Nicolas; Congy-Jolivet, Nicolas; Rose, Nicola J; Blancher, Antoine
2014-02-01
The impact of feto-maternal histocompatibility on reproduction has inspired long-lasting debates. However, after the review of numerous articles, the impact of HLA allele sharing within couples on fecundity remains questionable. We decided to explore the impact of major histocompatibility complex (MHC) feto-maternal compatibility on reproduction in a cynomolgus macaque facility composed of animals of Mauritian descent. The Mauritian-derived macaque population presents a very restricted MHC polymorphism (only seven founding haplotypes) due to a strong founding bottleneck effect. The MHC polymorphism was investigated in 237 trios (male, female and offspring) using 17 microsatellite markers distributed across the MHC. Haplotypes were confirmed by segregation analysis. We evaluated the relative frequencies of MHC-compatible and MHC-semi-compatible offspring with the mothers. Among the 237 trios, we selected 42 trios for which the identity of the father is certain and for which the theoretical probabilities of fully compatible and semi-compatible offspring were equal. We found 11 offspring fully compatible and 31 offspring semi-compatible with their respective mother. The observed proportions were clearly outside the interval of confidence of 99 % and therefore most probably resulted from a selection of the semi-compatible offspring during pregnancy. We concluded that MHC fully compatible cynomolgus macaque offspring have a selective survival disadvantage in comparison with offspring inheriting a paternal MHC haplotype differing from maternal haplotypes.
Automatic kelvin probe compatible with ultrahigh vacuum
Baikie, I.D.; van der Werf, Kees; Oerbekke, H.; Broeze, J.; van Silfhout, Arend
1989-01-01
This article describes a new type of in situ ultrahigh‐vacuum compatible kelvin probe based on a voice‐coil driving mechanism. This design exhibits several advantages over conventional mechanical feed‐through and (in situ) piezoelectric devices in regard to the possibility of multiple probe
Design of multichannel counting system for IBM PC and compatibles
International Nuclear Information System (INIS)
Majeed, B.; Ahmad, Z.; Osman, A.; Ysain, M.M.
1995-07-01
A Multichannel Counting System (MCCS), based on IBM-PC and compatible computer systems have been designed. The MCCS consists of a Multichannel Counting System plug-in interface card (MCCS-PC) for IBM PC and compatibles and a NIM-BIN module (MCCS-NB). The MCCS-PC provides simultaneous monitoring of upto seven independent SCA type inputs. An on board programmable timer provides elapsed time measurement. A menu-driven program for data acquisition and timer control has also been developed. (author) 8 figs
Batch Processing of CMOS Compatible Feedthroughs
DEFF Research Database (Denmark)
Rasmussen, F.E.; Heschel, M.; Hansen, Ole
2003-01-01
. The feedthrough technology employs a simple solution to the well-known CMOS compatibility issue of KOH by protecting the CMOS side of the wafer using sputter deposited TiW/Au. The fabricated feedthroughs exhibit excellent electrical performance having a serial resistance of 40 mOmega and a parasitic capacitance...... of 2.5 pF. (C) 2003 Elsevier Science B.V. All rights reserved....
A Zeroth Law Compatible Model to Kerr Black Hole Thermodynamics
Directory of Open Access Journals (Sweden)
Viktor G. Czinner
2017-02-01
Full Text Available We consider the thermodynamic and stability problem of Kerr black holes arising from the nonextensive/nonadditive nature of the Bekenstein–Hawking entropy formula. Nonadditive thermodynamics is often criticized by asserting that the zeroth law cannot be compatible with nonadditive composition rules, so in this work we follow the so-called formal logarithm method to derive an additive entropy function for Kerr black holes also satisfying the zeroth law’s requirement. Starting from the most general, equilibrium compatible, nonadditive entropy composition rule of Abe, we consider the simplest non-parametric approach that is generated by the explicit nonadditive form of the Bekenstein–Hawking formula. This analysis extends our previous results on the Schwarzschild case, and shows that the zeroth law-compatible temperature function in the model is independent of the mass–energy parameter of the black hole. By applying the Poincaré turning point method, we also study the thermodynamic stability problem in the system.
Coal use in Italy and environmental compatibility
International Nuclear Information System (INIS)
1998-01-01
Fossil fuels have in Italy great importance. In Italy, in terms of environmental protection and for social acceptance, coal has had a real opposition not verified in other countries. Environmental compatibility of coal cycle and related technologies are discussed also consequently at the Kyoto protocol [it
Mixed waste chemical compatibility with packaging components
International Nuclear Information System (INIS)
Nigrey, P.J.; Conroy, M.; Blalock, L.B.
1994-01-01
In this paper, a chemical compatibility testing program for packaging of mixed wastes at will be described. We will discuss the choice of four y-radiation doses, four time durations, four temperatures and four waste solutions to simulate the hazardous waste components of mixed wastes for testing materials compatibility of polymers. The selected simulant wastes are (1) an aqueous alkaline mixture of sodium nitrate and sodium nitrite; (2) a chlorinated hydrocarbon mixture; (3) a simulant liquid scintillation fluid; and (4) a mixture of ketones. A selection of 10 polymers with anticipated high resistance to one or more of these types of environments are proposed for testing as potential liner or seal materials. These polymers are butadiene acrylonitrile copolymer, cross-linked polyethylene, epichlorhyarin, ethylene-propylene rubber, fluorocarbon, glass-filled tetrafluoroethylene, high-density poly-ethylene, isobutylene-isoprene copolymer, polypropylene, and styrene-butadiene rubber. We will describe the elements of the testing plan along with a metric for establishing time resistance of the packaging materials to radiation and chemicals
Harrison, R. W.; Hoffman, E. E.; Davies, R. L.
1972-01-01
Advanced Rankine and other proposed space power systems utilize refractory metals in contact with both single-phase and two-phase alkali metals at elevated temperatures. A number of recent compatibility experiments are described which emphasize the excellent compatibility of refractory metals with the alkali metals, lithium, sodium, and potassium, under a variety of environmental conditions. The alkali metal compatibilities of tantalum-, columbium-, molybdenum-, and tungsten-base alloys are discussed.
Blood compatibility of AAc, HEMA, and PEGMA-grafted cellulose film
International Nuclear Information System (INIS)
Nho, Young Chang.; Kwon, Oh Hyun
2003-01-01
To improve surface blood compatibility on cellulose film for hemodialysis, acrylic acid, 2-hydroxyethyl methacrylate and three kinds of polyethylene glycol methacrylates were grafted onto the cellulose film surface by radiation grafting technique. Heparin was introduced onto the grafted cellulose film surfaces. The grafting and heparinization were confirmed by Fourier transform infrared spectroscopy in the attenuated total reflectance mode and electron spectroscopy for chemical analysis. The blood compatibility of the modified cellulose film was examined by the determination of platelet adhesion and thrombus formation
de Figueiró Santos, Joyce; Coelho, Flávio Codeço; Bliman, Pierre-Alexandre
2016-01-01
Colony Collapse Disorder (CCD) has become a global problem for beekeepers and for the crops that depend on bee pollination. While many factors are known to increase the risk of colony collapse, the ectoparasitic mite Varroa destructor is considered to be the most serious one. Although this mite is unlikely to cause the collapse of hives itself, it is the vector for many viral diseases which are among the likely causes for Colony Collapse Disorder. The effects of V. destructor infestation differ from one part of the world to another, with greater morbidity and higher colony losses in European honey bees (EHB) in Europe, Asia and North America. Although this mite has been present in Brazil for many years, there have been no reports of colony losses amongst Africanized Honey Bees (AHB). Studies carried out in Mexico have highlighted different behavioral responses by the AHB to the presence of the mite, notably as far as grooming and hygienic behavior are concerned. Could these explain why the AHB are less susceptible to Colony Collapse Disorder? In order to answer this question, we have developed a mathematical model of the infestation dynamics to analyze the role of resistance behavior by bees in the overall health of the colony, and as a consequence, its ability to face epidemiological challenges.
Directory of Open Access Journals (Sweden)
Joyce de Figueiró Santos
Full Text Available Colony Collapse Disorder (CCD has become a global problem for beekeepers and for the crops that depend on bee pollination. While many factors are known to increase the risk of colony collapse, the ectoparasitic mite Varroa destructor is considered to be the most serious one. Although this mite is unlikely to cause the collapse of hives itself, it is the vector for many viral diseases which are among the likely causes for Colony Collapse Disorder. The effects of V. destructor infestation differ from one part of the world to another, with greater morbidity and higher colony losses in European honey bees (EHB in Europe, Asia and North America. Although this mite has been present in Brazil for many years, there have been no reports of colony losses amongst Africanized Honey Bees (AHB. Studies carried out in Mexico have highlighted different behavioral responses by the AHB to the presence of the mite, notably as far as grooming and hygienic behavior are concerned. Could these explain why the AHB are less susceptible to Colony Collapse Disorder? In order to answer this question, we have developed a mathematical model of the infestation dynamics to analyze the role of resistance behavior by bees in the overall health of the colony, and as a consequence, its ability to face epidemiological challenges.
Desk-top publishing using IBM-compatible computers.
Grencis, P W
1991-01-01
This paper sets out to describe one Medical Illustration Departments' experience of the introduction of computers for desk-top publishing. In this particular case, after careful consideration of all the options open, an IBM-compatible system was installed rather than the often popular choice of an Apple Macintosh.
Lifescience Database Archive (English)
Full Text Available *k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly* *iiqllfhik*lsnctyvim*sftw*he*iet*ylygrgttsip*yks...csl*nlgrlccq*sr*ti*nqylcsrysft*er e*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwl
Compatibility and economic assessment of sweetpotato and garden ...
African Journals Online (AJOL)
ecological zone of Nigeria, to determine the compatibility and economic viability of sweetpotato (Ipomoea batatas) and garden egg (Solanum gelio) intercrop during 2011 and 2012 cropping seasons. Two sweetpotato varieties; NR05/022 and ...
Sun, Xiujie; Gupta, Kshama; Wu, Bogang; Zhang, Deyi; Yuan, Bin; Zhang, Xiaowen; Chiang, Huai-Chin; Zhang, Chi; Curiel, Tyler J; Bendeck, Michelle P; Hursting, Stephen; Hu, Yanfen; Li, Rong
2018-02-23
Discoidin domain receptor 1 (DDR1) is a collagen receptor that mediates cell communication with the extracellular matrix (ECM). Aberrant expression and activity of DDR1 in tumor cells are known to promote tumor growth. Although elevated DDR1 levels in the stroma of breast tumors are associated with poor patient outcome, a causal role for tumor-extrinsic DDR1 in cancer promotion remains unclear. Here we report that murine mammary tumor cells transplanted to syngeneic recipient mice in which Ddr1 has been knocked out (KO) grow less robustly than in WT mice. We also found that the tumor-associated stroma in Ddr1- KO mice exhibits reduced collagen deposition compared with the WT controls, supporting a role for stromal DDR1 in ECM remodeling of the tumor microenvironment. Furthermore, the stromal-vascular fraction (SVF) of Ddr1 knockout adipose tissue, which contains committed adipose stem/progenitor cells and preadipocytes, was impaired in its ability to stimulate tumor cell migration and invasion. Cytokine array-based screening identified interleukin 6 (IL-6) as a cytokine secreted by the SVF in a DDR1-dependent manner. SVF-produced IL-6 is important for SVF-stimulated tumor cell invasion in vitro , and, using antibody-based neutralization, we show that tumor promotion by IL-6 in vivo requires DDR1. In conclusion, our work demonstrates a previously unrecognized function of DDR1 in promoting tumor growth. © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.
A practical exact maximum compatibility algorithm for reconstruction of recent evolutionary history.
Cherry, Joshua L
2017-02-23
Maximum compatibility is a method of phylogenetic reconstruction that is seldom applied to molecular sequences. It may be ideal for certain applications, such as reconstructing phylogenies of closely-related bacteria on the basis of whole-genome sequencing. Here I present an algorithm that rapidly computes phylogenies according to a compatibility criterion. Although based on solutions to the maximum clique problem, this algorithm deals properly with ambiguities in the data. The algorithm is applied to bacterial data sets containing up to nearly 2000 genomes with several thousand variable nucleotide sites. Run times are several seconds or less. Computational experiments show that maximum compatibility is less sensitive than maximum parsimony to the inclusion of nucleotide data that, though derived from actual sequence reads, has been identified as likely to be misleading. Maximum compatibility is a useful tool for certain phylogenetic problems, such as inferring the relationships among closely-related bacteria from whole-genome sequence data. The algorithm presented here rapidly solves fairly large problems of this type, and provides robustness against misleading characters than can pollute large-scale sequencing data.
Electromagnetic compatibility principles and applications
Weston, David A
2001-01-01
This totally revised and expanded reference/text provides comprehensive, single-source coverage of the design, problem solving, and specifications of electromagnetic compatibility (EMC) into electrical equipment/systems-including new information on basic theories, applications, evaluations, prediction techniques, and practical diagnostic options for preventing EMI through cost-effective solutions. Offers the most recent guidelines, safety limits, and standards for human exposure to electromagnetic fields! Containing updated data on EMI diagnostic verification measurements, as well as over 900 drawings, photographs, tables, and equations-500 more than the previous edition
Genetic Compatibility Underlies Benefits of Mate Choice in an External Fertilizer.
Aguirre, J David; Blows, Mark W; Marshall, Dustin J
2016-05-01
Mate choice is a common feature of sexually reproducing species. In sessile or sedentary external fertilizers, however, direct interactions between reproductive partners are minimal, and instead mate recognition and choice must occur at the level of gametes. It is common for some sperm and egg combinations to have higher fertilization success than others, but it remains unclear whether differences in fertilization reflect gamete-level mate choice (GMC) for paternal quality or parental compatibility. Here, we examine the mechanisms underlying GMC in an externally fertilizing ascidian. A manipulative mate-choice assay confirmed that offspring viability was greater in clutches where we allowed GMC than in clutches where we precluded GMC. A complementary quantitative genetic experiment then revealed that paternal quality effects were generally weaker than parental compatibility effects, particularly for the trait combination underlying the benefits of GMC. Overall, our data suggest that gametes that are more compatible at fertilization produce more viable offspring than gametes that are less compatible at fertilization. Therefore, although the regalia we typically associate with sexual selection are absent in external fertilizers, mechanisms that allow females to bias fertilization in favor of some males over others produce significant fitness benefits in organisms reproducing via the ancestral strategy.
A review of compatibility of IFR fuel and austenitic stainless steel
International Nuclear Information System (INIS)
Keiser, D.D. Jr.
1996-01-01
Interdiffusion experiments have been conducted to investigate the compatibility of various austenitic stainless steels with U-Pu-Zr alloys, which are alloys to be employed as fuel for the Integral Fast Reactor being developed by Argonne National Laboratory. These tests have also studied the compatibility of austenitic stainless steels with fission products, like the minor actinides (Np and Am) and lanthanides (Ce and Nd), that are generated during the fission process in an IFR. This paper compares the results of these investigations in the context of fuel-cladding compatibility in IFR fuel elements, specifically focusing on the relative Interdiffusion behavior of the components and the types of phases that develop based on binary phase diagrams. Results of Interdiffusion tests are assessed in the light of observations derived from post-test examinations of actual irradiated fuel elements
Technology for the compatible integration of silicon detectors with readout electronics
International Nuclear Information System (INIS)
Zimmer, G.
1984-01-01
Compatible integration of detectors and readout electronics on the same silicon substrate is of growing interest. As the methods of microelectronics technology have already been adapted for detector fabrication, a common technology basis for detectors and readout electronics is available. CMOS technology exhibits most attractive features for the compatible realization of readout electronics when advanced LSI processing steps are combined with detector requirements. The essential requirements for compatible integration are the availability of high resistivity (100)-oriented single crystalline silicon substrate, the formation of suitably doped areas for MOS circuits and the isolation of the low voltage circuit from the detector operated at much higher supply voltage. Junction isolation as a first approach based on present production technology and dielectric isolation based on an advanced SOI-LSI technology are discussed as the most promising solutions for present and future applications, respectively. (orig.)
Globalisation and international compatibility - a challenge to ...
African Journals Online (AJOL)
The contexts of institutions for higher education are in flux with consequent learning challenges. One of these challenges is that of globalisation and the need for international compatibility. Another challenge is that Mode 2 learning programmes, material and methods need to be relevant to the specific context in which they ...
Energy Technology Data Exchange (ETDEWEB)
Seifert, Wolfgang [Institute of Physics, Martin Luther University, Halle-Wittenberg (Germany); Zabrocki, Knud; Mueller, Eckhard [Institute of Materials Research, German Aerospace Center (DLR), 51170 Koeln (Germany); Snyder, G.J. [California Institute of Technology, Pasadena, California 91125 (United States)
2010-03-15
The compatibility approach introduced by Snyder and Ursell opens a new pathway for the improvement of thermoelectric (TE) device performance. It has been shown that sufficient compatibility is - besides an increase of the averaged figure of merit Z - essential for efficient operation of a TE device, and that compatibility will facilitate rational materials selection, device design, and the engineering of functionally graded materials (FGMs). In this paper, the authors give an overview of the fundamental results and present a new approach from the perspective of variational calculus. A particular focus is on the role of ideal self-compatibility, i.e., adjusting compatibility locally at any position along a TE leg. (Abstract Copyright [2010], Wiley Periodicals, Inc.)
Micro-Arc Oxidation Enhances the Blood Compatibility of Ultrafine-Grained Pure Titanium
Directory of Open Access Journals (Sweden)
Lin Xu
2017-12-01
Full Text Available Ultrafine-grained pure titanium prepared by equal-channel angular pressing has favorable mechanical performance and does not contain alloy elements that are toxic to the human body. It has potential clinical value in applications such as cardiac valve prostheses, vascular stents, and hip prostheses. To overcome the material’s inherent thrombogenicity, surface-coating modification is a crucial pathway to enhancing blood compatibility. An electrolyte solution of sodium silicate + sodium polyphosphate + calcium acetate and the micro-arc oxidation (MAO technique were employed for in situ oxidation of an ultrafine-grained pure titanium surface. A porous coating with anatase- and rutile-phase TiO2 was generated and wettability and blood compatibility were examined. The results showed that, in comparison with ultrafine-grained pure titanium substrate, the MAO coating had a rougher surface, smaller contact angles for distilled water and higher surface energy. MAO modification effectively reduced the hemolysis rate; extended the dynamic coagulation time, prothrombin time (PT, and activated partial thromboplastin time (APTT; reduced the amount of platelet adhesion and the degree of deformation; and enhanced blood compatibility. In particular, the sample with an oxidation time of 9 min possessed the highest surface energy, largest PT and APTT values, smallest hemolysis rate, less platelet adhesion, a lesser degree of deformation, and more favorable blood compatibility. The MAO method can significantly enhance the blood compatibility of ultrafine-grained pure titanium, increasing its potential for practical applications.
Materials compatibility and corrosion issues for accelerator transmutation of waste
International Nuclear Information System (INIS)
Staudhammer, K.
1992-08-01
The need to understand the materials issues in an accelerator transmutation of waste (ATW) system is essential. This report focuses on the spallation container material, as this material is exposed to some of the most crucial environmental conditions of simultaneous radiation and corrosion in the system. The most severe design being considered is that of liquid lead. In previous investigations of lead compatibility with materials, the chemistry of the system was derived solely from the corrosion products; however, in an ATW system, the chemistry of the lead changes not only with the derived corrosion products of the material being tested but also with the buildup of the daughter production with time. Daughter production builds up and introduces elements that may have a great effect on the corrosion activity of the liquid lead. Consequently, data on liquid lead compatibility can be regarded only as a guide and must be reevaluated when particular daughter products are added. This report is intended to be a response to specific materials issues and concerns expressed by the ATW design working group and addresses the compatibility/corrosion concerns
A compatible electrocutaneous display for functional magnetic resonance imaging application.
Hartwig, V; Cappelli, C; Vanello, N; Ricciardi, E; Scilingo, E P; Giovannetti, G; Santarelli, M F; Positano, V; Pietrini, P; Landini, L; Bicchi, A
2006-01-01
In this paper we propose an MR (magnetic resonance) compatible electrocutaneous stimulator able to inject an electric current, variable in amplitude and frequency, into the fingertips in order to elicit tactile skin receptors (mechanoreceptors). The desired goal is to evoke specific tactile sensations selectively stimulating skin receptors by means of an electric current in place of mechanical stimuli. The field of application ranges from functional magnetic resonance imaging (fMRI) tactile studies to augmented reality technology. The device here proposed is designed using safety criteria in order to comply with the threshold of voltage and current permitted by regulations. Moreover, MR safety and compatibility criteria were considered in order to perform experiments inside the MR scanner during an fMRI acquisition for functional brain activation analysis. Psychophysical laboratory tests are performed in order to define the different evoked tactile sensation. After verifying the device MR safety and compatibility on a phantom, a test on a human subject during fMRI acquisition is performed to visualize the brain areas activated by the simulated tactile sensation.
Cell-compatible conducting polyaniline films prepared in colloidal dispersion mode.
Kašpárková, Věra; Humpolíček, Petr; Capáková, Zdenka; Bober, Patrycja; Stejskal, Jaroslav; Trchová, Miroslava; Rejmontová, Petra; Junkar, Ita; Lehocký, Marián; Mozetič, Miran
2017-09-01
Conducting polyaniline can be prepared and modified using several procedures, all of which can significantly influence its applicability in different fields of biomedicine or biotechnology. The modifications of surface properties are crucial with respect to the possible applications of this polymer in tissue engineering or as biosensors. Innovative technique for preparing polyaniline films via in-situ polymerization in colloidal dispersion mode using four stabilizers (poly-N-vinylpyrrolidone; sodium dodecylsulfate; Tween 20 and Pluronic F108) was developed. The surface energy, conductivity, spectroscopic features, and cell compatibility of thin polyaniline films were determined using contact-angle measurement, the van der Pauw method, Fourier-transform infrared spectroscopy, and assay conducted on mouse fibroblasts, respectively. The stabilizers significantly influenced not only the surface and electrical properties of the films but also their cell compatibility. Sodium dodecylsulfate seems preferentially to combine both the high conductivity and good cell compatibility. Moreover, the films with sodium dodecylsulfate were non-irritant for skin, which was confirmed by their in-vitro exposure to the 3D-reconstructed human tissue model. Copyright © 2017 Elsevier B.V. All rights reserved.
Gibson, Joshua D; Hunt, Greg J
2016-01-01
The complete mitochondrial genome from an Africanized honey bee population (AHB, derived from Apis mellifera scutellata) was assembled and analyzed. The mitogenome is 16,411 bp long and contains the same gene repertoire and gene order as the European honey bee (13 protein coding genes, 22 tRNA genes and 2 rRNA genes). ND4 appears to use an alternate start codon and the long rRNA gene is 48 bp shorter in AHB due to a deletion in a terminal AT dinucleotide repeat. The dihydrouracil arm is missing from tRNA-Ser (AGN) and tRNA-Glu is missing the TV loop. The A + T content is comparable to the European honey bee (84.7%), which increases to 95% for the 3rd position in the protein coding genes.
Directional control-response compatibility of joystick steered shuttle cars.
Burgess-Limerick, Robin; Zupanc, Christine M; Wallis, Guy
2012-01-01
Shuttle cars are an unusual class of vehicle operated in underground coal mines, sometimes in close proximity to pedestrians and steering errors may have very serious consequences. A directional control-response incompatibility has previously been described in shuttle cars which are controlled using a steering wheel oriented perpendicular to the direction of travel. Some other shuttle car operators are seated perpendicular to the direction of travel and steer the car via a seat mounted joystick. A virtual simulation was utilised to determine whether the steering arrangement in these vehicles maintains directional control-response compatibility. Twenty-four participants were randomly assigned to either a condition corresponding to this design (consistent direction), or a condition in which the directional steering response was reversed while driving in-bye (visual field compatible). Significantly less accurate steering performance was exhibited by the consistent direction group during the in-bye trials only. Shuttle cars which provide the joystick steering mechanism described here require operators to accommodate alternating compatible and incompatible directional control-response relationships with each change of car direction. A virtual simulation of an underground coal shuttle car demonstrates that the design incorporates a directional control-response incompatibility when driving the vehicle in one direction. This design increases the probability of operator error, with potential adverse safety and productivity consequences.
Dutertre, Martin; Vagner, Stéphan
2017-10-27
Upon DNA damage, cells trigger an early DNA-damage response (DDR) involving DNA repair and cell cycle checkpoints, and late responses involving gene expression regulation that determine cell fate. Screens for genes involved in the DDR have found many RNA-binding proteins (RBPs), while screens for novel RBPs have identified DDR proteins. An increasing number of RBPs are involved in early and/or late DDR. We propose to call this new class of actors of the DDR, which contain an RNA-binding activity, DNA-damage response RNA-binding proteins (DDRBPs). We then discuss how DDRBPs contribute not only to gene expression regulation in the late DDR but also to early DDR signaling, DNA repair, and chromatin modifications at DNA-damage sites through interactions with both long and short noncoding RNAs. Copyright © 2016 Elsevier Ltd. All rights reserved.
LHCb: LHCb Software and Conditions Database Cross-Compatibility Tracking: a Graph-Theory Approach
Cattaneo, M; Shapoval, I
2012-01-01
The Conditions Database (CondDB) of the LHCb experiment provides versioned, time dependent geometry and conditions data or all LHCb data processing applications (simulation, high level trigger, reconstruction, analysis). The evolution of CondDB and of the LHCb applications is a weakly-homomorphic process. It means that compatibility between a CondDB state and LHCb application state may not be preserved across different database and application generations. More over, a CondDB state by itself belongs to a complex three-dimensional phase space which evolves according to certain CondDB self-compatibility criteria, so it is sometimes difficult even to determine a self-consistent CondDB state. These compatibility issues may lead to various kinds of problems in the LHCb production, varying from unexpected application crashes to incorrect data processing results. Thus, there is a need for defining a well-established set of compatibility criteria between mentioned above entities, together with developing a compatibil...
LHCb Software and Conditions Database Cross-Compatibility Tracking System: a Graph-Theory Approach
Cattaneo, M; Shapoval, I
2012-01-01
The Conditions Database (CondDB) of the LHCb experiment provides versioned, time dependent geometry and conditions data or all LHCb data processing applications (simulation, high level trigger, reconstruction, analysis). The evolution of CondDB and of the LHCb applications is a weakly-homomorphic process. It means that compatibility between a CondDB state and LHCb application state may not be preserved across different database and application generations. More over, a CondDB state by itself belongs to a complex three-dimensional phase space which evolves according to certain CondDB self-compatibility criteria, so it is sometimes difficult even to determine a self-consistent CondDB state. These compatibility issues may lead to various kinds of problems in the LHCb production, varying from unexpected application crashes to incorrect data processing results. Thus, there is a need for defining a well-established set of compatibility criteria between mentioned above entities, together with developing a compatibil...
Directory of Open Access Journals (Sweden)
ABDUL GAFUR
2007-06-01
Full Text Available Peroxidase activity of the hybrid poplar Populus×canescens (Ait. Sm. (= P. tremula L. × P. alba L. inoculated with compatible and incompetent isolates of Paxillus involutus (Batsch Fr. was investigated. Screening of the ectomycorrhizal fungal isolates was initiated with exploration of mycelial growth characteristics and mycorrhizal ability in vitro with poplar. Both traits varied within the fungus although they did not seem to be genetically correlated. While isolates SCO1, NAU, and 031 grew faster than others, only isolates MAJ, SCO1, and 031 were able to form ectomycorrhiza with poplar. Isolates MAJ (compatible and NAU (incompetent were subsequently selected for further experiments. Activity of peroxidase, one of the defense-related enzymes, was examined in pure culture and short root components of compatible and incompetent interactions between poplar and P. involutus. Peroxidase activities increased significantly in poplar inoculated with incompetent isolate of the fungus compared to control, while induction of the same enzyme was not detected in compatible associations.
Pointing Hand Stimuli Induce Spatial Compatibility Effects and Effector Priming
Directory of Open Access Journals (Sweden)
Akio eNishimura
2013-04-01
Full Text Available The present study investigated the automatic influence of perceiving a picture that indicates other’s action on one’s own task performance in terms of spatial compatibility and effector priming. Participants pressed left and right buttons with their left and right hands respectively, depending on the color of a central dot target. Preceding the target, a left or right hand stimulus (pointing either to the left or right with the index or little finger was presented. In Experiment 1, with brief presentation of the pointing hand, a spatial compatibility effect was observed: Responses were faster when the direction of the pointed finger and the response position were spatially congruent than when incongruent. The spatial compatibility effect was larger for the pointing index finger stimulus compared to the pointing little finger stimulus. Experiment 2 employed longer duration of the pointing hand stimuli. In addition to the spatial compatibility effect for the pointing index finger, the effector priming effect was observed: Responses were faster when the anatomical left/right identity of the pointing and response hands matched than when the pointing and response hands differed in left/right identity. The results indicate that with sufficient processing time, both spatial/symbolic and anatomical features of a static body part implying another’s action simultaneously influence different aspects of the perceiver’s own action. Hierarchical coding, according to which an anatomical code is used only when a spatial code is unavailable, may not be applicable if stimuli as well as responses contain anatomical features.
Design of a New MR Compatible Haptic Interface with Six Actuated Degrees of Freedom
DEFF Research Database (Denmark)
Ergin, Mehmet Alper; Kühne, Markus; Thielscher, Axel
2014-01-01
Functional magnetic resonance imaging is an often adopted tool to study human motor control mechanisms. Highly controlled experiments as required by this form of analysis can be realized with haptic interfaces. Their design is challenging because of strong safety and MR compatibility requirements....... Existing MR-compatible haptic interfaces are restricted to maximum three actuated degrees of freedom. We propose an MR-compatible haptic interface with six actuated degrees of freedom to be able to study human brain mechanisms of natural pick-and-place movements including arm transport. In this work, we...... present its mechanical design, kinematic and dynamic model, as well as report on its model-based characterization. A novel hybrid control scheme for the employed ultrasonic motors is introduced. Preliminary MR compatibility tests based on one complete actuator-sensor module are performed. No measurable...
National Aeronautics and Space Administration — According to the decadal report titled, Life and Physical Sciences Research for a New Era of Space Exploration, a Report, ??the AHB Panel would be remiss if it did...
QSAR Study of Sucrose and Guanidine Derivatives
African Journals Online (AJOL)
NICO
CAChe Pro software by using eight descriptors,viz.electron affinity, ionization potential, electrophilicity index, total ... development of the AH-B theory of sweetness proposed by .... form of the solution to the quantum mechanical equation as.
Electromagnetic Compatibility of Matrix Converter System
Directory of Open Access Journals (Sweden)
S. Fligl
2006-12-01
Full Text Available The presented paper deals with matrix converters pulse width modulation strategies design with emphasis on the electromagnetic compatibility. Matrix converters provide an all-silicon solution to the problem of converting AC power from one frequency to another, offering almost all the features required of an ideal static frequency changer. They possess many advantages compared to the conventional voltage or current source inverters. A matrix converter does not require energy storage components as a bulky capacitor or an inductance in the DC-link, and enables the bi-directional power flow between the power supply and load. The most of the contemporary modulation strategies are able to provide practically sinusoidal waveforms of the input and output currents with negligible low order harmonics, and to control the input displacement factor. The perspective of matrix converters regarding EMC in comparison with other types of converters is brightly evident because it is no need to use any equipment for power factor correction and current and voltage harmonics reduction. Such converter with proper control is properly compatible both with the supply mains and with the supplied load. A special digital control system was developed for the realized experimental test bed which makes it possible to achieve greater throughput of the digital control system and its variability.
Studies of environmental compatability. Umweltbundesamt - Texte
Energy Technology Data Exchange (ETDEWEB)
1982-01-01
The evaluation of the methodical quality of the examples by means of a verification pattern had the result that approaches using quantitative methods - as for example the value in use analysis obtained better results: The representation of the state of the environment and of possible impairments of the environment, which had bejudged, achieved a higher degree of representativeness and completeness. Furthermore the concreteness of the used criteria for the description of the repercussions of a plan and the possibility to quantify same had to be judged more favourable. It must critically be remarked that by using quantitative methods difficulties may appear if impairments of the environment overlap or if there are correlations between the media respectively if there are non-linear repercussions of measures causing environmental damages. The present level of research should be developed to a strenghtened inclusion of complex and dynamic correlations of effects. More exacting investigations concerning environmental compatability are on the long term integrated in administrative procedures only at few authorities. With the demand for an extension of environmental compatability assessment to all steps of planning and procedure for the realization of a plan an early and more intensive participation of the public should be connected.
Is equal moral consideration really compatible with unequal moral status?
Rossi, John
2010-09-01
The issue of moral considerability, or how much moral importance a being's interests deserve, is one of the most important in animal ethics. Some leading theorists--most notably David DeGrazia--have argued that a principle of "equal moral consideration" is compatible with "unequal moral status." Such a position would reconcile the egalitarian force of equal consideration with more stringent obligations to humans than animals. The article presents arguments that equal consideration is not compatible with unequal moral status, thereby forcing those who would justify significantly different moral protections for humans and animals to argue for unequal consideration.
Application of direct digital radiography of nasal bone
International Nuclear Information System (INIS)
Gao Dengfa; Wang Haijun; Zhang Ailian; Wang Yulin
2005-01-01
Objective: To research the application value of direct digital radiograph (DDR ) in nasal bone imaging. Methods: One hundred cases were examined by DDR, 30 cases of them were examined by two methods both DDR and conventional radiography. All digital images were post-processed with 'MUSICA' (Multi-Scale Image Contrast Amplification), incision and largamente, analyzed and diagnosed by experienced two radiologists and two technicians. Results: One hundred cases of nasal bone, soft tissue of nose were showed excellent in DDR, and satisfactory cases were 95 and 92, respectively. Forty-six cases of nasal bone fractures were found. Thirty cases were examined by both DDR and conventional radiography, images of nasal bone, soft tissue of nose were showed, satisfactory cases were 28 in DDR; and satisfactory cases were 6 (χ 2 =20.05, P 2 =15.06, P 2 =5.14, P<0.05) in conventional and digital radiography, respectively. Conclusion: DDR images of nasal bone, soft tissue of nose was excellent, more fractures were discovered than conventional radiography. Image quality of DDR is better than conventional radiography in nasal bone imaging. (authors)
The high pH chemical and radiation compatibility of various liner materials
International Nuclear Information System (INIS)
Whyatt, G.A.; Farnsworth, R.K.
1990-01-01
This paper reports on a flexible membrane liner that has been proposed to line a concrete vault in which liquid low-level radioactive waste will be solidified. High-density polyethylene (HDPE) and polypropylene liners were tested at the Pacific Northwest Laboratory in an EPA method 9090 format to determine their chemical compatibility with the waste. Radiation effects were also investigated. The liners were immersed in a highly caustic (pH>14), primarily inorganic solution at 90 degrees C. The liners were subjected to radiation doses up to 38.9 Mrad, which was the expected dose the liner would receive over a 30-year life inside the vault. Recent changes have placed the liner outside the vault. The acceptance criteria for judging the compatibility of the liner with radiation would be different that those used for judging chemical compatibility. The radiation damage over the life of the liner can be simulated in a short-term test. Both HDPE and polypropylene liners were judged to be acceptable from a chemical and radiation standpoint when placed outside of the vault, while several other liners were not compatible. Radiation did not have a significant effect on chemical degradation rates
The high pH chemical and radiation compatibility of various liner materials
International Nuclear Information System (INIS)
Whyatt, G.; Farnsworth, R.
1990-01-01
A flexible membrane liner has been proposed to line a concrete vault in which liquid low-level radioactive waste will be solidified. High-density polyethylene (HDPE) and polypropylene liners were tested at the Pacific Northwest Laboratory in an EPA method 9090 format to determine their chemical compatibility with the waste. Radiation effects were also investigated. The liners were immersed in a highly caustic (pH>14), primarily inorganic solution at 90 degrees C. The liners were subjected to radiation doses up to 38.9 Mrad, which was the expected dose the liner would receive over a 30-year life inside the vault. Recent changes have placed the liner outside the vault. The acceptance criteria for judging the compatibility of the liner with radiation should be different than those used for judging chemical compatibility. The radiation damage over the life of the liner can be simulated in a short-term test. Both HDPE and polypropylene liners were judged to be acceptable from a chemical and radiation standpoint when placed outside of the vault, while several other liners were not compatible. Radiation did not have a significant effect on chemical degradation rates
Thermal compatibility of dental ceramic systems using cylindrical and spherical geometries
DeHoff, Paul H.; Barrett, Allyson A.; Lee, Robert B.; Anusavice, Kenneth J.
2009-01-01
Objective To test the hypothesis that bilayer ceramic cylinders and spheres can provide valid confirmation of thermal incompatibility stresses predicted by finite element analyses. Methods A commercial core ceramic and an experimental core ceramic were used to fabricate open-ended cylinders and core ceramic spheres. The core cylinders and spheres were veneered with one of four commercial dental ceramics representing four thermally compatible groups and four thermally incompatible groups. Axisymmetric thermal and viscoelastic elements in the ANSYS finite element program were used to calculate temperatures and stresses for each geometry and ceramic combination. This process required a transient heat transfer analysis for each combination to determine input temperatures for the structural model. Results After fabrication, each specimen was examined visually using fiberoptic transillumination for evidence of cracking. There were 100% failures of the thermally incompatible cylinders while none of the thermally compatible combinations failed. Among the spheres, 100% of the thermally incompatible systems failed, 16% of one of the thermally compatible systems failed, and none of the remaining compatible combinations failed. The calculated stress values were in general agreement with the experimental observations, i.e., low residual stresses for the specimens that did not fail and high residual stresses for the specimens that did fail. Significance Simple screening geometries can be used to identify highly incompatible ceramic combinations, but they do not identify marginally incompatible systems. PMID:17949805
60-Day waste compatibility safety issues and final results for AY-102 grab samples
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-01-31
Four grab samples (2AY-96-15, 2AY-96-16, 2AY-96-17, and 2AY-96-18) were taken from Riser 15D of Tank 241-AY-102 on October 8, 1996, and received by 222-S Laboratory on October 8, 1996. These samples were analyzed in accordance with Compatibility Grab Sampling and Analysis Plan (TSAP) and Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) in support of the Waste Compatibility Program. No notifications were required based on sample results.
Directory of Open Access Journals (Sweden)
Pierpaola Davalli
2018-01-01
Full Text Available Cancer is a death cause in economically developed countries that results growing also in developing countries. Improved outcome through targeted interventions faces the scarce selectivity of the therapies and the development of resistance to them that compromise the therapeutic effects. Genomic instability is a typical cancer hallmark due to DNA damage by genetic mutations, reactive oxygen and nitrogen species, ionizing radiation, and chemotherapeutic agents. DNA lesions can induce and/or support various diseases, including cancer. The DNA damage response (DDR is a crucial signaling-transduction network that promotes cell cycle arrest or cell death to repair DNA lesions. DDR dysregulation favors tumor growth as downregulated or defective DDR generates genomic instability, while upregulated DDR may confer treatment resistance. Redox homeostasis deeply and capillary affects DDR as ROS activate/inhibit proteins and enzymes integral to DDR both in healthy and cancer cells, although by different routes. DDR regulation through modulating ROS homeostasis is under investigation as anticancer opportunity, also in combination with other treatments since ROS affect DDR differently in the patients during cancer development and treatment. Here, we highlight ROS-sensitive proteins whose regulation in oxidatively induced DDR might allow for selective strategies against cancer that are better tailored to the patients.
Leaders, Leadership and Democracy--Are They Compatible?
Schostak, John
2016-01-01
This article is taken from a talk given by John Schostak at the Co-Operative Head Office, Manchester on 25 September 2015. Question addressed in this paper include: (1) To what extent is leadership needed for a democratic life?; (2) What form of democratic organisation, if any, is compatible with leadership?; and (3) Is democracy undermined by…
Materials Compatibility Testing in RSRM ODC: Free Cleaner Selection
Keen, Jill M.; Sagers, Neil W.; McCool, Alex (Technical Monitor)
2001-01-01
Government regulations have mandated production phase-outs of a number of solvents, including 1,1,1-trichloroethane, an ozone-depleting chemical (ODC). This solvent was used extensively in the production of the Reusable Solid Rocket Motors (RSRMs) for the Space Shuttle. Many tests have been performed to identify replacement cleaners. One major area of concern in the selection of a new cleaner has been compatibility. Some specific areas considered included cleaner compatibility with non-metallic surfaces, painted surfaces, support materials such as gloves and wipers as well as corrosive properties of the cleaners on the alloys used on these motors. The intent of this paper is to summarize the test logic, methodology, and results acquired from testing the many cleaner and material combinations.
The compatibility of fingerprint visualization techniques with immunolabeling
van Dam, Annemieke; Aalders, Maurice C. G.; van Leeuwen, Ton G.; Lambrechts, Saskia A. G.
2013-01-01
The chemical composition of a fingermark potentially holds a wealth of information about the fingermark donor, which can be extracted by immunolabeling. Immunolabeling can be used to detect specific components in fingermarks; however, to be applicable in the forensic field, it should be compatible
Rate-Compatible Protograph LDPC Codes
Nguyen, Thuy V. (Inventor); Nosratinia, Aria (Inventor); Divsalar, Dariush (Inventor)
2014-01-01
Digital communication coding methods resulting in rate-compatible low density parity-check (LDPC) codes built from protographs. Described digital coding methods start with a desired code rate and a selection of the numbers of variable nodes and check nodes to be used in the protograph. Constraints are set to satisfy a linear minimum distance growth property for the protograph. All possible edges in the graph are searched for the minimum iterative decoding threshold and the protograph with the lowest iterative decoding threshold is selected. Protographs designed in this manner are used in decode and forward relay channels.
Development of Calcomp compatible interface library 'piflib' on X Window System
International Nuclear Information System (INIS)
Tanabe, Hidenobu; Yokokawa, Mitsuo; Onuma, Yoshio.
1993-05-01
Graphics processing at JAERI mainly has been executed on mainframe computers with Calcomp compatible graphics libraries. With spread of engineering workstations (EWS), it is important that those enormous graphics softwares be able to be carried out on EWS. The Calcomp compatible interface library 'piflib' has been developed on the X Window System, which is the most popular window environments on EWS. In this report, specifications of the library 'piflib' and its usages are presented. The cooperative processing with mainframe computers is also described. (author)
Construction of Rate-Compatible LDPC Codes Utilizing Information Shortening and Parity Puncturing
Directory of Open Access Journals (Sweden)
Jones Christopher R
2005-01-01
Full Text Available This paper proposes a method for constructing rate-compatible low-density parity-check (LDPC codes. The construction considers the problem of optimizing a family of rate-compatible degree distributions as well as the placement of bipartite graph edges. A hybrid approach that combines information shortening and parity puncturing is proposed. Local graph conditioning techniques for the suppression of error floors are also included in the construction methodology.
A practical exact maximum compatibility algorithm for reconstruction of recent evolutionary history
Cherry, Joshua L.
2017-01-01
Background Maximum compatibility is a method of phylogenetic reconstruction that is seldom applied to molecular sequences. It may be ideal for certain applications, such as reconstructing phylogenies of closely-related bacteria on the basis of whole-genome sequencing. Results Here I present an algorithm that rapidly computes phylogenies according to a compatibility criterion. Although based on solutions to the maximum clique problem, this algorithm deals properly with ambiguities in the data....
Mitta, G; Gourbal, B; Grunau, C; Knight, M; Bridger, J M; Théron, A
2017-01-01
This review reexamines the results obtained in recent decades regarding the compatibility polymorphism between the snail, Biomphalaria glabrata, and the pathogen, Schistosoma mansoni, which is one of the agents responsible for human schistosomiasis. Some results point to the snail's resistance as explaining the incompatibility, while others support a "matching hypothesis" between the snail's immune receptors and the schistosome's antigens. We propose here that the two hypotheses are not exclusive, and that the compatible/incompatible status of a particular host/parasite couple probably reflects the balance of multiple molecular determinants that support one hypothesis or the other. Because these genes are involved in a coevolutionary arms race, we also propose that the underlying mechanisms can vary. Finally, some recent results show that environmental factors could influence compatibility. Together, these results make the compatibility between B. glabrata and S. mansoni an increasingly complex puzzle. We need to develop more integrative approaches in order to find targets that could potentially be manipulated to control the transmission of schistosomiasis. Copyright © 2017 Elsevier Ltd. All rights reserved.
Jing, Hui; Song, Jingyuan; Zheng, Junnian
2018-03-01
Discoidin domain receptor 1 (DDR1) is a receptor tyrosine kinase activated by various types of collagens that performs a critical role in cell attachment, migration, survival and proliferation. The functions of DDR1 in various types of tumor have been studied extensively. However, in breast carcinoma, the roles of collagen-evoked DDR1 remain ill defined. Although a number of studies have reported that DDR1 promotes apoptosis and inhibits migration in breast carcinoma, it has also been reported to be associated with tumor cell survival, chemoresistance to genotoxic drugs and the facilitation of invasion. The present review summarizes current progress and the complex effects of DDR1 in the field of breast carcinoma, and presents DDR1 as a promising therapeutic target.
Music and the brain - design of an MEG compatible piano.
Chacon-Castano, Julian; Rathbone, Daniel R; Hoffman, Rachel; Heng Yang; Pantazis, Dimitrios; Yang, Jason; Hornberger, Erik; Hanumara, Nevan C
2017-07-01
Magnetoencephalography (MEG) neuroimaging has been used to study subjects' responses when listening to music, but research into the effects of playing music has been limited by the lack of MEG compatible instruments that can operate in a magnetically shielded environment without creating electromagnetic interference. This paper describes the design and preliminary testing of an MEG compatible piano keyboard with 25 full size keys that employs a novel 3-state optical encoder design and electronics to provide realistic velocity-controlled volume modulation. This instrument will allow researchers to study musical performance on a finer timescale than fMRI and enable a range of MEG studies.
Uniqueness of the joint measurement and the structure of the set of compatible quantum measurements
Guerini, Leonardo; Terra Cunha, Marcelo
2018-04-01
We address the problem of characterising the compatible tuples of measurements that admit a unique joint measurement. We derive a uniqueness criterion based on the method of perturbations and apply it to show that extremal points of the set of compatible tuples admit a unique joint measurement, while all tuples that admit a unique joint measurement lie in the boundary of such a set. We also provide counter-examples showing that none of these properties are both necessary and sufficient, thus completely describing the relation between the joint measurement uniqueness and the structure of the compatible set. As a by-product of our investigations, we completely characterise the extremal and boundary points of the set of general tuples of measurements and of the subset of compatible tuples.
Plasmonic Modulator Using CMOS Compatible Material Platform
DEFF Research Database (Denmark)
Babicheva, Viktoriia; Kinsey, Nathaniel; Naik, Gururaj V.
2014-01-01
In this work, a design of ultra-compact plasmonic modulator is proposed and numerically analyzed. The device l ayout utilizes alternative plas monic materials such as tr ansparent conducting oxides and titanium nitride which potentially can be applied for CMOS compatible process. The modulation i...... for integration with existing insulator-metal-insu lator plasmonic waveguides as well as novel photonic/electronic hybrid circuits...
RESONANCE COMPATIBILITY BETWEEN ENDOSONIC TIPS AND ULTRASONIC DEVICES OF DIFFERENT BRANDS.
Directory of Open Access Journals (Sweden)
Kalin K. Shiyakov
2014-11-01
Full Text Available The aim of the study was to determine the compatibility of 6 piezoelectric scalers - Mini Piezon (EMS, Pyon 2 LED (W&H, Woodpecker HW-3H (GWMI, Varios 550 (NSK, P5 Newtron (Satelec-Acteon and DTE HD-7H (GWMI with 8 types of endosonic tips for separated instruments removal - K-files # 20 and 25 (EMS, ET25 (Satelec, Redo 2 (VDW, CPR-tips 6,7,8 (Obtura Spartan, Proultra Endo tips 6,7,8 (Dentsply-Maillefer, RT3 (EMS, Endo E3 (W&H, E7 (NSK. Methods: Examined and measured was the change in the tips’ displacement amplitude with the power increase of the scalers under total magnification 80x with an optical microscope (Leica MZ6 and an image-measuring software (Klonk Image Measurement. Results: Ultrasonic devices’ compatibility with the examined tips was as follows: Woodpecker – 76,9%, Mini Piezon – 61,5%, Pyon 2 LED - 30,7%, Varios 550 – 83,3%, P5 Newtron – 83,3%, DTE – 33,3%. Lack of compatibility was found in 40,35% of all cases. In 29,82% of the cases of lack of compatibility it was demonstrated as a non-effective vibration, and in the rest of the cases – 10,53% - uncontrolled over-powerful vibration, which was dangerous to use. Conclusion: Endosonic tips should be carefully chosen in accordance with the ultrasonic scaler used.
Visual compatibility of defibrotide with selected drugs during simulated Y-site administration.
Correard, Florian; Savry, Amandine; Gauthier-Villano, Laurence; Pisano, Pascale; Pourroy, Bertrand
2014-08-01
The visual compatibility of a solution of defibrotide (the only drug recommended for treatment and prophylaxis of hepatic venoocclusive disease) with solutions of various drugs commonly administered in bone marrow transplant procedures was studied. Solutions of 43 drug products in concentrations typically used in clinical practice were evaluated in 1:1 mixtures with defibrotide solution in glass tubes kept at room temperature. The evaluated products included antiinfectious, corticoid, sedative, analgesic, and cardiovascular agents widely used for hematopoietic stem cell transplantation and other marrow transplant procedures; in most cases, test solutions were prepared via dilution in or reconstitution with sterile water, 0.9% sodium chloride injection, or 5% dextrose injection. The mixtures were visually observed immediately after manual mixing and at specified time points (60, 150, and 240 minutes). Visual compatibility was defined as the absence of color change, haze, fibers, particles, gas generation, and precipitate formation. The effect of mixing order on visual compatibility was ascertained. Of the 43 tested drug solutions, 36 were found to be visually compatible with the defibrotide solution over the entire four-hour study period. Solutions of 7 drugs (amikacin, furosemide, midazolam, mycophenolate mofetil, nicardipine, tobramycin, and vancomycin) were visually incompatible with defibrotide solution. In some cases, evidence of incompatibility was observed intermittently or was dependent on mixing order. Defibrotide solution was found to be visually compatible with solutions of 36 i.v. products that are likely to be coadministered with the drug in a bone marrow transplant unit. Seven drug solutions were visually incompatible with defibrotide solution. Copyright © 2014 by the American Society of Health-System Pharmacists, Inc. All rights reserved.
Development of a UNIX network compatible reactivity computer
International Nuclear Information System (INIS)
Sanchez, R.F.; Edwards, R.M.
1996-01-01
A state-of-the-art UNIX network compatible controller and UNIX host workstation with MATLAB/SIMULINK software were used to develop, implement, and validate a digital reactivity calculation. An objective of the development was to determine why a Macintosh-based reactivity computer reactivity output drifted intolerably
Rate-Compatible LDPC Codes with Linear Minimum Distance
Divsalar, Dariush; Jones, Christopher; Dolinar, Samuel
2009-01-01
A recently developed method of constructing protograph-based low-density parity-check (LDPC) codes provides for low iterative decoding thresholds and minimum distances proportional to block sizes, and can be used for various code rates. A code constructed by this method can have either fixed input block size or fixed output block size and, in either case, provides rate compatibility. The method comprises two submethods: one for fixed input block size and one for fixed output block size. The first mentioned submethod is useful for applications in which there are requirements for rate-compatible codes that have fixed input block sizes. These are codes in which only the numbers of parity bits are allowed to vary. The fixed-output-blocksize submethod is useful for applications in which framing constraints are imposed on the physical layers of affected communication systems. An example of such a system is one that conforms to one of many new wireless-communication standards that involve the use of orthogonal frequency-division modulation
Evaluation of four methods for platelet compatibility testing
International Nuclear Information System (INIS)
McFarland, J.G.; Aster, R.H.
1987-01-01
Four platelet compatibility assays were performed on serum and platelet or lymphocyte samples from 38 closely HLA-matched donor/recipient pairs involved in 55 single-donor platelet transfusions. The 22 patients studied were refractory to transfusions of pooled random-donor platelets. Of the four assays (platelet suspension immunofluorescence, PSIFT; 51 Cr release; microlymphocytotoxicity; and a monoclonal anti-IgG assay, MAIA), the MAIA was most predictive of platelet transfusion outcome (predictability, 74% for one-hour posttransfusion platelet recovery and 76% for 24-hour recovery). The only other assay to reach statistical significance was the PSIFT (63% predictability for one-hour posttransfusion recovery). The degree of HLA compatibility between donor and recipient (exact matches v those utilizing cross-reactive associations) was unrelated to the ability of the MAIA to predict transfusion results. The MAIA may be capable of differentiating HLA antibodies, ABO antibodies, and platelet-specific antibodies responsible for failure of HLA-matched and selectively mismatched single-donor platelet transfusions
Effect of Time on Gypsum-Impression Material Compatibility
Won, John Boram
The purpose of this study was to evaluate the compatibility of dental gypsum with three recently introduced irreversible hydrocolloid (alginate) alternatives. The test materials were Alginot® (Kerr™), Position Penta Quick® (3M ESPE™) and Silgimix ® (Sultan Dental™). The irreversible hydrocolloid impression material, Jeltrate Plus antimicrobial® (Dentsply Caulk™) served as the control. Materials and Methods: Testing of materials was conducted in accordance with ANSI/ADA Specification No. 18 for Alginate Impression Materials. Statistical Analysis: The 3-Way ANOVA test was used to analyze measurements between different time points at a significance level of (p Outcome: It was found that there was greater compatibility between gypsum and the alternative materials over time than the traditional irreversible hydrocolloid material that was tested. A statistically significant amount of surface change/incompatibility was found over time with the combination of the dental gypsum products and the control impression material (Jeltrate Plus antimicrobial®).
Electromagnetic compatibility of tools and automated process control systems of NPP units
International Nuclear Information System (INIS)
Alpeev, A.S.
1994-01-01
Problems of electromagnetic compatibility of automated process control subsystems in NPP units are discussed. It is emphasized, that at the stage of development of request for proposal for each APC subsystem special attention should be paid to electromagnetic situation in specific room and requirements to the quality of functions performed by the system. Besides, requirements to electromagnetic compatibility tests at the work stations should be formulated, and mock-ups of the subsystems should be tested
A Push-pull Protocol to Reduce Colonization of Bird Nest Boxes by Honey Bees.
Efstathion, Caroline A; Kern, William H
2016-09-04
Introduction of the invasive Africanized honey bee (AHB) into the Neotropics is a serious problem for many cavity nesting birds, specifically parrots. These bees select cavities that are suitable nest sites for birds, resulting in competition. The difficulty of removing bees and their defensive behavior makes a prevention protocol necessary. Here, we describe a push-pull integrated pest management protocol to deter bees from inhabiting bird boxes by applying a bird safe insecticide, permethrin, to repel bees from nest boxes, while simultaneously attracting them to pheromone-baited swarm traps. Shown here is an example experiment using Barn Owl nest boxes. This protocol successfully reduced colonization of Barn Owl nest boxes by Africanized honey bees. This protocol is flexible, allowing adjustments to accommodate a wide range of bird species and habitats. This protocol could benefit conservation efforts where AHB are located.
An MRI-compatible hand sensory vibrotactile system
International Nuclear Information System (INIS)
Wang, Fa; Lakshminarayanan, Kishor; Slota, Gregory P; Seo, Na Jin; Webster, John G
2015-01-01
Recently, the application of vibrotactile noise to the wrist or back of the hand has been shown to enhance fingertip tactile sensory perception (Enders et al 2013), supporting the potential for an assistive device worn at the wrist, that generates minute vibrations to help the elderly or patients with sensory deficit. However, knowledge regarding the detailed physiological mechanism behind this sensory improvement in the central nervous system, especially in the human brain, is limited, hindering progress in development and use of such assistive devices. To enable investigation of the impact of vibrotactile noise on sensorimotor brain activity in humans, a magnetic resonance imaging (MRI)-compatible vibrotactile system was developed to provide vibrotactile noise during an MRI of the brain. The vibrotactile system utilizes a remote (outside the MR room) signal amplifier which provides a voltage from –40 to +40 V to drive a 12 mm diameter piezoelectric vibrator (inside the MR room). It is portable and is found to be MRI-compatible which enables its use for neurologic investigation with MRI. The system was also found to induce an improvement in fingertip tactile sensation, consistent with the previous study. (note)
A low-cost MRI compatible keyboard
DEFF Research Database (Denmark)
Jensen, Martin Snejbjerg; Heggli, Ole Adrian; Alves da Mota, Patricia
2017-01-01
, presenting a challenging environment for playing an instrument. Here, we present an MRI-compatible polyphonic keyboard with a materials cost of 850 $, designed and tested for safe use in 3T (three Tesla) MRI-scanners. We describe design considerations, and prior work in the field. In addition, we provide...... recommendations for future designs and comment on the possibility of using the keyboard in magnetoencephalography (MEG) systems. Preliminary results indicate a comfortable playing experience with no disturbance of the imaging process....
Compatibility of AlN ceramics with molten lithium
Energy Technology Data Exchange (ETDEWEB)
Yoneoka, Toshiaki; Sakurai, Toshiharu; Sato, Toshihiko; Tanaka, Satoru [Tokyo Univ., Department of Quantum Engineering and Systems Science, Tokyo (Japan)
2002-04-01
AlN ceramics were a candidate for electrically insulating materials and facing materials against molten breeder in a nuclear fusion reactor. In the nuclear fusion reactor, interactions of various structural materials with solid and liquid breeder materials as well as coolant materials are important. Therefore, corrosion tests of AlN ceramics with molten lithium were performed. AlN specimens of six kinds, different in sintering additives and manufacturing method, were used. AlN specimens were immersed into molten lithium at 823 K. Duration for the compatibility tests was about 2.8 Ms (32 days). Specimens with sintering additive of Y{sub 2}O{sub 3} by about 5 mass% formed the network structure of oxide in the crystals of AlN. It was considered that the corrosion proceeded by reduction of the oxide network and the penetration of molten lithium through the reduced pass of this network. For specimens without sintering additive, Al{sub 2}O{sub 3} containing by about 1.3% in raw material was converted to fine oxynitride particles on grain boundary or dissolved in AlN crystals. After immersion into lithium, these specimens were found to be sound in shape but reduced in electrical resistivity. These degradation of the two types specimens were considered to be caused by the reduction of oxygen components. On the other hand, a specimen sintered using CaO as sintering additive was finally became appreciably high purity. This specimen showed good compatibility for molten lithium at least up to 823 K. It was concluded that the reduction of oxygen concentration in AlN materials was essential in order to improve the compatibility for molten lithium. (author)
Compatibility of refractory materials with boiling sodium
International Nuclear Information System (INIS)
Meacham, S.A.
1976-01-01
The program employed to determine the compatibility of commercially available refractories with boiling sodium is described. The effects of impurities contained within the refractory material, and their relations with the refractory's physical stability are discussed. Also, since consideration of refractories for use as an insulating material within Liquid Metal Fast Breeder Reactor Plants (LMFBR's) is currently under investigation; recommendations, based upon this program, are presented
Assessing Compatibility of Direct Detection Data: Halo-Independent Global Likelihood Analyses
Gelmini, Graciela B.
2016-10-18
We present two different halo-independent methods utilizing a global maximum likelihood that can assess the compatibility of dark matter direct detection data given a particular dark matter model. The global likelihood we use is comprised of at least one extended likelihood and an arbitrary number of Poisson or Gaussian likelihoods. In the first method we find the global best fit halo function and construct a two sided pointwise confidence band, which can then be compared with those derived from the extended likelihood alone to assess the joint compatibility of the data. In the second method we define a "constrained parameter goodness-of-fit" test statistic, whose $p$-value we then use to define a "plausibility region" (e.g. where $p \\geq 10\\%$). For any halo function not entirely contained within the plausibility region, the level of compatibility of the data is very low (e.g. $p < 10 \\%$). As an example we apply these methods to CDMS-II-Si and SuperCDMS data, assuming dark matter particles with elastic s...
Environmental compatibility investigation of the Garzweiler II open cast mine project
International Nuclear Information System (INIS)
Oster, A.; Gaertner, D.
1994-01-01
Based on an EEC directive, the law on the investigation of ecological compatibility came into force in 1990. With the application of these European directives in national law, investigations to determine the ecological compatibility must now be carried out for projects to exploit brown coal. In this connection and in conjunction with the licensing procedure for Garzweiler II, Rheinbraun in 1992 for the first time compiled data on the investigations carried out to determine the ecological compatibility of an open cast mine. The data on these investigations include information on the necessity of the open cast mine and on alternative projects that have been examined, as well as a description of the project in question as regards its nature and extent. As far as the legally specified protected objects are concerned, i.e. people, water, air, nature (animals and plants, soil, climate and landscape) as well as cultural and other material objects, itemized data are furnished on the development and effects of the project and on countermeasures and the planned traffic and transport concept. (orig.) [de
75 FR 54546 - Amendment of the Commission's Rules Governing Hearing Aid-Compatible Mobile Handsets
2010-09-08
... compatibility standards are already being met for handsets that operate on a variety of 2G and 3G air interfaces... the Commission's Rules Governing Hearing Aid- Compatible Mobile Handsets AGENCY: Federal... to extend the scope of the rules beyond the current category of Commercial Mobile Radio Service (CMRS...
Compatibility and stability of valsartan in a solid pharmaceutical formulation
Directory of Open Access Journals (Sweden)
Tamíris Amanda Júlio
2013-12-01
Full Text Available Valsartan (VAL is a highly selective blocker of the angiotensin II receptor that has been widely used in the treatment of hypertension. Active pharmaceutical ingredient compatibility with excipients (crospovidone, hypromellose, magnesium stearate, microcrystalline cellulose and titanium dioxide is usually evaluated in solid pharmaceutical development. Compatibility and stability can be evaluated by liquid chromatography. Studies were performed using binary mixtures of 1:1 (w/w VAL/excipient; samples were stored under accelerated stability test conditions (40 ºC at 75% relative humidity. The results indicate that VAL is incompatible with crospovidone and hypromellose, which reduced the VAL content and gave rise to new peaks in the chromatogram due to degradation products.
Electromagnetic compatibility of PLC adapters for in-home/domestic networks
Potisk, Lukas; Hallon, Jozef; Orgon, Milos; Fujdiak, Radek
2018-01-01
The use of programable logic controllers (PLC) technology in electrical networks 230 V causes electromagnetic radiation that interferes with other electrical equipment connected to the network [1-4]. Therefore, this article describes the issues of electromagnetic compatibility (EMC) of new PLC adapters used in IP broadband services in a multi-user environment. The measurements of disturbing electromagnetic field originated in PLC adapters were made in a certified laboratory EMC (laboratory of electromagnetic compatibility) in the Institute of Electrical Engineering at Faculty of Electrical Engineering and Information Technology of the Slovak University of Technology in Bratislava. The measured spectra of the radiated electromagnetic field will be compared with the results obtained when testing older PLC modems [5].
Detection of human leukocyte antigen compatibility and antibodies in liver transplantation in China
Institute of Scientific and Technical Information of China (English)
Xue-Qin Meng; Xuan Zhang; Jun Fan; Lin Zhou; Bing Hao; Xiao-Ming Chen; Wei-Hang Ma; Shu-Sen Zheng
2009-01-01
BACKGROUND: The exact roles of human leukocyte antigen (HLA) compatibility, HLA antibodies and underlying diseases in acute rejection of liver transplants are not clear. Moreover, cytomegalovirus (CMV) infection, one of the most common infections after transplantation, is related to HLA genotype and the incidence of acute rejection. METHODS: Since there are controversial reports, we analyzed the impact of HLA matching, HLA antibodies and underlying diseases in 38 liver transplant recipients in China, and assessed the association of CMV infection and HLA compatibility. RESULTS: The frequency of no HLA compatibility was high in patients without antigenemia (P=0.019). All 17 patients with HLA-A matching developed antigenemia (P0.05). In patients with acute rejection, no differences were found in the incidence of acute rejection in transplants for hepatitis B, tumors, or combined hepatitis B and tumors (P>0.05).CONCLUSIONS: There are fewer acute rejections in transplants with more HLA compatibilities. Speciifc investigations of underlying diseases and HLA typing may be necessary in liver transplantation. The mechanisms of CMV infection and HLA matching should be further studied. HLA before transplantation should be examined for the prevention of acute rejection and CMV infection.
The ITER EC H and CD upper launcher: Analysis of remote handling compatibility
International Nuclear Information System (INIS)
Ronden, D.M.S.; Baar, M. de; Chavan, R.; Elzendoorn, B.S.Q.; Goodman, T.; Heemskerk, C.J.M.; Henderson, M.A.; Koning, J.F.; Saibene, G.; Spaeh, P.; Strauss, D.
2011-01-01
Research highlights: → RH class 1 requires a full RH compatible design and a detailed maintenance plan that needs to be demonstrated through hardware mockup testing. → RH class 2 requires a full RH compatible design and a detailed and verified maintenance plan. → RH class 3 requires a RH compatible design and a basic maintenance plan. - Abstract: The present design of the ECH (Electron Cyclotron Heating) upper port launcher has been evaluated in light of the ITER remote handling (RH) requirements. Changes to the launcher design associated with the accessibility, maintainability and manageability of replaceable components are presented. Captive bolts were placed along the flange of the Blanket Shielding Module (BSM). A hinge mechanism was integrated to simplify the (dis-)mounting of the BSM and a frame with incorporated cooling and actuation lines was suggested for simplified mounting and replacement of the steerable mirrors. Rotating the upper port plug upside-down improves maintenance access and component handling. Tools are proposed for manipulation of the port plug and its sub-components. The RH compatibility analysis can improve a design. Early consideration of RH requirements and implementation of necessary features is therefore vital.
Compatibility Grab Sampling and Analysis Plan for Fiscal Year 2001
International Nuclear Information System (INIS)
LAURICELLA, T.L.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for grab samples obtained to address waste compatibility
Preliminary assessment on compatibility of DUPIC fuel with CANDU-6
International Nuclear Information System (INIS)
Choi, Hang-Bok; Roh, G.H.; Jeong, C.J.; Rhee, B.W.; Choi, J.W.; Boss, C.R.
1997-01-01
The compatibility of DUPIC fuel with the existing CANDU-6 reactor was assessed. The technical issues of DUPIC fuel compatibility were chosen based on the CANDU physics design requirements and inherent characteristics of DUPIC fuel. The compatibility was assessed for the reference DUPIC fuel composition which was determined to reduce the composition heterogeneity and improve the spent PWR fuel utilization. Preliminary studies on a CANDU core loaded with DUPIC fuel have shown that the nominal power distribution is flatter than that of a natural uranium core when a 2-bundle shift refueling scheme is used, which reduces the reactivity worths of devices in the core and, therefore, the performance of reactivity devices was assessed. The safety of the core was assessed by a LOCA simulation and it was found that the power pulse upon LOCA can be maintained below that in the natural uranium core when a poison material is used in the DUPIC fuel. For the feasibility of handling DUPIC fuel in the plant, it will be necessary to introduce new equipment to load the DUPIC fuel in the refueling magazine. The radiation effect of DUPIC fuel on both the reactor hardware and the environment will be qualitatively analyzed later. (author)
Compatibility analysis of 3D printer resin for biological applications
Sivashankar, Shilpa
2016-08-30
The salient features of microfluidics such as reduced cost, handling small sample and reagent volumes and less time required to fabricate the devices has inspired the present work. The incompatibility of three-dimensional printer resins in their native form and the method to improve their compatibility to many biological processes via surface modification are reported. The compatibility of the material to build microfluidic devices was evaluated in three different ways: (i) determining if the ultraviolet (UV) cured resin inhibits the polymerase chain reaction (PCR), i.e. testing devices for PCR compatibility; (ii) observing agglutination complex formed on the surface of the UV cured resin when anti-C-reactive protein (CRP) antibodies and CRP proteins were allowed to agglutinate; and (iii) by culturing human embryonic kidney cell line cells and testing for its attachment and viability. It is shown that only a few among four in its native form could be used for fabrication of microchannels and that had the least effect on biological molecules that could be used for PCR and protein interactions and cells, whereas the others were used after treating the surface. Importance in building lab-on-chip/micrototal analysis systems and organ-on-chip devices is found.
COSIDERATIONS REGARDING THE COMPATIBILITY BETWEEN LEADERSHIP AND TEAMWORK SKILLS
Directory of Open Access Journals (Sweden)
Codruta Dana Duda Daianu
2015-02-01
Full Text Available The team leader is the author of vision, mentor, guide, motivator, source of encouragement and supportive team. The leader helps team members to focus on the big picture of the project, to give the best of them, to follow the right path and stay united. Leader qualities must necessarily include its ability to work together, to be folded on the processes that describe functional and structural developments in embedded team. The issue of the leader development includes the necessity to concurrently form the skills of tem working. The working paper underlines that these two formative desiderate are compatible, correlative and complementary. So, in the study that we undertake we proposed to determine the degree of compatibility between the two demands of education, as follows: the training of leader capable to exercise also the specific activities of teamwork
Compatibility of entomopathogenic fungi with extracts of plants and ...
African Journals Online (AJOL)
The compatibility of some commercial botanicals (Biospark, Phytophrate, Exodos, Biodos and Neemgold) and of solvent extracts of Syndrella nodiflora, Premna tomentosa, Vitex negundo, Ipomea carnea, Pteridium aquilinum (leaves) and Annona squomosa (seeds) with Beauveria bassiana (Bals.) Vuil., Isaria ...
Compatibility of refractory alloys with space reactor system coolants and working fluids
International Nuclear Information System (INIS)
DeVan, J.H.; DiStefano, J.R.; Hoffman, E.E.
1984-01-01
The bulk of this report deals with compatibility studies in liquid lithium and boiling potassium. Substantial information is also presented concerning the reactivity of niobium and tantalum alloys with residual gases in high and ultrahigh vacuum atmospheres. The remaining information, which is much less extensive, covers the compatibility behavior of molybdenum and tungsten alloys in alkali metals and a qualitative assessment of the use of refractory metals for containing helium in a closed Brayton cycle. 22 references, 29 figures, 14 tables
Compatibility of 316L stainless steel with tritium breeders for fusion reactors
International Nuclear Information System (INIS)
Broc, M.; Fauvet, P.; Flament, T.; Sannier, J.
1986-06-01
Compatibility problems with structural materials are a concern for the choice of the tritium breeder for fusion reactors. In the frame of the European Programme on Fusion Technology, two types of blankets are considered: liquid (eutectic lithium-lead alloy at 0.68 wt % Li: 17Li83Pb) and solid (lithium aluminate or silicate) breeders. This paper is devoted to compatibility studies of 316L stainless steel with 17Li83Pb alloy and γ-LiA10 2 ceramic
Du, W; Amarachintha, S; Wilson, A; Pang, Q
2017-02-01
Fanconi anemia (FA) is an inherited bone marrow failure syndrome with extremely high risk of leukemic transformation. Here we investigate the relationship between DNA damage response (DDR) and leukemogenesis using the Fanca knockout mouse model. We found that chronic exposure of the Fanca -/- hematopoietic stem cells to DNA crosslinking agent mitomycin C in vivo leads to diminished DDR, and the emergence/expansion of pre-leukemia stem cells (pre-LSCs). Surprisingly, although genetic correction of Fanca deficiency in the pre-LSCs restores DDR and reduces genomic instability, but fails to prevent pre-LSC expansion or delay leukemia development in irradiated recipients. Furthermore, we identified transcription program underlying dysregulated DDR and cell migration, myeloid proliferation, and immune response in the Fanca -/- pre-LSCs. Forced expression of the downregulated DNA repair genes, Rad51c or Trp53i13, in the Fanca -/- pre-LSCs partially rescues DDR but has no effect on leukemia, whereas shRNA knockdown of the upregulated immune receptor genes Trem1 or Pilrb improves leukemia-related survival, but not DDR or genomic instability. Furthermore, Trem1 cooperates with diminished DDR in vivo to promote Fanca -/- pre-LSC expansion and leukemia development. Our study implicates diminishing DDR as a root cause of FA leukemogenesis, which subsequently collaborates with other signaling pathways for leukemogenic transformation.
2011-10-27
... 11-153] Basic Service Tier Encryption Compatibility Between Cable Systems and Consumer Electronics... substantially affect compatibility between cable service and consumer electronics equipment for most subscribers... problems between cable service and consumer electronics equipment were limiting and/or precluding the...
Compatibility of the holy Qur'an with sciences: anthropological ...
African Journals Online (AJOL)
Abstract - In holy Qur'an countless verses are related to topics on the nature and the ... concepts compatible with the most recent scientific conclusions as that relating to our ... In fact these concepts are often more and less masked within.
Third Degree Skin Burns Caused by an MRI Compatible Electrocardiographic Monitoring System
DEFF Research Database (Denmark)
Brix, Lau; Isaksen, Christin Rosendahl Graff; Kristensen, Birgitte Hornbæk
of the assigned compatibility specifications of the leads due to the use of TFE sequences with high SAR values. MRI compatible monitoring systems are only safe when used with proper care. The presented burn cases may have been avoided if space had been provided between the ECG leads and the skin using a cloth....... This holds true even in cases in which the devices are MRI compatible and therefore safe in specified MRI environments. Of particular interest to this case report is skin burns caused by the ECG monitoring equipment. In this context, several cases of ECG electrode related burns have been reported, while...... burns caused by the ECG cables are less common [1]. This case report presents two unusual cases of skin burns which were caused by MRI safe ECG leads during scanning. Cases:Two patients suffered third degree burns using MRI approved ECG leads (Medrad® Veris MR Monitor system) in a Siemens Skyra 3...
Interactive virtual mock-ups for Remote Handling compatibility assessment of heavy components
Energy Technology Data Exchange (ETDEWEB)
Oosterhout, J. van, E-mail: j.vanoosterhout@differ.nl [FOM Institute DIFFER (Dutch Institute for Fundamental Energy Research), Association EURATOM-FOM, Partner in the Trilateral Euregio Cluster, PO Box 1207, 3430 BE Nieuwegein (Netherlands); Heemskerk, C.J.M.; Koning, J.F. [Heemskerk Innovative Technology B.V., Jonckerweg 12, 2201 DZ Noordwijk 6 (Netherlands); Ronden, D.M.S.; Baar, M. de [FOM Institute DIFFER (Dutch Institute for Fundamental Energy Research), Association EURATOM-FOM, Partner in the Trilateral Euregio Cluster, PO Box 1207, 3430 BE Nieuwegein (Netherlands)
2014-10-15
Highlights: •Specific ITER components require RHCA on hardware mock-ups. •Hardware mock-ups are expensive and have a long lead time. •Interactive Virtual Reality mock-ups are readily available and easily adapted. •This paper analysis and proposes improvements to simulator capabilities. -- Abstract: ITER standards Tesini (2009) require hardware mock-ups to validate the Remote Handling (RH) compatibility of RH class 1- and critical class 2-components. Full-scale mock-ups of large ITER components are expensive, have a long lead time and lose their relevance in case of design changes. Interactive Virtual Reality simulations with real time rigid body dynamics and contact interaction allow for RH Compatibility Assessment during the design iterations. This paper explores the use of interactive virtual mock-ups to analyze the RH compatibility of heavy component handling and maintenance. It infers generic maintenance operations from the analysis and proposes improvements to the simulator capabilities.
Interactive virtual mock-ups for Remote Handling compatibility assessment of heavy components
International Nuclear Information System (INIS)
Oosterhout, J. van; Heemskerk, C.J.M.; Koning, J.F.; Ronden, D.M.S.; Baar, M. de
2014-01-01
Highlights: •Specific ITER components require RHCA on hardware mock-ups. •Hardware mock-ups are expensive and have a long lead time. •Interactive Virtual Reality mock-ups are readily available and easily adapted. •This paper analysis and proposes improvements to simulator capabilities. -- Abstract: ITER standards Tesini (2009) require hardware mock-ups to validate the Remote Handling (RH) compatibility of RH class 1- and critical class 2-components. Full-scale mock-ups of large ITER components are expensive, have a long lead time and lose their relevance in case of design changes. Interactive Virtual Reality simulations with real time rigid body dynamics and contact interaction allow for RH Compatibility Assessment during the design iterations. This paper explores the use of interactive virtual mock-ups to analyze the RH compatibility of heavy component handling and maintenance. It infers generic maintenance operations from the analysis and proposes improvements to the simulator capabilities
Compatibility of fixed orthodontic appliances with MR environment
Czech Academy of Sciences Publication Activity Database
Starčuk jr., Zenon; Hubálková, H.; Starčuková, Jana; Linetskiy, I.; Bartušek, Karel; Krupa, P.
2006-01-01
Roč. 19, Suppl. 1 (2006), EPOS 726:1-7 E-ISSN 1352-8661 R&D Projects: GA MZd NR8110 Institutional research plan: CEZ:AV0Z20650511 Keywords : orthodontic appliance * magnetic resonance * compatibility * dentistry * artifact Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 0.756, year: 2005 http://posters.webges.com/esmrmb/epos
Non-stochastic effects: compatibility with present ICRP recommendations
International Nuclear Information System (INIS)
Field, S.B.; Upton, A.C.; New York Univ., NY
1985-01-01
The present recommendations of the ICRP (International Commission on Radiological Protection) are almost entirely based on 'stochastic effects' of ionizing radiation, i.e. cancer induction and heritable effects. In a recent report the compatibility of present recommendations with non-stochastic effects has been considered. The present paper is a summary of these findings. (author)
A new technique for generating spectrum compatible accelerogram
International Nuclear Information System (INIS)
Gosh, A.K.; Muralidharan, N.
1985-01-01
A new technique for generating spectrum compatible earthquake accelerogram is presented. Simplified linearised schemes are used to determine the weights of the modulated sinewaves used to represent the ground acceleration in conformity with the instants of time of attaining the maximum responses of the SDOFs. Some typical numerical results are presented in the paper. (orig.)
DEFF Research Database (Denmark)
Aguirre, Andrea A; Wollenweber, Bernd; Frei, Ursula K
2012-01-01
available for predicting pollen haplotype frequencies and pollen compatibility in tetraploid species. Results PollenCALC is a software tool written in C++ programming language that can predict pollen compatibility percentages for polyploid species with a two-locus (S, Z) self-incompatibility system...
Electromagnetic compatibility of nuclear power plants
International Nuclear Information System (INIS)
Cabayan, H.S.
1983-01-01
Lately, there has been a mounting concern about the electromagnetic compatibility of nuclear-power-plant systems mainly because of the effects due to the nuclear electromagnetic pulse, and also because of the introduction of more-sophisticated and, therefore, more-susceptible solid-state devices into the plants. Questions have been raised about the adequacy of solid-state-device protection against plant electromagnetic-interference sources and transients due to the nuclear electromagnetic pulse. In this paper, the author briefly reviews the environment, and the coupling, susceptibility, and vulnerability assessment issues of commercial nuclear power plants
Use of the method of biosphere compatibility for the assessment of environmental protection methods
Vorobyov, Sergey
2018-01-01
The article is devoted to the question of using the indicator of biosphere compatibility for assessing the effectiveness of environmental protection methods. The indicator of biosphere compatibility was proposed by the vice-president of RAASN (Russian Academy of Architecture and Building Sciences), Doctor of Technical Sciences, Professor V.I. Ilyichev. This indicator is allows not only qualitatively but also quantitatively to assess the degree of development of urban urban areas, from the standpoint of preserving the biosphere in urban ecosystems while realizing the city’s main functions. The integral indicator of biosphere compatibility is allows us to assess not only the current ecological situation in the territory under consideration, but also to plan the forecast of its changes for building the new construction projects, or for reconstructing existing ones. The indicator of biosphere compatibility, which is a mathematical expression of the tripartite balance (technosphere, biosphere and population of this area), is allows us to quantify the degree of effectiveness of different method of protecting the environment for choose the most effective for these conditions.
Bakaeva, N. V.; Vorobyov, S. A.; Chernyaeva, I. V.
2017-11-01
The article is devoted to the issue of using the biosphere compatibility indicator to assess the effectiveness of environmental protection methods. The indicator biosphere compatibility was proposed by the vice-president of RAASN (Russian Academy of Architecture and Building Sciences), Doctor of Technical Sciences, Professor V.I. Ilyichev. This indicator allows one to assess not only qualitatively but also quantitatively the degree of urban areas development from the standpoint of preserving the biosphere in urban ecosystems while performing the city’s main functions. The integral biosphere compatibility indicator allows us to assess not only the current ecological situation in the territory under consideration but also to plan the forecast of its changes for the new construction projects implementation or for the reconstruction of the existing ones. The biosphere compatibility indicator, which is a mathematical expression of the tripartite balance (technosphere, biosphere and population of this area), allows us to quantify the effectiveness degree of different methods for environment protection to choose the most effective one under these conditions.
Directory of Open Access Journals (Sweden)
Maria L. Marques
2016-05-01
Full Text Available ABSTRACT The use of vegetable fiber residue in cementitious matrices can be a sustainable technological alternative; however, it still has problems related to the chemical compatibility between the cement and the fibers. The present study evaluated the compatibility of vegetable fibers with cement using three methods of calculation and determined certain physical properties of the fibers and the curve of the temporal evolution of temperature for each composite. The surfaces of the composites were evaluated through atomic force microscope images and the results showed that the pretreatment of fiber washing significantly favors the compatibility with cement for fibers of eucalyptus, coconut and cocoa, with no influence for water hyacinth fiber. Bivariate correlation analyses showed that the compatibility of the composites is favored by the reduction in the degree of swelling, packing density and specific mass. The results showed that there is a potential use of plant fiber in civil construction and that the physical properties of each type of fiber can offer elements for its selection and pretreatment.
Improved compatibility between polystyrene and poly(vinylidene fluoride) by the addition of urea
International Nuclear Information System (INIS)
Melad, O.; Teim, O.A.; Sobeh, E.
2005-01-01
The viscosity behavior of dilute urea solution of dimethylformamide (Dmf) of Polystyrene-Poly(vinylidene fluoride) has been studied at 25 degree C. The results show that the polymer mixtures are incompatible in DMF solution in the absence of urea. The influence of urea addition on the degree of compatibility of the polymer mixture has been studied in terms of the compatibility parameters (A6/M, kbm , A [77] ,a and /?) respectively
JPEG2000-Compatible Scalable Scheme for Wavelet-Based Video Coding
Directory of Open Access Journals (Sweden)
Thomas André
2007-03-01
Full Text Available We present a simple yet efficient scalable scheme for wavelet-based video coders, able to provide on-demand spatial, temporal, and SNR scalability, and fully compatible with the still-image coding standard JPEG2000. Whereas hybrid video coders must undergo significant changes in order to support scalability, our coder only requires a specific wavelet filter for temporal analysis, as well as an adapted bit allocation procedure based on models of rate-distortion curves. Our study shows that scalably encoded sequences have the same or almost the same quality than nonscalably encoded ones, without a significant increase in complexity. A full compatibility with Motion JPEG2000, which tends to be a serious candidate for the compression of high-definition video sequences, is ensured.
JPEG2000-Compatible Scalable Scheme for Wavelet-Based Video Coding
Directory of Open Access Journals (Sweden)
André Thomas
2007-01-01
Full Text Available We present a simple yet efficient scalable scheme for wavelet-based video coders, able to provide on-demand spatial, temporal, and SNR scalability, and fully compatible with the still-image coding standard JPEG2000. Whereas hybrid video coders must undergo significant changes in order to support scalability, our coder only requires a specific wavelet filter for temporal analysis, as well as an adapted bit allocation procedure based on models of rate-distortion curves. Our study shows that scalably encoded sequences have the same or almost the same quality than nonscalably encoded ones, without a significant increase in complexity. A full compatibility with Motion JPEG2000, which tends to be a serious candidate for the compression of high-definition video sequences, is ensured.
Directory of Open Access Journals (Sweden)
Guanjun Liu
2015-01-01
Full Text Available Interorganizational Workflow nets (IWF-nets can well model many concurrent systems such as web service composition, in which multiple processes interact via sending/receiving messages. Compatibility of IWF-nets is a crucial criterion for the correctness of these systems. It guarantees that a system has no deadlock, livelock, or dead tasks. In our previous work we proved that the compatibility problem is PSPACE-complete for safe IWF-nets. This paper defines a subclass of IWF-nets that can model many cases about interactions. Necessary and sufficient condition is presented to decide their compatibility, and it depends on the net structures only. Finally, an algorithm is developed based on the condition.
Operation compatibility: a neglected contribution to dual-task costs
Pannebakker, M.M.; Band, G.P.H.; Ridderinkhof, K.R.
2009-01-01
Traditionally, dual-task interference has been attributed to the consequences of task load exceeding capacity limitations. However, the current study demonstrates that in addition to task load, the mutual compatibility of the concurrent processes modulates whether 2 tasks can be performed in
Földes, Noémi; Philipp, Andrea M; Badets, Arnaud; Koch, Iring
2018-05-01
The ideomotor principle states that actions are represented by their anticipated sensory effects. This notion is often tested using the response-effect compatibility (REC) paradigm, where participants' responses are followed either by a compatible or incompatible response effect (e.g., an effect on the right side after a right-hand response is considered R-E compatible due to the spatial overlap, whereas an effect on the left side after the right-hand response is considered incompatible). Shorter reaction times are typically observed in the compatible condition compared to the incompatible condition (i.e., REC effect), suggesting that effect anticipation plays a role in action control. Previous evidence from verbal REC suggested that effect anticipation can be due to conceptual R-E overlap, but there was also phonological overlap (i.e., anticipated reading of a word preceded by the vocal response of saying that very word). To examine the representational basis of REC, in three experiments, we introduced a bilingual R-E mapping to exclude phonological R-E overlap (i.e., in the R-E compatible condition, the translation equivalent of the response word is presented as an effect word in a different language). Our findings show that the REC effect is obtained when presenting the effect word in the same language as the response (i.e., monolingual condition), but the compatibility effect was not found when the semantically same word is presented in a different language, suggesting no conceptually generalized REC in a bilingual setting. (232 words). Copyright © 2018 Elsevier B.V. All rights reserved.
Welsh, D T
2000-07-01
The osmoadaptation of most micro-organisms involves the accumulation of K(+) ions and one or more of a restricted range of low molecular mass organic solutes, collectively termed 'compatible solutes'. These solutes are accumulated to high intracellular concentrations, in order to balance the osmotic pressure of the growth medium and maintain cell turgor pressure, which provides the driving force for cell extension growth. In this review, I discuss the alternative roles which compatible solutes may also play as intracellular reserves of carbon, energy and nitrogen, and as more general stress metabolites involved in protection of cells against other environmental stresses including heat, desiccation and freezing. Thus, the evolutionary selection for the accumulation of a specific compatible solute may not depend solely upon its function during osmoadaptation, but also upon the secondary benefits its accumulation provides, such as increased tolerance of other environmental stresses prevalent in the organism's niche or even anti-herbivory or dispersal functions in the case of dimethylsulfoniopropionate (DMSP). In the second part of the review, I discuss the ecological consequences of the release of compatible solutes to the environment, where they can provide sources of compatible solutes, carbon, nitrogen and energy for other members of the micro-flora. Finally, at the global scale the metabolism of specific compatible solutes (betaines and DMSP) in brackish water, marine and hypersaline environments may influence global climate, due to the production of the trace gases, methane and dimethylsulfide (DMS) and in the case of DMS, also couple the marine and terrestrial sulfur cycles.
Generalized fixed point theorems for compatible mappings with some types in fuzzy metric spaces
International Nuclear Information System (INIS)
Cho, Yeol Je; Sedghi, Shaban; Shobe, Nabi
2009-01-01
In this paper, we give some new definitions of compatible mappings of types (I) and (II) in fuzzy metric spaces and prove some common fixed point theorems for four mappings under the condition of compatible mappings of types (I) and (II) in complete fuzzy metric spaces. Our results extend, generalize and improve the corresponding results given by many authors.
Reproductive biology of varroa mites in colonies of Africanized honey bees
Calderon Fallas, R.A.
2009-01-01
We investigated the reproductive biology of V. destructor in Africanized honeybees (AHB) in Central American conditions, specifically in Costa Rica. Attention was paid to mite fertility and production of viable female mites in worker and drone brood cells. Other reproduction parameters, like
Understanding the origins of metal-organic framework/polymer compatibility.
Semino, R; Moreton, J C; Ramsahye, N A; Cohen, S M; Maurin, G
2018-01-14
The microscopic interfacial structures for a series of metal-organic framework/polymer composites consisting of the Zr-based UiO-66 coupled with different polymers are systematically explored by applying a computational methodology that integrates density functional theory calculations and force field-based molecular dynamics simulations. These predictions are correlated with experimental findings to unravel the structure-compatibility relationship of the MOF/polymer pairs. The relative contributions of the intermolecular MOF/polymer interactions and the flexibility/rigidity of the polymer with respect to the microscopic structure of the interface are rationalized, and their impact on the compatibility of the two components in the resulting composite is discussed. The most compatible pairs among those investigated involve more flexible polymers, i.e. polyvinylidene fluoride (PVDF) and polyethylene glycol (PEG). These polymers exhibit an enhanced contact surface, due to a better adaptation of their configuration to the MOF surface. In these cases, the irregularities at the MOF surface are filled by the polymer, and even some penetration of the terminal groups of the polymer into the pores of the MOF can be observed. As a result, the affinity between the MOF and the polymer is very high; however, the pores of the MOF may be sterically blocked due to the strong MOF/polymer interactions, as evidenced by UiO-66/PEG composites. In contrast, composites involving polymers that exhibit higher rigidity, such as the polymer of intrinsic microporosity-1 (PIM-1) or polystyrene (PS), present interfacial microvoids that contribute to a decrease in the contact surface between the two components, thus reducing the MOF/polymer affinity.
Electromagnetic compatibility design and cabling system rules
International Nuclear Information System (INIS)
Raimbourg, J.
2009-01-01
This report is devoted to establish EMC (Electromagnetic Compatibility) design and cabling system rules. It is intended for hardware designers in charge of designing electronic maps or integrating existing materials into a comprehensive system. It is a practical guide. The rules described in this document do not require enhanced knowledge of advanced mathematical or physical concepts. The key point is to understand phenomena with a pragmatic approach to highlight the design and protection rules. (author)
Institute of Scientific and Technical Information of China (English)
LI Fang; WANG Jin; HUANG San
2011-01-01
Polyethylene terephthalate (PET,Dacron) was modified by surface immobilization of hirudin with glutaraldehyde(GA) as coupling reagent to improve the blood compatibility.Hirudin-immobilizcd PETs were characterized by X-ray photoelectron spectroscopy (XPS) and contact angle measurements.The blood compatibility of the PETs was evaluated by platelet adhesion evaluation and fibrinogen conformational change measurements in vitro.The results showed the decrease of platelet adhesion and activation on hirudinimmobilized PET with increasing of glutaraldehyde concentration.Fibrinogen experiment showed that fibrinogen adherence and conformational changes of PET-HRD were less than those of untreated PET,which made the materials difficult to form thrombus.The proper reason of blood compatibility improvement was low interface tension between hirudin-immobilized PETs and blood,as well as blood proteins,and low ratio of dispersive/polar component of the surface energy(γsd/γsp) and high hydrophilicity.
Mai, Lan-Yin; Li, Yi-Xuan; Chen, Yong; Xie, Zhen; Li, Jie; Zhong, Ming-Yu
2014-05-01
The compatibility of traditional Chinese medicines (TCMs) formulae containing enormous information, is a complex component system. Applications of mathematical statistics methods on the compatibility researches of traditional Chinese medicines formulae have great significance for promoting the modernization of traditional Chinese medicines and improving clinical efficacies and optimizations of formulae. As a tool for quantitative analysis, data inference and exploring inherent rules of substances, the mathematical statistics method can be used to reveal the working mechanisms of the compatibility of traditional Chinese medicines formulae in qualitatively and quantitatively. By reviewing studies based on the applications of mathematical statistics methods, this paper were summarized from perspective of dosages optimization, efficacies and changes of chemical components as well as the rules of incompatibility and contraindication of formulae, will provide the references for further studying and revealing the working mechanisms and the connotations of traditional Chinese medicines.
Compatibility art of traditional Chinese medicine: from the perspective of herb pairs.
Wang, Shengpeng; Hu, Yangyang; Tan, Wen; Wu, Xu; Chen, Ruie; Cao, Jiliang; Chen, Meiwan; Wang, Yitao
2012-09-28
Over the past decades, research of traditional Chinese medicine (TCM) mainly focused on developing potential candidates from Chinese medicinal herbs, while the wisdom of applying these traditional herbs has not been paid as much attention as it deserves. As is well-known, multi-herb therapy is one of the most important characteristics of TCM, but the modernization drive of this conventional wisdom has faced many obstacles due to its unimaginable complexity. Herb pairs, the most fundamental and the simplest form of multi-herb formulae, are a centralized representative of Chinese herbal compatibility. In light of their simplicity and the basic characteristics of complex formulae, herb pairs are of great importance in the studies of herb compatibility. A systematic search of herb pair related research was carried out using multiple online literature databases, books and monographs published in the past 20 years. A comprehensive introduction to the compatibility of TCM, the position of herb pairs in TCM and the progresses of several famous herb pairs were provided in this review. Furthermore, the clinical study and the future research trends of herb pairs were also discussed. Herb pairs have played, and may continue to play a key role in full investigation of general herb compatibility for their indispensable position in TCM. Much more research is needed for the standardization, safety evaluation, and mechanism exploration of herb pairs. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Compatibility of reduced activation ferritic/martensitic steels with liquid breeders
International Nuclear Information System (INIS)
Muroga, T.; Nagasaka, T.; Kondo, M.; Sagara, A.; Noda, N.; Suzuki, A.; Terai, T.
2008-10-01
The compatibility of Reduced Activation Ferritic/Martensitic Steel (RAFM) with liquid Li and molten-salt Flibe have been characterized and accessed. Static compatibility tests were carried out in which the specimens were immersed into liquid Li or Flibe in isothermal autoclaves. Also carried out were compatibility tests in flowing liquid Li by thermal convection loops. In the case of liquid Li, the corrosion rate increased with temperature significantly. The corrosion was almost one order larger for the loop tests than for the static tests. Chemical analysis showed that the corrosion was enhanced when the level of N in Li is increased. Transformation from martensitic to ferritic phase and the resulting softening were observed in near-surface area of Li-exposed specimens, which were shown to be induced by decarburization. In the case of Flibe, the corrosion loss was much larger in a Ni crucible than in a RAFM crucible. Both fluorides and oxides were observed on the surfaces. Thus, the key corrosion process of Flibe is the competing process of fluoridation and oxidation. Possible mechanism of the enhanced corrosion in Ni crucible is electrochemical circuit effect. It was suggested that the corrosion loss rate of RAFM by liquid Li and Flibe can be reduced by reducing the level of impurity N in Li and avoiding the use of dissimilar materials in Flibe, respectively. (author)
Using statistical compatibility to derive advanced probabilistic fatigue models
Czech Academy of Sciences Publication Activity Database
Fernández-Canteli, A.; Castillo, E.; López-Aenlle, M.; Seitl, Stanislav
2010-01-01
Roč. 2, č. 1 (2010), s. 1131-1140 E-ISSN 1877-7058. [Fatigue 2010. Praha, 06.06.2010-11.06.2010] Institutional research plan: CEZ:AV0Z20410507 Keywords : Fatigue models * Statistical compatibility * Functional equations Subject RIV: JL - Materials Fatigue, Friction Mechanics
77 FR 59702 - Promoting U.S. EC Regulatory Compatibility
2012-09-28
... beneficial job creation, economic growth, and competitiveness, working closely with public and private sector... regulatory differences, and unnecessary red tape while respecting each other's right to protect public health... jurisdictions that may be impeding deeper regulatory compatibility in the sector--for example, differences with...
The Influence and Compatibility of Vegetable Oils and other ...
African Journals Online (AJOL)
The vegetable oils used as skin permeation enhancers were selected on the basis of compatibility studies data. A total of eight monolithic systems were prepared by using different concentrations of drug-polymers-permeation enhancers. The permeation parameters, flux, permeability coefficient, enhancement ratio and ...
Bosković, Radovan I; Tobutt, Kenneth R; Ortega, Encarnación; Sutherland, Bruce G; Godini, Angelo
2007-12-01
Prunus dulcis, the almond, is a predominantly self-incompatible (SI) species with a gametophytic self-incompatibility system mediated by S-RNases. The economically important allele Sf, which results in self-compatibility in P. dulcis, is said to have arisen by introgression from Prunus webbii in the Italian region of Apulia. We investigated the range of self-(in)compatibility alleles in Apulian material of the two species. About 23 cultivars of P. dulcis (14 self-compatible (SC) and nine SI) and 33 accessions of P. webbii (16 SC, two SI and 15 initially of unknown status), all from Apulia, were analysed using PCR of genomic DNA to amplify S-RNase alleles and, in most cases, IEF and staining of stylar protein extracts to detect S-RNase activity. Some amplification products were cloned and sequenced. The allele Sf was present in nearly all the SC cultivars of P. dulcis but, surprisingly, was absent from nearly all SC accessions of P. webbii. And of particular interest was the presence in many SI cultivars of P. dulcis of a new active allele, labelled S30, the sequence of which showed it to be the wild-type of Sf so that Sf can be regarded as a stylar part mutant S30 degrees . These findings indicate Sf may have arisen within P. dulcis, by mutation. One SC cultivar of P. dulcis, 'Patalina', had a new self-compatibility allele lacking RNase activity, Sn5, which could be useful in breeding programmes. In the accessions of P. webbii, some of which were known to be SC, three new alleles were found which lacked RNase activity but had normal DNA sequences.
Survival of transfused red blood cells: In vivo compatibility testing with chromium-51
International Nuclear Information System (INIS)
Dharkar, D.D.; Pineda, A.A.
1983-01-01
The /sup 51/Cr red cell survival test and specific test for measurement of the disappearance rate of labeled red cells. This procedure can be used for the assessment of red cell compatibility testing in vivo. The authors recommend that more routine transfusions as well as ''difficult'' transfusions be monitored by /sup 51/Cr in vivo compatibility testing before the actual transfusions, so that more consistent and reliable survival values are achieved
International Nuclear Information System (INIS)
Gehin, J.C.; Worrall, A.; Oakley, B.; Jenni, K.; Taiwo, T.; Wigeland, R.
2015-01-01
One of the key objectives of the U.S. Department of Energy (DOE) Nuclear Energy Research/development road-map is the development of sustainable nuclear fuel cycles that can improve natural resource utilization and provide solutions to the management of nuclear wastes. Recently, an evaluation and screening (ES) of fuel cycle systems has been conducted to identify those options that provide the best opportunities for obtaining such improvements and also to identify the required research and development activities that can support the development of advanced fuel cycle options. In order to evaluate and screen fuel cycle systems in the ES study, nine criteria were used including Development and Deployment Risk (DDR). More specifically, this criterion was represented by the following metrics: Development time, development cost, deployment cost from prototypic validation to first-of-a-kind commercial, compatibility with the existing nuclear fuel cycle infrastructure, existence of regulations for the fuel cycle and familiarity with licensing, and existence of market incentives and/or barriers to commercial implementation of fuel cycle processes. Given the comprehensive nature of the study, a systematic approach was needed to determine metric data for the DDR criterion. As would be expected, the Evaluation Group representing the once-through use of uranium in thermal reactors is always the highest ranked fuel cycle Evaluation Group for this DDR criterion. Evaluation Groups that consist of once-through fuel cycles that use existing reactor types are consistently ranked very high. The highest ranked limited and continuous recycle fuel cycle Evaluation Groups are those that recycle Pu in thermal reactors. The lowest ranked fuel cycles are predominately continuous recycle single stage and multi-stage fuel cycles that involve TRU and/or U 233 recycle. (authors)
Reddy, Jay P; Peddibhotla, Sirisha; Bu, Wen; Zhao, Jing; Haricharan, Svasti; Du, Yi-Chieh Nancy; Podsypanina, Katrina; Rosen, Jeffrey M; Donehower, Larry A; Li, Yi
2010-02-23
p53, apoptosis, and senescence are frequently activated in preneoplastic lesions and are barriers to progression to malignancy. These barriers have been suggested to result from an ATM-mediated DNA damage response (DDR), which may follow oncogene-induced hyperproliferation and ensuing DNA replication stress. To elucidate the currently untested role of DDR in breast cancer initiation, we examined the effect of oncogene expression in several murine models of breast cancer. We did not observe a detectable DDR in early hyperplastic lesions arising in transgenic mice expressing several different oncogenes. However, DDR signaling was strongly induced in preneoplastic lesions arising from individual mammary cells transduced in vivo by retroviruses expressing either PyMT or ErbB2. Thus, activation of an oncogene after normal tissue development causes a DDR. Furthermore, in this somatic ErbB2 tumor model, ATM, and thus DDR, is required for p53 stabilization, apoptosis, and senescence. In palpable tumors in this model, p53 stabilization and apoptosis are lost, but unexpectedly senescence remains in many tumor cells. Thus, this murine model fully recapitulates early DDR signaling; the eventual suppression of its endpoints in tumorigenesis provides compelling evidence that ErbB2-induced aberrant mammary cell proliferation leads to an ATM-mediated DDR that activates apoptosis and senescence, and at least the former must be overcome to progress to malignancy. This in vivo study also uncovers an unexpected effect of ErbB2 activation previously known for its prosurvival roles, and suggests that protection of the ATM-mediated DDR-p53 signaling pathway may be important in breast cancer prevention.
Histology of the distal dural ring.
Graffeo, Christopher S; Perry, Avital; Copeland, William R; Raghunathan, Aditya; Link, Michael J
2017-09-01
The distal dural ring (DDR) is a conserved intracranial anatomic structure marking the boundary point at which the internal carotid artery (ICA) exits the cavernous sinus (CS) and enters the subarachnoid space. Although the CS has been well described in a range of anatomic studies, to our knowledge no prior study has analyzed the histologic relationship between the ICA and DDR. Correspondingly, our objective was to assess the relationship of the DDR to the ICA and determine whether the DDR can be dissected from the ICA and thus divided, or can only be circumferentially trimmed around the artery. The authors examined ten fresh-frozen, adult cadaveric specimens. A standard frontotemporal craniotomy, orbito-optic osteotomy, and extradural anterior clinoidectomy was performed bilaterally. The cavernous ICA, DDR, and supraclinoid ICA were harvested as an en bloc specimen. Specimens formalin-fixed and paraffin-embedded prior to routine histochemical staining with hematoxylin and eosin and Masson trichrome. In all specimens, marked microscopic investment of the DDR throughout the ICA adventitia was noted. Dural collagen fibers extensively permeated the arterial layers superficial to the muscularis propria, with no evidence of a clear separation between the DDR and arterial adventitia. Histologic analysis suggests that the ICA and DDR are highly interrelated, continuous structures, and therefore attempted intraoperative dissection between these structures may carry an elevated risk of injury to the ICA. We correspondingly recommend careful circumferential trimming of the DDR in lieu of direct dissection in cases requiring mobilization of the clinoidal ICA. Clin. Anat. 30:742-746, 2017. © 2017Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
Investigation of drug-excipient compatibility using rheological and thermal tools
Trivedi, Maitri R.
HYPOTHESIS: We plan to investigate a different approach to evaluate drug-excipient physical compatibility using rheological and thermal tools as opposed to commonly used chemical techniques in pharmaceutical industry. This approach offers practical solutions to routinely associated problems arising with API's and commonly used hydrates forms of excipients. ABSTRACT: Drug-Excipient compatibility studies are an important aspect of pre-formulation and formulation development in pharmaceutical research and development. Various approaches have been used in pharmaceutical industry including use of thermal analysis and quantitative assessment of drug-excipient mixtures after keeping the samples under stress environment depending upon the type of formulation. In an attempt to provide better understanding of such compatibility aspect of excipients with different properties of API, various rheological and thermal studies were conducted on binary mixtures of excipients which exist in different hydrates. Dibasic Calcium Phosphate (DCP, anhydrous and dihydrate forms) and Lactose (Lac, anhydrous and monohydrate) were selected with cohesive API's (Acetaminophen and Aspirin). Binary mixtures of DCP and Lac were prepared by addition of 0% w/w to 50% w/w of the API into each powder blend. Rheological and thermal aspects were considered using different approaches such as powder rheometer, rotational shear cell and traditional rheometery approaches like angle of repose (AOR), hausner's ratio (HR) and cares index (CI). Thermal analysis was conducted using modulated differential scanning calorimetry (MDSC) and thermal effusivity. The data suggested that the powder rheometer showed distinctive understanding in the flowability behavior of binary mixtures with addition of increasing proportion of API's than traditional approaches. Thermal approaches revealed the potential interaction of water of crystallization DCP-D with the API (APAP) while such interactions were absent in DCP-A, while
Effects of grasp compatibility on long-term memory for objects.
Canits, Ivonne; Pecher, Diane; Zeelenberg, René
2018-01-01
Previous studies have shown action potentiation during conceptual processing of manipulable objects. In four experiments, we investigated whether these motor actions also play a role in long-term memory. Participants categorized objects that afforded either a power grasp or a precision grasp as natural or artifact by grasping cylinders with either a power grasp or a precision grasp. In all experiments, responses were faster when the affordance of the object was compatible with the type of grasp response. However, subsequent free recall and recognition memory tasks revealed no better memory for object pictures and object names for which the grasp affordance was compatible with the grasp response. The present results therefore do not support the hypothesis that motor actions play a role in long-term memory. Copyright © 2017 Elsevier B.V. All rights reserved.
Compatibility testing of vitrified waste forms
International Nuclear Information System (INIS)
Rankin, W.N.
1978-01-01
The compatibility of vitrified radioactive waste with candidate canister materials will be evaluated with both cast and in-can melted vitrified waste. Both real and simulated sludges will be used. In addition, the compatibility of these materials with salt from a possible final storage location will be determined. Cast vitrified waste will be tested with ASTM A 333 and ASTM A 516 low-carbon steels and Type 304L stainless steel at 100, 600 and 800 0 C. Cast vitrified waste that has been devitrified by heat treatment will be tested at 100 0 C. Two types of test specimens will be used with either simulated or real sludges: (1) unsealed capsules made of pieces of mill-finished pipe into which vitrified waste is cast, and (2) sealed capsules containing a small container of vitrified waste identical to the ones in the unsealed capsule. In-can melted vitrified waste will be tested with synthetic sludge only and with ASTM A 333 and ASTM A 516 low-carbon steels, Type 304L stainless steel and Inconel 600. Two types of tests will be carried out: (1) melting vitrified waste in miniature metal canisters and (2) exposure of small (carefully measured) metal coupons to molten glass. The air oxidation rates of candidate canister materials will be determined, and specimens will also be exposed to salt from Drill Hole AEC-8 in Carlsbad, New Mexico. Sealed capsules containing an ASTM A 516 low-carbon steel or Type 304L stainless steel specimen partially embedded in a small block of salt will be heated
Discoidin domain receptor 1 activity drives an aggressive phenotype in bladder cancer
Xie, Xin; Rui, Wenbin; He, Wei; Shao, Yuan; Sun, Fukang; Zhou, Wenlong; Wu, Yuxuan; Zhu, Yu
2017-01-01
Discoidin domain receptor 1 (DDR1) is a receptor tyrosine kinase which utilizes collagen as a ligand to regulate the interaction between cancer cells and tumor stroma. However, the clinical relevance of DDR1 expression in bladder cancer as well as its molecular regulation have not been previously investigated. Here, we assessed the role of DDR1 in bladder cancer. The DDR1 levels in bladder cancer specimens were examined by Western blot, compared to the paired adhesive normal controls. The eff...
SMI Compatible Simulation Scheduler Design for Reuse of Model Complying with SMP Standard
Directory of Open Access Journals (Sweden)
Cheol-Hea Koo
2010-12-01
Full Text Available Software reusability is one of key factors which impacts cost and schedule on a software development project. It is very crucial also in satellite simulator development since there are many commercial simulator models related to satellite and dynamics. If these models can be used in another simulator platform, great deal of confidence and cost/schedule reduction would be achieved. Simulation model portability (SMP is maintained by European Space Agency and many models compatible with SMP/simulation model interface (SMI are available. Korea Aerospace Research Institute (KARI is developing hardware abstraction layer (HAL supported satellite simulator to verify on-board software of satellite. From above reasons, KARI wants to port these SMI compatible models to the HAL supported satellite simulator. To port these SMI compatible models to the HAL supported satellite simulator, simulation scheduler is preliminary designed according to the SMI standard.
Gender compatibility, math-gender stereotypes, and self-concepts in math and physics
Koul, Ravinder; Lerdpornkulrat, Thanita; Poondej, Chanut
2016-12-01
[This paper is part of the Focused Collection on Gender in Physics.] Positive self-assessment of ability in the quantitative domains is considered critical for student participation in science, technology, engineering, and mathematics field studies. The present study investigated associations of gender compatibility (gender typicality and contentedness) and math-gender stereotypes with self-concepts in math and physics. Statistical analysis of survey data was based on a sample of 170 male and female high school science students matched on propensity scores based on age and past GPA scores in math. Results of MANCOVA analyses indicated that the combination of high personal gender compatibility with low endorsement of math-gender stereotypes was associated with low gender differentials in math and physics self-concepts whereas the combination of high personal gender compatibility with high endorsement of math-gender stereotypes was associated with high gender differentials in math and physics self-concepts. These results contribute to the recent theoretical and empirical work on antecedents to the math and physics identities critical to achieving gender equity in STEM fields.
Ahlqvist, Sheana; London, Bonita; Rosenthal, Lisa
2013-09-01
Although the perceived compatibility between one's gender and science, technology, engineering, and mathematics (STEM) identities (gender-STEM compatibility) has been linked to women's success in STEM fields, no work to date has examined how the stability of identity over time contributes to subjective and objective STEM success. In the present study, 146 undergraduate female STEM majors rated their gender-STEM compatibility weekly during their freshman spring semester. STEM women higher in gender rejection sensitivity, or gender RS, a social-cognitive measure assessing the tendency to perceive social-identity threat, experienced larger fluctuations in gender-STEM compatibility across their second semester of college. Fluctuations in compatibility predicted impaired outcomes the following school year, including lower STEM engagement and lower academic performance in STEM (but not non-STEM) classes, and significantly mediated the relationship between gender RS and STEM engagement and achievement in the 2nd year of college. The week-to-week changes in gender-STEM compatibility occurred in response to negative academic (but not social) experiences.
The compatibility of student teacher beliefs with research on ...
African Journals Online (AJOL)
The findings suggest that the student teachers in this study held strong beliefs on a number of issues, especially on discipline and control, which are not compatible with research-based findings on supportive classroom climates. The article highlights the implications for teacher educators and suggests one approach to ...
Developing Globally Compatible Institutional Infrastructures for Indian Higher Education
Chakrabarti, Raj; Bartning, Augustine; Sengupta, Shiladitya
2010-01-01
The authors profile developments in the globalization of Indian higher education, with an emphasis on emerging globally compatible institutional infrastructures. In recent decades, there has been an enormous amount of brain drain: the exodus of the brightest professionals and students to other countries. The article argues that the implementation…
International Nuclear Information System (INIS)
Liu, Pingsheng; Chen, Qiang; Yuan, Bo; Chen, Mengzhou; Wu, Shishan; Lin, Sicong; Shen, Jian
2013-01-01
A facile approach to modify silicone rubber (SR) membrane for improving the blood compatibility was investigated. The hydrophobic SR surface was firstly activated by air plasma, after which an initiator was immobilized on the activated surface for atom transfer radical polymerization (ATRP). Three zwitterionic polymers were then grafted from SR membrane via surface-initiated atom transfer radical polymerization (SI-ATRP). The surface composition, wettability, and morphology of the membranes before and after modification were characterized by X-ray photoelectron spectroscopy (XPS), static water contact angle (WCA) measurement, and atomic force microscopy (AFM). Results showed that zwitterionic polymers were successfully grafted from SR surfaces, which remarkably improved the wettability of the SR surface. The blood compatibility of the membranes was evaluated by protein adsorption and platelet adhesion tests in vitro. As observed, all the zwitterionic polymer modified surfaces have improved resistance to nonspecific protein adsorption and have excellent resistance to platelet adhesion, showing significantly improved blood compatibility. This work should inspire many creative uses of SR based materials for biomedical applications such as vessel, catheter, and microfluidics. Highlights: • Facile surface modification of silicone rubber with functional brushes • Modified SR surfaces have improved resistance to nonspecific protein adsorption. • Modified SR surfaces have excellent resistance to platelet adhesion. • Zwitteironic surface significant improvement in blood compatibility • Could inspire many creative uses of SR based materials for biomedical
Energy Technology Data Exchange (ETDEWEB)
Liu, Pingsheng [School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); Chen, Qiang, E-mail: chem100@nju.edu.cn [School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); High Technology Research Institute of Nanjing University, Changzhou 213164 (China); Yuan, Bo; Chen, Mengzhou; Wu, Shishan; Lin, Sicong [School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); Shen, Jian, E-mail: shenj1957@yahoo.com.cn [School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China)
2013-10-15
A facile approach to modify silicone rubber (SR) membrane for improving the blood compatibility was investigated. The hydrophobic SR surface was firstly activated by air plasma, after which an initiator was immobilized on the activated surface for atom transfer radical polymerization (ATRP). Three zwitterionic polymers were then grafted from SR membrane via surface-initiated atom transfer radical polymerization (SI-ATRP). The surface composition, wettability, and morphology of the membranes before and after modification were characterized by X-ray photoelectron spectroscopy (XPS), static water contact angle (WCA) measurement, and atomic force microscopy (AFM). Results showed that zwitterionic polymers were successfully grafted from SR surfaces, which remarkably improved the wettability of the SR surface. The blood compatibility of the membranes was evaluated by protein adsorption and platelet adhesion tests in vitro. As observed, all the zwitterionic polymer modified surfaces have improved resistance to nonspecific protein adsorption and have excellent resistance to platelet adhesion, showing significantly improved blood compatibility. This work should inspire many creative uses of SR based materials for biomedical applications such as vessel, catheter, and microfluidics. Highlights: • Facile surface modification of silicone rubber with functional brushes • Modified SR surfaces have improved resistance to nonspecific protein adsorption. • Modified SR surfaces have excellent resistance to platelet adhesion. • Zwitteironic surface significant improvement in blood compatibility • Could inspire many creative uses of SR based materials for biomedical.
Are hospital quality improvement and public accountability compatible?
Panzer, R J
1994-07-01
The goals of public accountability and quality improvement are compatible in theory but not necessarily in practice. Both concepts emphasize the customer. However, those working toward these two goals design systems with quite different roles and relationships between the providers and consumers of health care. Superficial interactions obstruct meaningful dialogue about how to build a better system meeting both sets of goals. Current practices of public accountability and quality improvement have fundamentally different paradigms concerning the roles and responsibilities of those who provide and those who consume health care. There are at least three ways to improve the current relationship between public accountability and quality improvement. First, optimizing the design and performance of each effort would be an improvement since the goals are highly compatible. Neither ideal currently meets its own expectations, creating distrust among the proponents of each when reality falls short. Second, the two efforts could be coordinated through joint community-level planning and sharing. Finally and optimally, the two concepts could be made part of the same community-level cooperative system, an approach that offers the greatest opportunity for achieving shared goals.
Characterization of a prototype MR-compatible Delta4 QA system in a 1.5 tesla MR-linac
de Vries, J. H. W.; Seravalli, E.; Houweling, A. C.; Woodings, S. J.; van Rooij, R.; Wolthaus, J. W. H.; Lagendijk, J. J. W.; Raaymakers, B. W.
2018-01-01
To perform patient plan quality assurance (QA) on a newly installed MR-linac (MRL) it is necessary to have an MR-compatible QA device. An MR compatible device (MR-Delta4) has been developed together with Scandidos AB (Uppsala, Sweden). The basic characteristics of the detector response, such as short-term reproducibility, dose linearity, field size dependency, dose rate dependency, dose-per-pulse dependency and angular dependency, were investigated for the clinical Delta4-PT as well as for the MR compatible version. All tests were performed with both devices on a conventional linac and the MR compatible device was tested on the MRL as well. No statistically significant differences were found in the short-term reproducibility (tesla magnetic field of the Elekta MR-linac
Lee, Eung Seok; Olson, Pamela R; Gupta, Neha; Solpuker, Utku; Schwartz, Franklin W; Kim, Yongje
2014-02-01
Permanganate (MnO4(-)) is a strong oxidant that is widely used for treating chlorinated ethylenes in groundwater. This study aims to develop hyper-saline MnO4(-) solution (MnO4(-) gel; PG) that can be injected into aquifers via wells, slowly gelates over time, and slowly release MnO4(-) to flowing water. In this study, compatibility and miscibility of gels, such as chitosan, aluminosilicate, silicate, and colloidal silica gels, with MnO4(-) were tested. Of these gels, chitosan was reactive with MnO4(-). Aluminosilicates were compatible but not readily miscible with MnO4(-). Silicates and colloidal silica were both compatible and miscible with MnO4(-), and gelated with addition of KMnO4 granules. Colloidal silica has low initial viscosity (<15cP), exhibited delayed gelation characteristics with the lag times ranging from 0 to 200min. Release of MnO4(-) from the colloidal silica-based PG gel occurred in a delayed fashion, with maximum duration of 24h. These results suggested that colloidal silica can be used to create PG or delayed-gelling forms containing other oxidants which can be used for groundwater remediation. Copyright © 2013 Elsevier Ltd. All rights reserved.
Assessing compatibility of direct detection data: halo-independent global likelihood analyses
Energy Technology Data Exchange (ETDEWEB)
Gelmini, Graciela B. [Department of Physics and Astronomy, UCLA,475 Portola Plaza, Los Angeles, CA 90095 (United States); Huh, Ji-Haeng [CERN Theory Division,CH-1211, Geneva 23 (Switzerland); Witte, Samuel J. [Department of Physics and Astronomy, UCLA,475 Portola Plaza, Los Angeles, CA 90095 (United States)
2016-10-18
We present two different halo-independent methods to assess the compatibility of several direct dark matter detection data sets for a given dark matter model using a global likelihood consisting of at least one extended likelihood and an arbitrary number of Gaussian or Poisson likelihoods. In the first method we find the global best fit halo function (we prove that it is a unique piecewise constant function with a number of down steps smaller than or equal to a maximum number that we compute) and construct a two-sided pointwise confidence band at any desired confidence level, which can then be compared with those derived from the extended likelihood alone to assess the joint compatibility of the data. In the second method we define a “constrained parameter goodness-of-fit” test statistic, whose p-value we then use to define a “plausibility region” (e.g. where p≥10%). For any halo function not entirely contained within the plausibility region, the level of compatibility of the data is very low (e.g. p<10%). We illustrate these methods by applying them to CDMS-II-Si and SuperCDMS data, assuming dark matter particles with elastic spin-independent isospin-conserving interactions or exothermic spin-independent isospin-violating interactions.
Context-dependent JPEG backward-compatible high-dynamic range image compression
Korshunov, Pavel; Ebrahimi, Touradj
2013-10-01
High-dynamic range (HDR) imaging is expected, together with ultrahigh definition and high-frame rate video, to become a technology that may change photo, TV, and film industries. Many cameras and displays capable of capturing and rendering both HDR images and video are already available in the market. The popularity and full-public adoption of HDR content is, however, hindered by the lack of standards in evaluation of quality, file formats, and compression, as well as large legacy base of low-dynamic range (LDR) displays that are unable to render HDR. To facilitate the wide spread of HDR usage, the backward compatibility of HDR with commonly used legacy technologies for storage, rendering, and compression of video and images are necessary. Although many tone-mapping algorithms are developed for generating viewable LDR content from HDR, there is no consensus of which algorithm to use and under which conditions. We, via a series of subjective evaluations, demonstrate the dependency of the perceptual quality of the tone-mapped LDR images on the context: environmental factors, display parameters, and image content itself. Based on the results of subjective tests, it proposes to extend JPEG file format, the most popular image format, in a backward compatible manner to deal with HDR images also. An architecture to achieve such backward compatibility with JPEG is proposed. A simple implementation of lossy compression demonstrates the efficiency of the proposed architecture compared with the state-of-the-art HDR image compression.
This issue paper provides a comprehensive literature review regarding the compatibility of NAPLs with a wide variety of materials used at hazardous waste sites. A condensed reference table of compatibility data for 207 chemicals and 28 commonly used well construction and sampling...
DNA damage response in nephrotoxic and ischemic kidney injury
Energy Technology Data Exchange (ETDEWEB)
Yan, Mingjuan; Tang, Chengyuan [Department of Nephrology, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 (China); Ma, Zhengwei [Department of Cellular Biology & Anatomy, Medical College of Georgia at Augusta University and Charlie Norwood VA Medical Center, Augusta, GA 30912 (United States); Huang, Shuang [Department of Anatomy and Cell Biology, University of Florida College of Medicine, Gainesville, FL (United States); Dong, Zheng, E-mail: zdong@augusta.edu [Department of Nephrology, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 (China); Department of Cellular Biology & Anatomy, Medical College of Georgia at Augusta University and Charlie Norwood VA Medical Center, Augusta, GA 30912 (United States)
2016-12-15
DNA damage activates specific cell signaling cascades for DNA repair, cell cycle arrest, senescence, and/or cell death. Recent studies have demonstrated DNA damage response (DDR) in experimental models of acute kidney injury (AKI). In cisplatin-induced AKI or nephrotoxicity, the DDR pathway of ATR/Chk2/p53 is activated and contributes to renal tubular cell apoptosis. In ischemic AKI, DDR seems more complex and involves at least the ataxia telangiectasia mutated (ATM), a member of the phosphatidylinositol 3-kinase-related kinase (PIKK) family, and p53; however, while ATM may promote DNA repair, p53 may trigger cell death. Targeting DDR for kidney protection in AKI therefore relies on a thorough elucidation of the DDR pathways in various forms of AKI.
The radiation destruction of blood compatible blockcopolymers
International Nuclear Information System (INIS)
Gorelik, B.A.; Raygorodsky, I.M.; Dubinskaya, O.V.; Goldberg, E.Sh.; Listvoyb, G.I.
1991-01-01
Among the blood compatible polymers such blockcopolymers as polyurethanes and polycarbonatesiloxanes the main problem of the production is the method of sterilization. It is considered that the radiation sterilization promising for articles like catheters made from these polymers. There are some data in the literature about radiation stability of polycarbonates and polysiloxane, but the influence of ionizing irradiation on polycarbonatesiloxane was not studied until now. The irradiation was carried out by γ-cell RHM-γ-20 in air. (author) 4 refs.; 5 figs
Interfacial compatibility of polymer-based structures in electronics
Turunen, Markus P. K.
2004-01-01
Interfacial compatibility of dissimilar materials was investigated to achieve a better understanding of interfacial adhesion in metal/polymer/metal systems. Surface modifications of polymers were applied to improve the adhesion. The modified surfaces were characterised by scanning electron microscopy (SEM), atomic force microscopy (AFM), X-ray photoelectron spectroscopy (XPS) and contact angle measurements accompanied by surface free energy evaluations. The pull-off test was employed to asses...
Compatibility with European law of opt-out legislation
International Nuclear Information System (INIS)
Feldmann, U.
2000-01-01
Should consensus with the utilities not be reached, Federal Minister for the Environment, Mr. Trittin, repeatedly announced to introduce opt-out legislation 'by dissent'. Both the constitutionality of such legislation and its compatibility with European law are topics of controversial debate in the literature. The decision taken by the Bavarian cabinet on February 8 in this year, to use all political and legal means against shutting down German nuclear power plants and, for this purpose, even to approach the European Commission on grounds of potential violation of European law, are reason enough to deal in more detail with the compatibility of an opt-out law with the Euratom Treaty and the EC Treaty. As the opt-out law does not yet exist, these considerations can only be of a theoretical nature. However, this is the working hypothesis assumed: Reprocessing is banned as of the entry into force of the opt-out law. This ban includes moving nuclear waste abroad for reprocessing. The peaceful use of nuclear power for electricity generation in power reactors operated for thirty years is forbidden. Older reactors may be run only for a transition period of another three years. (This includes abandoning the promotion purpose in the German Atomic Energy Act and a ban on building new power reactors). However, the operating life may be distributed in a flexible way. This contribution indicates that there are sound reasons and interesting approaches, respectively, in the literature for assuming that opting out by means of legislation, coupled with a ban on reprocessing, at least constitutes a violation of the freedom for goods and/or services. However, this cannot be derived unequivocally from either the Euratom Treaty or the EC Treaty or from rulings by the European Court of Justice. Ultimately, compatibility with European law of the ban on reprocessing can be decided only by the European Court of Justice. (orig.) [de
Construction of gateway-compatible yeast two-hybrid vectors for ...
African Journals Online (AJOL)
Yeast two-hybrid system combined with the gateway technology will greatly facilitate the cloning of interested DNA fragment into yeast two-hybrid vectors and therefore increase the efficiency of yeast two-hybrid analysis. In this study, we constructed a pair of Gateway-compatible yeast two-hybrid vectors pBTM116GW and ...
A comparison of non-invasive versus invasive methods of ...
African Journals Online (AJOL)
Puneet Khanna
for Hb estimation from the laboratory [total haemoglobin mass (tHb)] and arterial blood gas (ABG) machine (aHb), using ... A comparison of non-invasive versus invasive methods of haemoglobin estimation in patients undergoing intracranial surgery. 161 .... making decisions for blood transfusions based on these results.
A low power biomedical signal processor ASIC based on hardware software codesign.
Nie, Z D; Wang, L; Chen, W G; Zhang, T; Zhang, Y T
2009-01-01
A low power biomedical digital signal processor ASIC based on hardware and software codesign methodology was presented in this paper. The codesign methodology was used to achieve higher system performance and design flexibility. The hardware implementation included a low power 32bit RISC CPU ARM7TDMI, a low power AHB-compatible bus, and a scalable digital co-processor that was optimized for low power Fast Fourier Transform (FFT) calculations. The co-processor could be scaled for 8-point, 16-point and 32-point FFTs, taking approximate 50, 100 and 150 clock circles, respectively. The complete design was intensively simulated using ARM DSM model and was emulated by ARM Versatile platform, before conducted to silicon. The multi-million-gate ASIC was fabricated using SMIC 0.18 microm mixed-signal CMOS 1P6M technology. The die area measures 5,000 microm x 2,350 microm. The power consumption was approximately 3.6 mW at 1.8 V power supply and 1 MHz clock rate. The power consumption for FFT calculations was less than 1.5 % comparing with the conventional embedded software-based solution.
Developing 2 C-compatible investment criteria
Energy Technology Data Exchange (ETDEWEB)
Roeser, Frauke [NewClimate - Institute for Climate Policy and Global Sustainability gGmbH, Bonn (Germany); Weischer, Lutz [Germanwatch e.V., Koeln (Germany); Thomae, Jakob [2degrees Investing Initiative, New York, NY (United States); Hoehne, Niklas; Hagemann, Markus; El Alaoui, Alexander; Bals, Christoph; Eckstein, David; Kreft, Soenke; Rosse, Morten
2015-11-30
This report studies the development of criteria for assessing the compatibility of financial investments with the international goal to limit global temperature increase to below 2 C above pre-industrial levels. The findings are intended as a starting point and a key input for a longer term process to develop consensus-based 2 C investing criteria. The focus here is placed on investments in projects and physical assets, in particular of development and climate finance organisations. In order to limit global temperature increase to 2 C, global greenhouse gas (GHG) emissions will have to be reduced significantly, eventually to zero, during the course of this century. This requires shifting capital from high to low carbon investments as well as significant capital mobilisation for investments in 2 C-compatible infrastructure. Given the long lifetime of physical assets, and the urgency of decarbonisation over the coming decades, this needs to begin today. Public financial institutions can play a prominent role in contributing to aligning investment flows with the 2 C limit, as well as in closing the current infrastructure investment gap, responding to their explicit or implicit climate mandates and leadership role in the finance sector. The majority of international financial institutions integrate climate considerations into their finance decisions to some degree, and are familiar with different types of criteria, including positive and negative lists, qualitative and quantitative benchmarks, and the use of shadow carbon pricing. However, current approaches do not link to the 2 C limit. 2 C investment criteria are therefore needed to guide investors in this regard. Such criteria may also support other purposes, including an understanding of climate risks and improved reporting and accountability.
Developing 2 C-compatible investment criteria
International Nuclear Information System (INIS)
Roeser, Frauke; Weischer, Lutz; Thomae, Jakob; Hoehne, Niklas; Hagemann, Markus; El Alaoui, Alexander; Bals, Christoph; Eckstein, David; Kreft, Soenke; Rosse, Morten
2015-01-01
This report studies the development of criteria for assessing the compatibility of financial investments with the international goal to limit global temperature increase to below 2 C above pre-industrial levels. The findings are intended as a starting point and a key input for a longer term process to develop consensus-based 2 C investing criteria. The focus here is placed on investments in projects and physical assets, in particular of development and climate finance organisations. In order to limit global temperature increase to 2 C, global greenhouse gas (GHG) emissions will have to be reduced significantly, eventually to zero, during the course of this century. This requires shifting capital from high to low carbon investments as well as significant capital mobilisation for investments in 2 C-compatible infrastructure. Given the long lifetime of physical assets, and the urgency of decarbonisation over the coming decades, this needs to begin today. Public financial institutions can play a prominent role in contributing to aligning investment flows with the 2 C limit, as well as in closing the current infrastructure investment gap, responding to their explicit or implicit climate mandates and leadership role in the finance sector. The majority of international financial institutions integrate climate considerations into their finance decisions to some degree, and are familiar with different types of criteria, including positive and negative lists, qualitative and quantitative benchmarks, and the use of shadow carbon pricing. However, current approaches do not link to the 2 C limit. 2 C investment criteria are therefore needed to guide investors in this regard. Such criteria may also support other purposes, including an understanding of climate risks and improved reporting and accountability.
Liu, Yung-Ching; Jhuang, Jing-Wun
2012-07-01
A driving simulator study was conducted to evaluate the effects of five in-vehicle warning information displays upon drivers' emergent response and decision performance. These displays include visual display, auditory displays with and without spatial compatibility, hybrid displays in both visual and auditory format with and without spatial compatibility. Thirty volunteer drivers were recruited to perform various tasks that involved driving, stimulus-response, divided attention and stress rating. Results show that for displays of single-modality, drivers benefited more when coping with visual display of warning information than auditory display with or without spatial compatibility. However, auditory display with spatial compatibility significantly improved drivers' performance in reacting to the divided attention task and making accurate S-R task decision. Drivers' best performance results were obtained for hybrid display with spatial compatibility. Hybrid displays enabled drivers to respond the fastest and achieve the best accuracy in both S-R and divided attention tasks. Copyright © 2011 Elsevier Ltd and The Ergonomics Society. All rights reserved.
Lanaud, Claire; Fouet, Olivier; Legavre, Thierry; Lopes, Uilson; Sounigo, Olivier; Eyango, Marie Claire; Mermaz, Benoit; Da Silva, Marcos Ramos; Loor Solorzano, Rey Gaston; Argout, Xavier; Gyapay, Gabor; Ebaiarrey, Herman Ebai; Colonges, Kelly; Sanier, Christine; Rivallan, Ronan; Mastin, Géraldine; Cryer, Nicholas; Boccara, Michel; Verdeil, Jean-Luc; Efombagn Mousseni, Ives Bruno; Peres Gramacho, Karina; Clément, Didier
2017-10-13
Cocoa self-compatibility is an important yield factor and has been described as being controlled by a late gameto-sporophytic system expressed only at the level of the embryo sac. It results in gametic non-fusion and involves several loci. In this work, we identified two loci, located on chromosomes 1 and 4 (CH1 and CH4), involved in cocoa self-incompatibility by two different processes. Both loci are responsible for gametic selection, but only one (the CH4 locus) is involved in the main fruit drop. The CH1 locus acts prior to the gamete fusion step and independently of the CH4 locus. Using fine-mapping and genome-wide association studies, we focused analyses on restricted regions and identified candidate genes. Some of them showed a differential expression between incompatible and compatible reactions. Immunolocalization experiments provided evidence of CH1 candidate genes expressed in ovule and style tissues. Highly polymorphic simple sequence repeat (SSR) diagnostic markers were designed in the CH4 region that had been identified by fine-mapping. They are characterized by a strong linkage disequilibrium with incompatibility alleles, thus allowing the development of efficient diagnostic markers predicting self-compatibility and fruit setting according to the presence of specific alleles or genotypes. SSR alleles specific to self-compatible Amelonado and Criollo varieties were also identified, thus allowing screening for self-compatible plants in cocoa populations. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Discoidin domain receptor 1 is activated independently of beta(1) integrin
DEFF Research Database (Denmark)
Vogel, W; Brakebusch, C; Fässler, R
2000-01-01
independent of the epidermal growth factor (EGF) receptor. In cells that endogenously express both DDR1 and the EGF receptor, stimulation with EGF does not induce DDR activation. Third, we detected full DDR1 activation after collagen stimulation in cells that have been treated with blocking antibodies...... for alpha(2)beta(1) integrin or in cells with a targeted deletion of the beta(1) integrin gene. Finally, we show that overexpression of dominant negative DDR1 in the myoblast cell line C2C12 blocks cellular differentiation and the formation of myofibers....
Skills-demands compatibility as a determinant of flow experience in an inductive reasoning task.
Schiefele, Ulrich; Raabe, Andreas
2011-10-01
The skills-demands fit hypothesis of flow theory was examined. Based on the earlier finding that high demands in a game situation do not reduce the experience of flow, a cognitive task paradigm was used. The effect of skills-demands compatibility on the experience of flow but not of other, similar psychological states (i.e., concentration, negative and positive activation) was also investigated. Participants were 89 undergraduate students who worked on a number of inductive reasoning tasks in four successive trials with or without skills-demands compatibility. The results clearly supported the skills-demands fit hypothesis; concentration and activation were affected only by the tasks' difficulty. Inductive reasoning tasks are a useful tool for the experimental analysis of flow, and skills-demands compatibility is a significant and powerful condition of flow, but not of other, similar psychological states.
Directory of Open Access Journals (Sweden)
Ian D. Hartley
2010-12-01
Full Text Available The compatibility of wood from mountain pine beetle (Dendroctonus ponderosa killed lodgepole pine (Pinus contorta var. latifolia with Portland cement was investigated based on time-since-death as a quantitative estimator, and the presence of blue-stained sapwood, brown rot, or white rot as qualitative indicators. The exothermic behavior of cement hydration, maximum heat rate, time to reach this maximum, and total heat released within a 3.5–24 h interval were used for defining a new wood-cement compatibility index (CX. CX was developed and accounted for large discrepancies in assessing wood-cement compatibility compared to the previous methods. Using CX, no significant differences were found between fresh or beetle-killed wood with respect to the suitability for cement; except for the white rot samples which reached or exceeded the levels of incompatibility. An outstanding physicochemical behavior was also found for blue-stained sapwood and cement, producing significantly higher compatibility indices.
Pasca, Sorin A; Hartley, Ian D; Reid, Matthew E; Thring, Ronald W
2010-12-17
The compatibility of wood from mountain pine beetle (Dendroctonus ponderosa) killed lodgepole pine (Pinus contorta var. latifolia) with Portland cement was investigated based on time-since-death as a quantitative estimator, and the presence of blue-stained sapwood, brown rot, or white rot as qualitative indicators. The exothermic behavior of cement hydration, maximum heat rate, time to reach this maximum, and total heat released within a 3.5-24 h interval were used for defining a new wood-cement compatibility index (CX). CX was developed and accounted for large discrepancies in assessing wood-cement compatibility compared to the previous methods. Using CX, no significant differences were found between fresh or beetle-killed wood with respect to the suitability for cement; except for the white rot samples which reached or exceeded the levels of incompatibility. An outstanding physicochemical behavior was also found for blue-stained sapwood and cement, producing significantly higher compatibility indices.
Park, Joung-Sun; Jeon, Ho-Jun; Pyo, Jung-Hoon; Kim, Young-Shin; Yoo, Mi-Ae
2018-03-07
Stem cell dysfunction is closely linked to tissue and organismal aging and age-related diseases, and heavily influenced by the niche cells' environment. The DNA damage response (DDR) is a key pathway for tissue degeneration and organismal aging; however, the precise protective role of DDR in stem cell/niche aging is unclear. The Drosophila midgut is an excellent model to study the biology of stem cell/niche aging because of its easy genetic manipulation and its short lifespan. Here, we showed that deficiency of DDR in Drosophila enterocytes (ECs) accelerates intestinal stem cell (ISC) aging. We generated flies with knockdown of Mre11 , Rad50 , Nbs1 , ATM , ATR , Chk1 , and Chk2 , which decrease the DDR system in ECs. EC-specific DDR depletion induced EC death, accelerated the aging of ISCs, as evidenced by ISC hyperproliferation, DNA damage accumulation, and increased centrosome amplification, and affected the adult fly's survival. Our data indicated a distinct effect of DDR depletion in stem or niche cells on tissue-resident stem cell proliferation. Our findings provide evidence of the essential role of DDR in protecting EC against ISC aging, thus providing a better understanding of the molecular mechanisms of stem cell/niche aging.
Mo doped DLC nanocomposite coatings with improved mechanical and blood compatibility properties
Energy Technology Data Exchange (ETDEWEB)
Tang, X.S. [School of Physics Science and Technology, Zhanjiang Normal University, Zhanjiang 524048 (China); Development Center for New Materials Engineering and Technology in Universities of Guangdong, Zhanjiang 524048 (China); Wang, H.J.; Feng, L. [School of Physics Science and Technology, Zhanjiang Normal University, Zhanjiang 524048 (China); Shao, L.X. [School of Physics Science and Technology, Zhanjiang Normal University, Zhanjiang 524048 (China); Development Center for New Materials Engineering and Technology in Universities of Guangdong, Zhanjiang 524048 (China); Zou, C.W., E-mail: qingyihaiyanas@163.com [School of Physics Science and Technology, Zhanjiang Normal University, Zhanjiang 524048 (China); Development Center for New Materials Engineering and Technology in Universities of Guangdong, Zhanjiang 524048 (China)
2014-08-30
Highlights: • Mo doped diamond like carbon coatings were deposited by magnetron sputtering. • The blood compatibility of Mo-DLC coatings was observed through platelet adhesion. • The amount of thrombus on the Mo-DLC is much less than that of pyrolytic carbon. - Abstract: Mo (molybdenum) doped diamond like carbon (Mo-DLC) coatings with improved mechanical and blood compatibility properties were deposited by closed field unbalanced magnetron sputtering. The undoped and Mo-doped DLC coatings were analyzed by various characterization techniques such as Raman spectra, Atomic force microscopy, and temperature-dependent frictional wear testing. The results showed that the Mo-DLC coating with low Mo concentration was a effective protective coating with reduced residual stress and increased cohesive strength, and kept good wear resistance at the ambient temperature of 500 °C. The blood compatibility of Mo-DLC coatings was investigated by platelet adhesion. The results showed that the amount of thrombus on the Mo-DLC nanocomposite coatings was much less than that of thrombus on pyrolytic carbon films. The Mo-DLC nanocomposite coatings would be a new kind of promising materials applied to artificial heart valve and endovascula stent.
Mo doped DLC nanocomposite coatings with improved mechanical and blood compatibility properties
International Nuclear Information System (INIS)
Tang, X.S.; Wang, H.J.; Feng, L.; Shao, L.X.; Zou, C.W.
2014-01-01
Highlights: • Mo doped diamond like carbon coatings were deposited by magnetron sputtering. • The blood compatibility of Mo-DLC coatings was observed through platelet adhesion. • The amount of thrombus on the Mo-DLC is much less than that of pyrolytic carbon. - Abstract: Mo (molybdenum) doped diamond like carbon (Mo-DLC) coatings with improved mechanical and blood compatibility properties were deposited by closed field unbalanced magnetron sputtering. The undoped and Mo-doped DLC coatings were analyzed by various characterization techniques such as Raman spectra, Atomic force microscopy, and temperature-dependent frictional wear testing. The results showed that the Mo-DLC coating with low Mo concentration was a effective protective coating with reduced residual stress and increased cohesive strength, and kept good wear resistance at the ambient temperature of 500 °C. The blood compatibility of Mo-DLC coatings was investigated by platelet adhesion. The results showed that the amount of thrombus on the Mo-DLC nanocomposite coatings was much less than that of thrombus on pyrolytic carbon films. The Mo-DLC nanocomposite coatings would be a new kind of promising materials applied to artificial heart valve and endovascula stent
Pathogenicity and diversity of vegetative compatibility of Fusarium verticillioides
Directory of Open Access Journals (Sweden)
Krnjaja Vesna S.
2007-01-01
Full Text Available Pathogenicity of 10 Fusarium verticillioides isolates, originated from grain of wheat (five isolates and maize (five isolates, were studied under greenhouse conditions. Based on different parameters of the pathogenicity estimate (a scale for % of nonemerged plants, % of survived plants, plant vigour - the growth and dry weight of roots and epicotyls and disease severity it was determined that all F. verticillioides isolates expressed a different degree of pathogenicity. According to % of nonemerged plants six three and one F. verticillioides isolates expressed low, moderate and high degree of pathogenicity, respectively. All F. verticillioides isolates reduced the plant survival rate and vigour, while the disease severity ranged from 2.0 to 3.54. Two types of nit mutants, nit1 and NitM, were obtained by the use of the method of vegetative compatibility. The frequency of nit1 mutants was greater (58.79% than the frequency of NitM mutants (5.77%. A total of 10 vegetative compatibility groups (VCGs of F. verticillioides were established in the complementation tests. These results point out to a high genetic diversity of F. verticillioides population.
FUNGIBLE AND COMPATIBLE BIOFUELS: LITERATURE SEARCH, SUMMARY, AND RECOMMENDATIONS
Energy Technology Data Exchange (ETDEWEB)
Bunting, Bruce G [ORNL; Bunce, Michael [ORNL; Barone, Teresa L [ORNL; Storey, John Morse [ORNL
2011-04-01
The purpose of the study described in this report is to summarize the various barriers to more widespread distribution of bio-fuels through our common carrier fuel distribution system, which includes pipelines, barges and rail, fuel tankage, and distribution terminals. Addressing these barriers is necessary to allow the more widespread utilization and distribution of bio-fuels, in support of a renewable fuels standard and possible future low-carbon fuel standards. These barriers can be classified into several categories, including operating practice, regulatory, technical, and acceptability barriers. Possible solutions to these issues are discussed; including compatibility evaluation, changes to bio-fuels, regulatory changes, and changes in the distribution system or distribution practices. No actual experimental research has been conducted in the writing of this report, but results are used to develop recommendations for future research and additional study as appropriate. This project addresses recognized barriers to the wider use of bio-fuels in the areas of development of codes and standards, industrial and consumer awareness, and materials compatibility issues.
Directory of Open Access Journals (Sweden)
Raimundo Maciel Souza
2008-02-01
Full Text Available Os movimentos de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no Estado do Ceará, Brasil, foram investigados com o objetivo de compreender variações anuais em sua população. A chegada e a partida de colônias de abelhas africanizadas (AHB, no município semi-árido de Canindé e na úmida cidade litorânea de Fortaleza (separadas por 120 km, foram monitoradas semanalmente, de janeiro de 1999 a dezembro de 2001, e comparados com os dados pluviométricos de chuvas em ambas as áreas. Os resultados demonstraram que as abelhas africanizadas somente nidificaram no semi-árido durante a estação chuvosa e o abandonaram na estação seca, ao contrário do observado em Fortaleza. Apenas 5% das colônias permaneceram na área semi-árida por todo o ano, por causa dos ataques de formigas (Camponotus sp. e carência de néctar e água na estação seca. A maioria das colônias migrou para as áreas litorâneas onde o clima é mais ameno e muitas espécies vegetais florescem nesta época do ano. O excesso de chuvas provavelmente forçava as colônias africanizadas a migrarem de volta ao semi-árido durante a estação chuvosa. Conclui-se que o abandono e a migração são estratégias que permitem às abelhas africanizadas sobreviverem no semi-árido nordestino, em contraste com as raças européias que nunca conseguiram estabelecer populações silvestres na região.We investigated the annual movements of feral Africanized honey bee (Apis melliferaL. colonies in the state of Ceará, Brazil, aiming to understand seasonal variations in their population. Arrival and absconding of Africanized honey bee (AHB colonies in the semiarid municipality of Canindé and the coastal humid city of Fortaleza (120 km apart were recorded weekly from January 1999 to December 2001, and the data compared to rainfall records in both areas. Results showed that AHB colonies only nest in the semiarid during the rainy season and abscond during the
Directory of Open Access Journals (Sweden)
Breno Magalhães Freitas
2007-10-01
Full Text Available We investigated the annual movements of feral Africanized honey bee (Apis mellifera L. colonies in the state of Ceará, Brazil, aiming to understand seasonal variations in their population. Arrival and absconding of Africanized honey bee (AHB colonies in the semiaridmunicipality of Canindé and the coastal humid city of Fortaleza (120 km apart were recorded weekly from January 1999 to December 2001, and the data compared to rainfall records in both areas. Results showed that AHB colonies only nest in the semiarid during the rainy season and abscond during the dry season, the opposite from observations taken in Fortaleza. Only 5% of colonies remained in the semiarid area for the entire year due to ant (Camponotus sp. attacks and shortage of nectar and water during the dry season, with most colonies migrating to coastal areas where the weather is milder and many plant species bloom at that time of year. Excessive rainfallprobably pushes AHB colonies back to the semiarid during the rainy season. We concluded that absconding and migration are strategies that allow AHB colonies to survive in the semiarid NE of Brazil, contrary to European honeybees, which have never succeeded in establishing wild colonies in the region.Os movimentos de colônias silvestres da abelha melífera africanizada (Apis mellifera L. no Estado do Ceará, Brasil, foram investigados com o objetivo de compreender variações anuais em sua população. A chegada e a partida de colônias de abelhas africanizadas (AHB,no município semi-árido de Canindé e na úmida cidade litorânea de Fortaleza (separadas por 120 km, foram monitoradas semanalmente, de janeiro de 1999 a dezembro de 2001, e comparados com os dados pluviométricos de chuvas em ambas as áreas. Os resultadosdemonstraram que as abelhas africanizadas somente nidificaram no semi-árido durante a estação chuvosa e o abandonaram na estação seca, ao contrário do observado em Fortaleza. Apenas 5% das col
Common fixed point theorems for weakly compatible mappings in fuzzy metric spaces
Directory of Open Access Journals (Sweden)
Sunny Chauhan
2013-05-01
Full Text Available The aim of this paper is to prove a common fixed point theorem for a pair of weakly compatible mappings in fuzzy metric space by using the (CLRg property. An example is also furnished which demonstrates the validity of our main result. As an application to our main result, we present a fixed point theorem for two finite families of self mappings in fuzzy metric space by using the notion of pairwise commuting. Our results improve the results of Sedghi, Shobe and Aliouche [A common fixed point theorem for weakly compatible mappings in fuzzy metric spaces, Gen. Math. 18(3 (2010, 3-12 MR2735558].
A social work study for the effects of different factors on compatible and discordant couples
Directory of Open Access Journals (Sweden)
Mehdi Esalat
2012-04-01
Full Text Available In this paper, we perform an empirical investigation to examine the impact different factors on compatible and discordant couples. The survey is performed in one of western regions of Iran near the city of Esfahan. In our study, we choose two groups of people from the population with no family dispute and from the people who have requested divorce. They are asked to fill in a questionnaire and the results are analyzed. We used Chi-square tests to verify any meaningful difference between compatible and discordant couples on different issues. The survey concludes that compatible and discordant couples were different in their motivation, marital satisfaction, continued incentive generation, finding better position among relatives and accomplishing their religious duties to get married.
International Nuclear Information System (INIS)
Feitosa, Marcos Antonio Fernandes
2008-01-01
The plastic industry has recognized that mixture of polymers, called polymeric blends, yields new materials with improve properties and better features of those of the polymer blended. In most of the cases, blends are formed by immiscible components presenting separated phases, micro-structures or morphologies. One of the main factors for good mechanical performance is the interfacial adhesion of the blend components. The improvement of miscibility between the polymer components and the enhancement of blend performance is denominated of compatibility. This compatibility can be achieved by chemical methods or using ionizing radiation. The present work has as a main objective the study of the effect of the ionizing radiation from electron beam in the compatibility of the polyamide (PA) 6.6 and low density polyethylene (LDPE) 75%/25% wt blend, in the range of applied doses from 50 to 250 kGy. The compatibility effect was evaluated by mechanical test, which has shown improvement in the tensile strength and hardness properties and a reduction of the impact resistant. This mechanical behavior can be considered as a combination effect of the cross-linking, induced in the molecular structure on the polymers, and the increase of the miscibility of the blend components. The degree of compatibility was evaluated by the behavior of the glass transition temperatures (T g ) for the blend components obtained by dynamic mechanical analysis (DMA) measurements. The results have shown that the values of T g for PA 6.6 and LDPE get near by 8 deg C showing that the ionizing radiation have promoted a compatibility effect on the irradiated blend. (author)
Directory of Open Access Journals (Sweden)
O.S. Kozhanova
2015-04-01
Full Text Available Purpose: motivation of methodological approach to selection of sportswomen to calisthenics teams for group exercises considering compatibility factor. Material: in the research 40 high qualification sportswomen of 17-23 yrs age with sport experience of 11-16 years participated. With cluster analysis 10 gymnasts with morphological indicators, meeting modern standards of group exercises were selected. Results: we found 5 generalized factors, which characterize structure of selection to teams and determines 72% of dispersion. Influence of kinds and connected with them criteria of compatibility on efficiency of gymnasts’ competition functioning were also determined. The authors substantiated methodological approach to selection of sportswomen to calisthenics teams for group exercises, considering compatibility factor. Conclusions: in selection to calisthenics teams for group exercises it is purposeful to realize complex registration of compatibility kinds, considering gymnasts’ similar features by recommended indicators.
Compatible solutes in lactic acid bacteria subjected to water stress
Kets, E.P.W.
1997-01-01
The goal of the research project described in this thesis was to investigate the protective effect of compatible solutes on tactic acid bacteria subjected to drying. Dried preparations of lactic acid bacteria are applied as starter cultures in feed and food industries. Dried starter
Introducing PneuAct: Parametrically-Designed MRI-Compatible Pneumatic Stepper Actuator
Sojoodi Farimani, F.; Misra, Sarthak
2018-01-01
Pneumatic stepper motors are one of the promising alternative actuation methods for motion control in environments where electromagnetic (EM) motors cannot be used. Due to the lack of commercial off-the-shelf products, researchers working on MR compatible robotics have to develop their own pneumatic
Performance of ventilators compatible with magnetic resonance imaging: a bench study.
Chikata, Yusuke; Okuda, Nao; Izawa, Masayo; Onodera, Mutsuo; Nishimura, Masaji
2015-03-01
Magnetic resonance imaging (MRI) is indispensable for diagnosing brain and spinal cord abnormalities. Magnetic components cannot be used during MRI procedures; therefore, patient support equipment must use MRI-compatible materials. However, little is known of the performance of MRI-compatible ventilators. At commonly used settings, we tested the delivered tidal volume (V(T)), F(IO2), PEEP, and operation of the high-inspiratory-pressure-relief valves of 4 portable MRI-compatible ventilators (Pneupac VR1, ParaPAC 200DMRI, CAREvent MRI, iVent201) and one ICU ventilator (Servo-i). Each ventilator was set in volume control/continuous mandatory ventilation mode. Breathing frequency and V(T) were tested at 10 breaths/min and 300, 500, and 700 mL, respectively. The Pneupac VR1 has fixed V(T) and frequency combinations, so it was tested at V(T) = 300 mL and 20 breaths/min, V(T) = 500 mL and 12 breaths/min, and V(T) = 800 mL and 10 breaths/min. F(IO2) was 0.6 and 1.0. At the air-mix setting, F(IO2) was fixed at 0.5 with the Pneupac VR1, 0.45 with the ParaPAC 200DMRI, and 0.6 with the CAREvent MRI. PEEP was set at 5 and 10 cm H2O, and pressure relief was set at 30 and 40 cm H2O. V(T) error varied widely among ventilators (-28.1 to 25.5%). As V(T) increased, error decreased with the Pneupac VR1, ParaPAC 200DMRI, and CAREvent MRI (P ventilators (-29.2 to 42.5%). Only the Servo-i maintained V(T), F(IO2), and PEEP at set levels. The pressure-relief valves worked in all ventilators. None of the MRI-compatible ventilators maintained V(T), F(IO2), and PEEP at set levels. Vital signs of patients with unstable respiratory mechanics should be monitored during transport and MRI. Copyright © 2015 by Daedalus Enterprises.
The DNA damage response during mitosis
International Nuclear Information System (INIS)
Heijink, Anne Margriet; Krajewska, Małgorzata; Vugt, Marcel A.T.M. van
2013-01-01
Cells are equipped with a cell-intrinsic signaling network called the DNA damage response (DDR). This signaling network recognizes DNA lesions and initiates various downstream pathways to coordinate a cell cycle arrest with the repair of the damaged DNA. Alternatively, the DDR can mediate clearance of affected cells that are beyond repair through apoptosis or senescence. The DDR can be activated in response to DNA damage throughout the cell cycle, although the extent of DDR signaling is different in each cell cycle phase. Especially in response to DNA double strand breaks, only a very marginal response was observed during mitosis. Early on it was recognized that cells which are irradiated during mitosis continued division without repairing broken chromosomes. Although these initial observations indicated diminished DNA repair and lack of an acute DNA damage-induced cell cycle arrest, insight into the mechanistic re-wiring of DDR signaling during mitosis was only recently provided. Different mechanisms appear to be at play to inactivate specific signaling axes of the DDR network in mitosis. Importantly, mitotic cells not simply inactivate the entire DDR, but appear to mark their DNA damage for repair after mitotic exit. Since the treatment of cancer frequently involves agents that induce DNA damage as well as agents that block mitotic progression, it is clinically relevant to obtain a better understanding of how cancer cells deal with DNA damage during interphase versus mitosis. In this review, the molecular details concerning DDR signaling during mitosis as well as the consequences of encountering DNA damage during mitosis for cellular fate are discussed
The DNA damage response during mitosis
Energy Technology Data Exchange (ETDEWEB)
Heijink, Anne Margriet; Krajewska, Małgorzata; Vugt, Marcel A.T.M. van, E-mail: m.vugt@umcg.nl
2013-10-15
Cells are equipped with a cell-intrinsic signaling network called the DNA damage response (DDR). This signaling network recognizes DNA lesions and initiates various downstream pathways to coordinate a cell cycle arrest with the repair of the damaged DNA. Alternatively, the DDR can mediate clearance of affected cells that are beyond repair through apoptosis or senescence. The DDR can be activated in response to DNA damage throughout the cell cycle, although the extent of DDR signaling is different in each cell cycle phase. Especially in response to DNA double strand breaks, only a very marginal response was observed during mitosis. Early on it was recognized that cells which are irradiated during mitosis continued division without repairing broken chromosomes. Although these initial observations indicated diminished DNA repair and lack of an acute DNA damage-induced cell cycle arrest, insight into the mechanistic re-wiring of DDR signaling during mitosis was only recently provided. Different mechanisms appear to be at play to inactivate specific signaling axes of the DDR network in mitosis. Importantly, mitotic cells not simply inactivate the entire DDR, but appear to mark their DNA damage for repair after mitotic exit. Since the treatment of cancer frequently involves agents that induce DNA damage as well as agents that block mitotic progression, it is clinically relevant to obtain a better understanding of how cancer cells deal with DNA damage during interphase versus mitosis. In this review, the molecular details concerning DDR signaling during mitosis as well as the consequences of encountering DNA damage during mitosis for cellular fate are discussed.
Genomic and Molecular Landscape of DNA Damage Repair Deficiency across The Cancer Genome Atlas
Directory of Open Access Journals (Sweden)
Theo A. Knijnenburg
2018-04-01
Full Text Available Summary: DNA damage repair (DDR pathways modulate cancer risk, progression, and therapeutic response. We systematically analyzed somatic alterations to provide a comprehensive view of DDR deficiency across 33 cancer types. Mutations with accompanying loss of heterozygosity were observed in over 1/3 of DDR genes, including TP53 and BRCA1/2. Other prevalent alterations included epigenetic silencing of the direct repair genes EXO5, MGMT, and ALKBH3 in ∼20% of samples. Homologous recombination deficiency (HRD was present at varying frequency in many cancer types, most notably ovarian cancer. However, in contrast to ovarian cancer, HRD was associated with worse outcomes in several other cancers. Protein structure-based analyses allowed us to predict functional consequences of rare, recurrent DDR mutations. A new machine-learning-based classifier developed from gene expression data allowed us to identify alterations that phenocopy deleterious TP53 mutations. These frequent DDR gene alterations in many human cancers have functional consequences that may determine cancer progression and guide therapy. : Knijnenburg et al. present The Cancer Genome Atlas (TCGA Pan-Cancer analysis of DNA damage repair (DDR deficiency in cancer. They use integrative genomic and molecular analyses to identify frequent DDR alterations across 33 cancer types, correlate gene- and pathway-level alterations with genome-wide measures of genome instability and impaired function, and demonstrate the prognostic utility of DDR deficiency scores. Keywords: The Cancer Genome Atlas PanCanAtlas project, DNA damage repair, somatic mutations, somatic copy-number alterations, epigenetic silencing, DNA damage footprints, mutational signatures, integrative statistical analysis, protein structure analysis
International Nuclear Information System (INIS)
Bouthier de la Tour, Claire; Passot, Fanny Marie; Toueille, Magali; Servant, Pascale; Sommer, Suzanne; Mirabella, Boris; Blanchard, Laurence; Groot, Arjan de; Guerin, Philippe; Armengaud, Jean
2013-01-01
The nucleoids of radiation-resistant Deinococcus species show a high degree of compaction maintained after ionizing irradiation. We identified proteins recruited after irradiation in nucleoids of Deinococcus radiodurans and Deinococcus deserti by means of comparative proteomics. Proteins in nucleoid-enriched fractions from unirradiated and irradiated Deinococcus were identified and semi quantified by shotgun proteomics. The ssDNA-binding protein SSB, DNA gyrase subunits GyrA and GyrB, DNA topoisomerase I, RecA recombinase, UvrA excinuclease, RecQ helicase, DdrA, DdrB, and DdrD proteins were found in significantly higher amounts in irradiated nucleoids of both Deinococcus species. We observed, by immunofluorescence microscopy, the subcellular localization of these proteins in D. radiodurans, showing for the first time the recruitment of the DdrD protein into the D. radiodurans nucleoid. We specifically followed the kinetics of recruitment of RecA, DdrA, and DdrD to the nucleoid after irradiation. Remarkably, RecA proteins formed irregular filament-like structures 1 h after irradiation, before being redistributed throughout the cells by 3 h post-irradiation. Comparable dynamics of DdrD localization were observed, suggesting a possible functional interaction between RecA and DdrD. Several proteins involved in nucleotide synthesis were also seen in higher quantities in the nucleoids of irradiated cells, indicative of the existence of a mechanism for orchestrating the presence of proteins involved in DNA metabolism in nucleoids in response to massive DNA damage. All MS data have been deposited in the ProteomeXchange with identifier PXD00196. (authors)
Compatibility of Pt-3008 with selected components of the selenide isotope generator system
International Nuclear Information System (INIS)
Keiser, J.R.
1979-04-01
The first in a new generation of radioisotopic thermoelectric generators being built by Teledyne Energy Systems and designated the Selenide Isotope Generator has thermoelectric materials that can be degraded by reaction with O 2 , H 2 O, CO, and other gases. Consequently, for at least the first ground demonstration system a protective xenon atmosphere will be maintained over the thermoelectrics. The high-temperature portion of the atmosphere-retaining structure will be fabricated from the alloy Pt-3008 (Pt--30 wt % Rh--8 wt % W), which was developed at Oak Ridge National Laboratory. For this application Pt-3008 must be compatible with the various insulations and thermoelectric materials. A study of the compatibility of Pt-3008 with these materials and showed that Pt-3008 was embrittled after exposure to some of the insulations that were not adequately outgassed and by one of the thermoelectric materials (Cu 2 Se) in some of the isothermal tests. It is believed that Pt-3008 will be compatible with the Selenide Isotope Generator materials when they are well outgassed and under the temperature gradient conditions of the operating system
Research on micro-structure and hemo-compatibility of the artificial heart valve surface
International Nuclear Information System (INIS)
Ye Xia; Shao Yunliang; Zhou Ming; Li Jian; Cai Lan
2009-01-01
In order to seek the method to improve the hemo-compatibility of artificial mechanical heart valve, the surface of rabbit's heart valve was observed using the scanning electron microscopy (SEM). The results showed that the dual-scale structure which consists of cobblestones-like structure of 8 μm in underside diameter and 3 μm in height, and the fine cilia of about 150 nm in diameter, was helpful to the hemo-compatibility of the heart valve. Therefore, the polydimethylsiloxane (PDMS) surface with hierarchical micro-structure was fabricated using femtosecond laser fabrication technique and soft lithography. At the same time, the tests of apparent contact angle and platelet adhesion on both smooth and textured PDMS surfaces were carried out to study their wettability and hemo-compatibility. The results demonstrated that the surface with textured structure displayed more excellent wettabililty and anti-coagulation property than that of smooth surface. The apparent contact angle of textured surface enhanced from 113.1 deg. to 163.6 deg. and the amount of adsorbed platelet on such surface was fewer, no distortion and no activation were found.
Inducing PLA/starch compatibility through butyl-etherification of waxy and high amylose starch.
Wokadala, Obiro Cuthbert; Emmambux, Naushad Mohammad; Ray, Suprakas Sinha
2014-11-04
In this study, waxy and high amylose starches were modified through butyl-etherification to facilitate compatibility with polylactide (PLA). Fourier transform infrared spectroscopy, proton nuclear magnetic resonance spectroscopy and wettability tests showed that hydrophobic butyl-etherified waxy and high amylose starches were obtained with degree of substitution values of 2.0 and 2.1, respectively. Differential scanning calorimetry, tensile testing, and scanning electron microscopy (SEM) demonstrated improved PLA/starch compatibility for both waxy and high amylose starch after butyl-etherification. The PLA/butyl-etherified waxy and high amylose starch composite films had higher tensile strength and elongation at break compared to PLA/non-butyl-etherified composite films. The morphological study using SEM showed that PLA/butyl-etherified waxy starch composites had a more homogenous microstructure compared to PLA/butyl-etherified high amylose starch composites. Thermogravimetric analysis showed that PLA/starch composite thermal stability decreased with starch butyl-etherification for both waxy and high amylose starches. This study mainly demonstrates that PLA/starch compatibility can be improved through starch butyl-etherification. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Shen Feng; Zhang Erlin; Wei Zunjie
2010-01-01
In vitro blood compatibility of poly (hydroxybutyrate-co-hydroxyhexanoate) (PHBHHx) was evaluated in comparison with poly (L-lactic acid) (PLLA) by a haemolysis assay, in vitro platelet adhesion test and coagulation measurements including plasma recalcification time (PRT), plasma prothrombin time (PT) and kinetic clotting time. The results showed that PHBHHx exhibited better blood compatibility than PLLA. Furthermore, PHBHHx film was modified by NaOH treatment to improve the surface hydrophilic property and the influence of the surface modification on the blood compatibility was investigated. Surface properties including hydrophilic property, surface appearance and functional groups were characterized by water contact angle measurement, scanning electron microscopy (SEM) and X-ray photoelectron spectroscopy (XPS). The results showed that the hydrophilic property of PHBHHx film was obviously improved by the NaOH treatment. It was also shown that the NaOH treatment could significantly enhance the blood compatibility of PHBHHx by prolonging PRT, PT, and kinetic clotting time and decreasing platelet activation. It is thought that the improvement in the hydrophilic property mainly contributes to the enhancement of blood compatibility.
Ambrose, Stephanie J; Harmer, Christopher J; Hall, Ruth M
2018-02-24
In an early study, IncA and IncC plasmids that were reported to be compatible were grouped as the "A-C complex" based on similarities and on strong entry exclusion. However, recently, the term IncA/C has been used frequently to describe plasmids belonging to both of these two groups. Granted that the supporting data was not included in the original reports and that the consensus iteron sequences have since been shown to be essentially identical, we have addressed the question again. The original IncA plasmid, RA1, and the IncC plasmid pRMH760, were introduced into the same cell by transformation, and were found to be maintained stably for over 100 generations in the absence of selection for either plasmid, i.e. they were compatible. We conclude that use of the term IncA/C for this important plasmid group is indeed incorrect and it causes unnecessary confusion. Granted the importance of IncC plasmids in the spread of antibiotic resistance genes, we recommend that use of the misleading terms IncA/C, IncA/C 1 and IncA/C 2 should cease. In addition, RA1 and pRMH760 were shown to each completely prevent entry of the other via conjugative transfer into the cell they reside in. Copyright © 2018 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Wang, Ke [Key Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi, Jiangsu Province (China); Pei, Hao [Wuxi Hospital of Infectious Disease, Wuxi, Jiangsu Province (China); Huang, Biao; Yang, Run-Lin [Key Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi, Jiangsu Province (China); Wu, Hang-Yuan [Wuxi Hospital of Infectious Disease, Wuxi, Jiangsu Province (China); Zhu, Xue; Zhu, Lan [Key Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi, Jiangsu Province (China)
2012-08-17
The role of B cells in the pathogenesis of hepatitis B virus (HBV) infection has not been explored in depth. In the present study, the activation status of B cells from peripheral blood of healthy controls (N = 20) and patients with acute hepatitis B (AHB, N = 15) or chronic hepatitis B (CHB, N = 30) was evaluated by measuring the expression levels of B-cell activation markers CD69 and CD86, using quantitative real-time PCR and flow cytometry. Moreover, the potential mechanism underlying B-cell activation during HBV infection was further investigated by analyzing the expression profile of FCRL1, an intrinsic activation molecule of B cells. An elevation in the levels of B-cell activation markers including CD69 and CD86 was observed in the AHB patients (44.31 ± 9.27, 27.64 ± 9.26%) compared to CHB patients (30.35 ± 11.27, 18.41 ± 6.56%, P < 0.05), which was still higher than healthy controls (12.23 ± 7.84, 8.22 ± 3.43%, P < 0.05). Furthermore, the expression of FCRL1 was found to be similar to B-cell activation markers, which was highest in AHB patients (70.15 ± 17.11%), lowest in healthy donors (36.32 ± 9.98%, P < 0.05) and half-way between these levels in patients with CHB (55.17 ± 12.03%, P < 0.05). The results were positively associated with aberrant B-cell activation. These data suggest that B cells can play a role in HBV infection, and therefore more effort should be devoted to exploring their functions.
CMOS-compatible spintronic devices: a review
Makarov, Alexander; Windbacher, Thomas; Sverdlov, Viktor; Selberherr, Siegfried
2016-11-01
For many decades CMOS devices have been successfully scaled down to achieve higher speed and increased performance of integrated circuits at lower cost. Today’s charge-based CMOS electronics encounters two major challenges: power dissipation and variability. Spintronics is a rapidly evolving research and development field, which offers a potential solution to these issues by introducing novel ‘more than Moore’ devices. Spin-based magnetoresistive random-access memory (MRAM) is already recognized as one of the most promising candidates for future universal memory. Magnetic tunnel junctions, the main elements of MRAM cells, can also be used to build logic-in-memory circuits with non-volatile storage elements on top of CMOS logic circuits, as well as versatile compact on-chip oscillators with low power consumption. We give an overview of CMOS-compatible spintronics applications. First, we present a brief introduction to the physical background considering such effects as magnetoresistance, spin-transfer torque (STT), spin Hall effect, and magnetoelectric effects. We continue with a comprehensive review of the state-of-the-art spintronic devices for memory applications (STT-MRAM, domain wall-motion MRAM, and spin-orbit torque MRAM), oscillators (spin torque oscillators and spin Hall nano-oscillators), logic (logic-in-memory, all-spin logic, and buffered magnetic logic gate grid), sensors, and random number generators. Devices with different types of resistivity switching are analyzed and compared, with their advantages highlighted and challenges revealed. CMOS-compatible spintronic devices are demonstrated beginning with predictive simulations, proceeding to their experimental confirmation and realization, and finalized by the current status of application in modern integrated systems and circuits. We conclude the review with an outlook, where we share our vision on the future applications of the prospective devices in the area.
Bougouin, Christelle; Thelcide, Chloë; Crespin-Maillard, Fabienne; Maillard, Christian; Kinowski, Jean Marie; Favier, Mireille
2005-10-01
The compatibility of ondansetron hydrochloride and methylprednisolone sodium succinate in 5% dextrose injection and 0.9% sodium chloride injection was studied. Test solutions of ondansetron hydrochloride 0.16 mg/mL and methylprednisolone sodium succinate 2.4 mg/mL were prepared in triplicate and tested in duplicate. Total volumes of 4 and 2 mL of ondansetron hydrochloride solution and methylprednisolone sodium succinate solution, respectively, were added to 50-mL multilayer polyolefin bags containing 5% dextrose injection or 0.9% sodium chloride injection. Bags were stored for 24 hours at 20-25 degrees C and for 48 hours at 4-8 degrees C. Chemical compatibility was measured with high-performance liquid chromatography, and physical compatibility was determined visually. Ondansetron hydrochloride was stable for up to 24 hours at 20-25 degrees C and up to 48 hours at 4-8 degrees C. Methylprednisolone sodium succinate was stable for up to 48 hours at 4-8 degrees C. When stored at 20-25 degrees C, methylprednisolone sodium succinate was stable for up to 7 hours in 5% dextrose injection and up to 24 hours in 0.9% sodium chloride injection. Compatibility data for solutions containing ondansetron hydrochloride plus methylprednisolone sodium succinate revealed that each drug was stable for up to 24 hours at 20-25 degrees C and up to 48 hours at 4-8 degrees C. Ondansetron 0.16 mg/mL (as the hydrochloride) and methylprednisolone 2.4 mg/mL (as the sodium succinate) mixed in 50-mL multilayer polyolefin bags were stable in both 5% dextrose injection and 0.9% sodium chloride injection for up to 24 hours at 20-25 degrees C and up to 48 hours at 4-8 degrees C.
THE COMPATIBILITY STUDENT CHOICE OF UNIVERSITY MAJORING; A PRELIMINARY STUDIES
Directory of Open Access Journals (Sweden)
Daharnis Daharnis
2016-06-01
Full Text Available The continuous improvements in order to optimize the basic education to higher education are still running. Based on that purpose, there are many factors to supporting the students' learning activities success; one of the factors is suitability with majors in university. The purpose of this study is to reveal the condition of the compatibility of students majoring with their interest, then to describe the information when the student choose their majoring. Samples in this study were 122 peoples, taken by random sampling from the Padang State University. Data obtained by distributing questionnaires. The results showed that there are students that their major do not match with their interest (22.13%, only 3.28% of students who feel compatible with their major. This result should be a major concern, particularly for counselor in schools for design counseling services to solve these problems. The result of this study used as a grand tour or a preliminary study for further research.
Progress of the DUPIC fuel compatibility analysis (I) - reactor physics
Energy Technology Data Exchange (ETDEWEB)
Choi, Hang Bok; Jeong, Chang Joon; Roh, Gyu Hong; Rhee, Bo Wook; Park, Jee Won
2003-12-01
Since 1992, the direct use of spent pressurized water reactor fuel in CANada Deuterium Uranium (CANDU) reactors (DUPIC) has been studied as an alternative to the once-through fuel cycle. The DUPIC fuel cycle study is focused on the technical feasibility analysis, the fabrication of DUPIC fuels for irradiation tests and the demonstration of the DUPIC fuel performance. The feasibility analysis was conducted for the compatibility of the DUPIC fuel with existing CANDU-6 reactors from the viewpoints of reactor physics, reactor safety, fuel cycle economics, etc. This study has summarized the intermediate results of the DUPIC fuel compatibility analysis, which includes the CANDU reactor physics design requirements, DUPIC fuel core physics design method, performance of the DUPIC fuel core, regional overpower trip setpoint, and the CANDU primary shielding. The physics analysis showed that the CANDU-6 reactor can accommodate the DUPIC fuel without deteriorating the physics design requirements by adjusting the fuel management scheme if the fissile content of the DUPIC fuel is tightly controlled.
A review of magnetic resonance imaging compatible manipulators in surgery.
Elhawary, H; Zivanovic, A; Davies, B; Lampérth, M
2006-04-01
Developments in magnetic resonance imaging (MRI), coupled with parallel progress in the field of computer-assisted surgery, mean that an ideal environment has been created for the development of MRI-compatible robotic systems and manipulators, capable of enhancing many types of surgical procedure. However, MRI does impose severe restrictions on mechatronic devices to be used in or around the scanners. In this article a review of the developments in the field of MRI-compatible surgical manipulators over the last decade is presented. The manipulators developed make use of different methods of actuation, but they can be reduced to four main groups: actuation transmitted through hydraulics, pneumatic actuators, ultrasonic motors based on the piezoceramic principle and remote manual actuation. Progress has been made concerning material selection, position sensing, and different actuation techniques, and design strategies have been implemented to overcome the multiple restrictions imposed by the MRI environment. Most systems lack the clinical validation needed to continue on to commercial products.
The remote handling compatibility analysis of the ITER generic upper port plug structure
Energy Technology Data Exchange (ETDEWEB)
Ronden, D.M.S., E-mail: d.m.s.ronden@differ.nl [FOM Institute DIFFER, P.O. Box 1207, 3430 BE Nieuwegein (Netherlands); Dammann, A. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul-lez-Durance (France); Elzendoorn, B. [FOM Institute DIFFER, P.O. Box 1207, 3430 BE Nieuwegein (Netherlands); Giacomin, T. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul-lez-Durance (France); Heemskerk, C. [Heemskerk Innovative Technology, Merelhof 2, 2172 HZ Sassenheim (Netherlands); Loesser, D. [Princeton Plasma Physics Laboratory, Princeton, NJ 08543-0451 (United States); Maquet, P. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul-lez-Durance (France); Oosterhout, J. van [FOM Institute DIFFER, P.O. Box 1207, 3430 BE Nieuwegein (Netherlands); Pak, S.; Pitcher, C.S.; Portales, M.; Proust, M.; Udintsev, V.S.; Walsh, M.J. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul-lez-Durance (France)
2014-10-15
Highlights: • We describe the remote handling compatibility of the ITER generic upper port plug. • Concepts are presented of specific design solutions to improve RH compatibility. • Simulation in VR of the GUPP DSM replacement indicates possible collisions. • Specific tooling concepts are proposed for GUPP handling equipment for the hot cell. - Abstract: The ITER diagnostics generic upper port plug (GUPP) is developed as a standardized design for all diagnostic upper port plugs, in which a variety of payloads can be mounted. Here, the remote handling compatibility analysis (RHCA) of the GUPP design is presented that was performed for the GUPP final design review. The analysis focuses mainly on the insertion and extraction procedure of the diagnostic shield module (DSM), a removable cassette that contains the diagnostic in-vessel components. It is foreseen that the DSM is a replaceable component – the procedure of which is to be performed inside the ITER hot cell facility (HCF), where the GUPP can be oriented in a vertical position. The DSM removal procedure in the HCF consists of removing locking pins, an M30 sized shoulder bolt and two electrical straps through the use of a dexterous manipulator, after which the DSM is lifted out of the GUPP by an overhead crane. For optimum access to its internals, the DSM is mounted in a handling device. The insertion of a new or refurbished DSM follows the reverse procedure. The RHCA shows that the GUPP design requires a moderate amount of changes to become fully compatible with RH maintenance requirements.
The remote handling compatibility analysis of the ITER generic upper port plug structure
International Nuclear Information System (INIS)
Ronden, D.M.S.; Dammann, A.; Elzendoorn, B.; Giacomin, T.; Heemskerk, C.; Loesser, D.; Maquet, P.; Oosterhout, J. van; Pak, S.; Pitcher, C.S.; Portales, M.; Proust, M.; Udintsev, V.S.; Walsh, M.J.
2014-01-01
Highlights: • We describe the remote handling compatibility of the ITER generic upper port plug. • Concepts are presented of specific design solutions to improve RH compatibility. • Simulation in VR of the GUPP DSM replacement indicates possible collisions. • Specific tooling concepts are proposed for GUPP handling equipment for the hot cell. - Abstract: The ITER diagnostics generic upper port plug (GUPP) is developed as a standardized design for all diagnostic upper port plugs, in which a variety of payloads can be mounted. Here, the remote handling compatibility analysis (RHCA) of the GUPP design is presented that was performed for the GUPP final design review. The analysis focuses mainly on the insertion and extraction procedure of the diagnostic shield module (DSM), a removable cassette that contains the diagnostic in-vessel components. It is foreseen that the DSM is a replaceable component – the procedure of which is to be performed inside the ITER hot cell facility (HCF), where the GUPP can be oriented in a vertical position. The DSM removal procedure in the HCF consists of removing locking pins, an M30 sized shoulder bolt and two electrical straps through the use of a dexterous manipulator, after which the DSM is lifted out of the GUPP by an overhead crane. For optimum access to its internals, the DSM is mounted in a handling device. The insertion of a new or refurbished DSM follows the reverse procedure. The RHCA shows that the GUPP design requires a moderate amount of changes to become fully compatible with RH maintenance requirements
Directory of Open Access Journals (Sweden)
F. Arévalo
2010-06-01
Full Text Available Objetivo: estudiar la frecuencia de positividad de las pruebas serológicas en pacientes con biopsias compatible con enfermedad celiaca. Material y métodos: estudio transversal. Se incluyeron pacientes con biopsia duodenal histológicamente compatible con enfermedad celiaca y determinación de anticuerpos antigliadina, antiendomisio y antitransglutaminasa IgA. Definimos como caso de enfermedad celiaca a quienes tuvieran biopsia positiva y anticuerpos antiendomisio y/o antitransglutaminasa positivos. Resultados: 31 pacientes fueron incluidos de los cuales 6 fueron antiendomisio positivo, 5 fueron antitransglutaminasa positivo y antigliadina fue positivo en 14. Por lo tanto de 31 pacientes con cambios histológicos compatibles con enfermedad celiaca sólo 10 tuvieron serología diagnóstica. Sólo uno de los pacientes tuvo positividad tanto para antitransglutaminasa como para antiendomisio. Conclusiones: a encontramos que la mayoría de biopsias de duodeno con un cuadro histológico sugerente de enfermedad celiaca no se corresponden con serología diagnóstica de esta enfermedad; b encontramos baja coincidencia en la positividad serológica entre antiendomisio y antitransglutaminasa.Objective: to study the frequency of positive serology for celiac disease (CD in patients with duodenal biopsies suggestive of this disease. Material and methods: cross sectional study. We included patients with duodenal biopsies histologically compatible with CD and antigliadin, antiendomysial and IgA antitransglutaminase antibodies. We defined a "case" of CD if there was a positive biopsy and either antiendomisial or antitransglutaminase positive antibodies. Results: thirty one patients were included in our study. Six were antiendomysial positive and 5 antitransglutaminase positive while the antigliadin was positive in 14 cases. Therefore, out of 31 patients only 10 had a serology compatible with CD and only one had positive both antibodies, antiendomysial and
Epstein-Barr Virus Hijacks DNA Damage Response Transducers to Orchestrate Its Life Cycle.
Hau, Pok Man; Tsao, Sai Wah
2017-11-16
The Epstein-Barr virus (EBV) is a ubiquitous virus that infects most of the human population. EBV infection is associated with multiple human cancers, including Burkitt's lymphoma, Hodgkin's lymphoma, a subset of gastric carcinomas, and almost all undifferentiated non-keratinizing nasopharyngeal carcinoma. Intensive research has shown that EBV triggers a DNA damage response (DDR) during primary infection and lytic reactivation. The EBV-encoded viral proteins have been implicated in deregulating the DDR signaling pathways. The consequences of DDR inactivation lead to genomic instability and promote cellular transformation. This review summarizes the current understanding of the relationship between EBV infection and the DDR transducers, including ATM (ataxia telangiectasia mutated), ATR (ATM and Rad3-related), and DNA-PK (DNA-dependent protein kinase), and discusses how EBV manipulates the DDR signaling pathways to complete the replication process of viral DNA during lytic reactivation.
Differential Equations Compatible with KZ Equations
International Nuclear Information System (INIS)
Felder, G.; Markov, Y.; Tarasov, V.; Varchenko, A.
2000-01-01
We define a system of 'dynamical' differential equations compatible with the KZ differential equations. The KZ differential equations are associated to a complex simple Lie algebra g. These are equations on a function of n complex variables z i taking values in the tensor product of n finite dimensional g-modules. The KZ equations depend on the 'dual' variable in the Cartan subalgebra of g. The dynamical differential equations are differential equations with respect to the dual variable. We prove that the standard hypergeometric solutions of the KZ equations also satisfy the dynamical equations. As an application we give a new determinant formula for the coordinates of a basis of hypergeometric solutions
Adaptive transmission based on multi-relay selection and rate-compatible LDPC codes
Su, Hualing; He, Yucheng; Zhou, Lin
2017-08-01
In order to adapt to the dynamical changeable channel condition and improve the transmissive reliability of the system, a cooperation system of rate-compatible low density parity check (RC-LDPC) codes combining with multi-relay selection protocol is proposed. In traditional relay selection protocol, only the channel state information (CSI) of source-relay and the CSI of relay-destination has been considered. The multi-relay selection protocol proposed by this paper takes the CSI between relays into extra account in order to obtain more chances of collabration. Additionally, the idea of hybrid automatic request retransmission (HARQ) and rate-compatible are introduced. Simulation results show that the transmissive reliability of the system can be significantly improved by the proposed protocol.
Economically compatible climate protection for Germany as a major site of industry
International Nuclear Information System (INIS)
Fahl, U.; Laege, E.; Schaumann, P.; Voss, A.
1996-01-01
National climate protection policy must be designed in such a way as to ensure its compatibility with the economy and full employment. In this context, cost-efficient measures for reducing greenhouse gas emissions which achieve a maximum cut in greenhouse gases for each Mark that is spent are of paramount importance. Climate protection, the strengthening of Germany as a major site of industry and a sphere of life, sustainable development and the safeguarding of power supply are all one. Political and economic action must have this fact in mind. This is the background against which the possibilities for economically compatible and climate-friendly reduction of energy-related greenhouse gas emissions in Germany are discussed. (orig.) [de
The Bicycle Compatibility Index : a level of service concept, implementation manual
1998-11-01
Currently, no methodology is widely accepted by engineers, planners, or bicycle coordinators that will allow them to determine how compatible a roadway is for allowing efficient operation of both bicycles and motor vehicles. Determining how existing ...
Evaluation of Absorbents for Compatibility with Site Generated Hazardous and Mixed Liquid Wastes
International Nuclear Information System (INIS)
Oji, L.N.
2002-01-01
SRS Solid Waste requested SRTC to perform a literature-based evaluation of sorbents, which are compatible with hazardous mixed waste being generated on site. Polypropylene-based materials and ground corn cob (Toxi-dry), because of their compatibility with the Consolidated Incinerator Facility (CIF) process, are the only two spill stabilization agents which are recommended for use on site (IS manual, Waste Acceptance Criteria 3.18). While ensuring minimal potential for undesired reactions between spills and spill control agents, Solid Waste wants to increase the number of site approved absorbents to give waste generators more flexibility in choosing liquid spill immobilization agents
Cu-Click Compatible Triazabutadienes To Expand the Scope of Aryl Diazonium Ion Chemistry.
Cornali, Brandon M; Kimani, Flora W; Jewett, John C
2016-10-07
Triazabutadienes can be used to readily generate reactive aryl diazonium ions under mild, physiologically relevant conditions. These conditions are compatible with a range of functionalities that do not tolerate traditional aryl diazonium ion generation. To increase the utility of this aryl diazonium ion releasing chemistry an alkyne-containing triazabutadiene was synthesized. The copper-catalyzed azide-alkyne cycloaddition ("Cu-click") reaction was utilized to modify the alkyne-containing triazabutadiene and shown to be compatible with the nitrogen-rich triazabutadiene. One of the triazole products was tethered to a fluorophore, thus enabling the direct fluorescent labeling of a model protein.
DNA-damage response during mitosis induces whole-chromosome missegregation.
Bakhoum, Samuel F; Kabeche, Lilian; Murnane, John P; Zaki, Bassem I; Compton, Duane A
2014-11-01
Many cancers display both structural (s-CIN) and numerical (w-CIN) chromosomal instabilities. Defective chromosome segregation during mitosis has been shown to cause DNA damage that induces structural rearrangements of chromosomes (s-CIN). In contrast, whether DNA damage can disrupt mitotic processes to generate whole chromosomal instability (w-CIN) is unknown. Here, we show that activation of the DNA-damage response (DDR) during mitosis selectively stabilizes kinetochore-microtubule (k-MT) attachments to chromosomes through Aurora-A and PLK1 kinases, thereby increasing the frequency of lagging chromosomes during anaphase. Inhibition of DDR proteins, ATM or CHK2, abolishes the effect of DNA damage on k-MTs and chromosome segregation, whereas activation of the DDR in the absence of DNA damage is sufficient to induce chromosome segregation errors. Finally, inhibiting the DDR during mitosis in cancer cells with persistent DNA damage suppresses inherent chromosome segregation defects. Thus, the DDR during mitosis inappropriately stabilizes k-MTs, creating a link between s-CIN and w-CIN. The genome-protective role of the DDR depends on its ability to delay cell division until damaged DNA can be fully repaired. Here, we show that when DNA damage is induced during mitosis, the DDR unexpectedly induces errors in the segregation of entire chromosomes, thus linking structural and numerical chromosomal instabilities. ©2014 American Association for Cancer Research.
Activation of DNA damage repair pathways by murine polyomavirus
Energy Technology Data Exchange (ETDEWEB)
Heiser, Katie; Nicholas, Catherine; Garcea, Robert L., E-mail: Robert.Garcea@Colorado.edu
2016-10-15
Nuclear replication of DNA viruses activates DNA damage repair (DDR) pathways, which are thought to detect and inhibit viral replication. However, many DNA viruses also depend on these pathways in order to optimally replicate their genomes. We investigated the relationship between murine polyomavirus (MuPyV) and components of DDR signaling pathways including CHK1, CHK2, H2AX, ATR, and DNAPK. We found that recruitment and retention of DDR proteins at viral replication centers was independent of H2AX, as well as the viral small and middle T-antigens. Additionally, infectious virus production required ATR kinase activity, but was independent of CHK1, CHK2, or DNAPK signaling. ATR inhibition did not reduce the total amount of viral DNA accumulated, but affected the amount of virus produced, indicating a defect in virus assembly. These results suggest that MuPyV may utilize a subset of DDR proteins or non-canonical DDR signaling pathways in order to efficiently replicate and assemble. -- Highlights: •Murine polyomavirus activates and recruits DNA damage repair (DDR) proteins to replication centers. •Large T-antigen mediates recruitment of DDR proteins to viral replication centers. •Inhibition or knockout of CHK1, CHK2, DNA-PK or H2AX do not affect viral titers. •Inhibition of ATR activity reduces viral titers, but not viral DNA accumulation.
14 CFR Appendix B to Part 150 - Noise Compatibility Programs
2010-01-01
...) The implementation of any restriction on the use of airport by any type or class of aircraft based on... purpose. (a) This appendix prescribes the content and the methods for developing noise compatibility... identify existing and future noncompatible land uses, based on airport operation and off-airport land uses...
Characterization of a prototype MR-compatible Delta4 QA-system in a 1.5 tesla MR-linac
de Vries, Wilfred J H; Seravalli, Enrica; Houweling, Anette; Woodings, Simon J; van Rooij, Rob; Wolthaus, Jochem W H; Lagendijk, JJW; Raaymakers, Bas W
2018-01-01
To perform patient plan-quality assurance (QA) on the newly installed MR-Linac (MRL) there was a need for having an MR-compatible QA-device. An MR compatible device (MR-Delta4) was developed together with Scandidos AB (Uppsala, Sweden). The basic characteristics of the detector response
Compatible ionic liquid-cellulases system for hydrolysis of lignocellulosic biomass.
Wang, Ying; Radosevich, Mark; Hayes, Douglas; Labbé, Nicole
2011-05-01
Ionic liquids (ILs) have been increasingly recognized as novel solvents for dissolution and pretreatment of cellulose. However, cellulases are inactivated in the presence of ILs, even when present at low concentrations. To more fully exploit the benefits of ILs it is critical to develop a compatible IL-cellulases system in which the IL is able to effectively solubilize and activate the lignocellulosic biomass, and the cellulases possess high stability and activity. In this study, we investigated the stability and activity of a commercially available cellulases mixture in the presence of different concentrations of 1-ethyl-3-methylimidazolium acetate ([Emim][OAc]). A mixture of cellulases and β-glucosidase (Celluclast1.5L, from Trichoderma reesei, and Novozyme188, from Aspergillus niger, respectively) retained 77% and 65% of its original activity after being pre-incubated in 15% and 20% (w/v) IL solutions, respectively, at 50°C for 3 h. The cellulases mixture also retained high activity in 15% [Emim][OAc] to hydrolyze Avicel, a model substrate for cellulose analysis, with conversion efficiency of approximately 91%. Notably, the presence of different amounts of yellow poplar lignin did not interfere significantly with the enzymatic hydrolysis of Avicel. Using this IL-cellulase system (15% [Emim][OAc]), the saccharification of yellow poplar biomass was also significantly improved (33%) compared to the untreated control (3%) during the first hour of enzymatic hydrolysis. Together, these findings provide compelling evidence that [Emim][OAc] was compatible with the cellulase mixture, and this compatible IL-cellulases system is promising for efficient activation and hydrolysis of native biomass to produce biofuels and co-products from the individual biomass components. Copyright © 2010 Wiley Periodicals, Inc.
Investigation of Drug–Polymer Compatibility Using Chemometric-Assisted UV-Spectrophotometry
Directory of Open Access Journals (Sweden)
Amir Ibrahim Mohamed
2017-01-01
Full Text Available A simple chemometric-assisted UV-spectrophotometric method was used to study the compatibility of clindamycin hydrochloride (HC1 with two commonly used natural controlled-release polymers, alginate (Ag and chitosan (Ch. Standard mixtures containing 1:1, 1:2, and 1:0.5 w/w drug–polymer ratios were prepared and UV scanned. A calibration model was developed with partial least square (PLS regression analysis for each polymer separately. Then, test mixtures containing 1:1 w/w drug–polymer ratios with different sets of drug concentrations were prepared. These were UV scanned initially and after three and seven days of storage at 25 °C. Using the calibration model, the drug recovery percent was estimated and a decrease in concentration of 10% or more from initial concentration was considered to indicate instability. PLS models with PC3 (for Ag and PC2 (for Ch showed a good correlation between actual and found values with root mean square error of cross validation (RMSECV of 0.00284 and 0.01228, and calibration coefficient (R2 values of 0.996 and 0.942, respectively. The average drug recovery percent after three and seven days was 98.1 ± 2.9 and 95.4 ± 4.0 (for Ag, and 97.3 ± 2.1 and 91.4 ± 3.8 (for Ch, which suggests more drug compatibility with an Ag than a Ch polymer. Conventional techniques including DSC, XRD, FTIR, and in vitro minimum inhibitory concentration (MIC for (1:1 drug–polymer mixtures were also performed to confirm clindamycin compatibility with Ag and Ch polymers.
Compatible-strain mixed finite element methods for incompressible nonlinear elasticity
Faghih Shojaei, Mostafa; Yavari, Arash
2018-05-01
We introduce a new family of mixed finite elements for incompressible nonlinear elasticity - compatible-strain mixed finite element methods (CSFEMs). Based on a Hu-Washizu-type functional, we write a four-field mixed formulation with the displacement, the displacement gradient, the first Piola-Kirchhoff stress, and a pressure-like field as the four independent unknowns. Using the Hilbert complexes of nonlinear elasticity, which describe the kinematics and the kinetics of motion, we identify the solution spaces of the independent unknown fields. In particular, we define the displacement in H1, the displacement gradient in H (curl), the stress in H (div), and the pressure field in L2. The test spaces of the mixed formulations are chosen to be the same as the corresponding solution spaces. Next, in a conforming setting, we approximate the solution and the test spaces with some piecewise polynomial subspaces of them. Among these approximation spaces are the tensorial analogues of the Nédélec and Raviart-Thomas finite element spaces of vector fields. This approach results in compatible-strain mixed finite element methods that satisfy both the Hadamard compatibility condition and the continuity of traction at the discrete level independently of the refinement level of the mesh. By considering several numerical examples, we demonstrate that CSFEMs have a good performance for bending problems and for bodies with complex geometries. CSFEMs are capable of capturing very large strains and accurately approximating stress and pressure fields. Using CSFEMs, we do not observe any numerical artifacts, e.g., checkerboarding of pressure, hourglass instability, or locking in our numerical examples. Moreover, CSFEMs provide an efficient framework for modeling heterogeneous solids.
Compatibility of dip-coated Er2O3 coating by MOD method with liquid Li
International Nuclear Information System (INIS)
Zhang Dongxun; Kondo, Masatoshi; Tanaka, Teruya; Muroga, Takeo; Valentyn, Tsisar
2011-01-01
An electrical insulating ceramic coating on the self-cooled lithium blanket is a promising technology for suppressing MHD pressure drop in the blanket system. Er 2 O 3 is thought to be one of the potential candidate materials for ceramic coatings because of their high electrical resistivity and high compatibility with liquid lithium. In this study, Er 2 O 3 coating was fabricated on the ferritic steels by dip-coating method with MOD (metal organic decomposition) liquid precursor followed by baking in different atmosphere. The coated specimens were immersed at 500 o C in the static liquid lithium to test the compatibility. It was shown that the compatibility of the coating was degraded when Fe 2 O 3 or Fe 3 O 4 was formed as the main composition of the substrate oxidation layer during the baking. On the other hand, thin Cr 2 O 3 layer in the substrate oxidation layer did not influence the stability of Er 2 O 3 coating. Atmosphere controlling for suppressing the substrate oxidation, especially Fe 2 O 3 or Fe 3 O 4 , during the baking is shown to be essential for the compatibility of MOD Er 2 O 3 coating on ferritic steels.
Assessing the MR compatibility of dental retainer wires at 7 Tesla.
Wezel, Joep; Kooij, Bert Jan; Webb, Andrew G
2014-10-01
To determine the MR compatibility of common dental retainer wires at 7 Tesla in terms of potential RF heating and magnetic susceptibility effects. Electromagnetic simulations and experimental results were compared for dental retainer wires placed in tissue-mimicking phantoms. Simulations were then performed for a human model with wire in place. Finally, image quality was assessed for different scanning protocols and wires. Simulations and experimental data in phantoms agreed well, with the length of the wire correlating to maximum heating in phantoms being approximately 47 mm. Even in this case, no substantial heating occurs when scanning within the specific absorption rate (SAR) guidelines for the head. Image distortions from the most ferromagnetic dental wire were not significant for any brain region. Dental retainer wires appear to be MR compatible at 7 Tesla. Copyright © 2013 Wiley Periodicals, Inc.
Compatibility of hydroxypropyl-β-cyclodextrin with algal toxicity bioassays
International Nuclear Information System (INIS)
Fai, Patricia Bi; Grant, Alastair; Reid, Brian J.
2009-01-01
Numerous reports have indicated that hydrophobic organic compound bioaccessibility in sediment and soil can be determined by extraction using aqueous hydroxypropyl-β-cyclodextrin (HPCD) solutions. This study establishes the compatibility of HPCD with Selenastrum capricornutum and assesses whether its presence influences the toxicity of reference toxicants. Algal growth inhibition (72 h) showed no significant (P > 0.05) difference at HPCD concentrations up to and including 20 mM. HPCD presence did not influence the toxicity of the inorganic reference toxicant (ZnSO 4 ), with IC50 values of 0.82 μM and 0.85 μM, in the presence and absence of HPCD (20 mM), respectively. However, HPCD presence (20 mM) reduced the toxicity of 2,4-dichlorophenol and the herbicides diuron and isoproturon. These reductions were attributed to inclusion complex formation between the toxicants and the HPCD cavity. Liberation of complexed toxicants, by sample manipulation prior to toxicity assessment, is proposed to provide a sensitive, high throughput, bioassay that reflects compound bioaccessibility. - Compatibility of the biomimetic HPCD extraction method with algal cell growth inhibition bioassays to assess toxicity of reference toxicants and environmental relevant herbicides
Compatibility of hydroxypropyl-{beta}-cyclodextrin with algal toxicity bioassays
Energy Technology Data Exchange (ETDEWEB)
Fai, Patricia Bi; Grant, Alastair [School of Environmental Sciences, University of East Anglia, Norwich NR4 7TJ (United Kingdom); Reid, Brian J. [School of Environmental Sciences, University of East Anglia, Norwich NR4 7TJ (United Kingdom)], E-mail: b.reid@uea.ac.uk
2009-01-15
Numerous reports have indicated that hydrophobic organic compound bioaccessibility in sediment and soil can be determined by extraction using aqueous hydroxypropyl-{beta}-cyclodextrin (HPCD) solutions. This study establishes the compatibility of HPCD with Selenastrum capricornutum and assesses whether its presence influences the toxicity of reference toxicants. Algal growth inhibition (72 h) showed no significant (P > 0.05) difference at HPCD concentrations up to and including 20 mM. HPCD presence did not influence the toxicity of the inorganic reference toxicant (ZnSO{sub 4}), with IC50 values of 0.82 {mu}M and 0.85 {mu}M, in the presence and absence of HPCD (20 mM), respectively. However, HPCD presence (20 mM) reduced the toxicity of 2,4-dichlorophenol and the herbicides diuron and isoproturon. These reductions were attributed to inclusion complex formation between the toxicants and the HPCD cavity. Liberation of complexed toxicants, by sample manipulation prior to toxicity assessment, is proposed to provide a sensitive, high throughput, bioassay that reflects compound bioaccessibility. - Compatibility of the biomimetic HPCD extraction method with algal cell growth inhibition bioassays to assess toxicity of reference toxicants and environmental relevant herbicides.
A Highest Order Hypothesis Compatibility Test for Monocular SLAM
Directory of Open Access Journals (Sweden)
Edmundo Guerra
2013-08-01
Full Text Available Simultaneous Location and Mapping (SLAM is a key problem to solve in order to build truly autonomous mobile robots. SLAM with a unique camera, or monocular SLAM, is probably one of the most complex SLAM variants, based entirely on a bearing-only sensor working over six DOF. The monocular SLAM method developed in this work is based on the Delayed Inverse-Depth (DI-D Feature Initialization, with the contribution of a new data association batch validation technique, the Highest Order Hypothesis Compatibility Test, HOHCT. The Delayed Inverse-Depth technique is used to initialize new features in the system and defines a single hypothesis for the initial depth of features with the use of a stochastic technique of triangulation. The introduced HOHCT method is based on the evaluation of statistically compatible hypotheses and a search algorithm designed to exploit the strengths of the Delayed Inverse-Depth technique to achieve good performance results. This work presents the HOHCT with a detailed formulation of the monocular DI-D SLAM problem. The performance of the proposed HOHCT is validated with experimental results, in both indoor and outdoor environments, while its costs are compared with other popular approaches.
Role of microRNA-199a-5p and discoidin domain receptor 1 in human hepatocellular carcinoma invasion
Directory of Open Access Journals (Sweden)
Shen Qingli
2010-08-01
Full Text Available Abstract Background Micro-ribonucleic acid (miRNA-199a-5p has been reported to be decreased in hepatocellular carcinoma (HCC compared to normal tissue. Discoidin domain receptor-1 (DDR1 tyrosine kinase, involved in cell invasion-related signaling pathway, was predicted to be a potential target of miR-199a-5p by the use of miRNA target prediction algorithms. The aim of this study was to investigate the role of miR-199a-5p and DDR1 in HCC invasion. Methods Mature miR-199a-5p and DDR1 expression were evaluated in tumor and adjacent non-tumor liver tissues from 23 patients with HCC undergoing liver resection and five hepatoma cell lines by the use of real-time quantitative RT-PCR (qRT-PCR analysis. The effect of aberrant miR-199a-5p expression on cell invasion was assessed in vitro using HepG2 and SNU-182 hepatoma cell lines. Luciferase reporter assay was employed to validate DDR1 as a putative miR-199a-5p target gene. Regulation of DDR1 expression by miR-199a-5p was assessed by the use qRT-PCR and western blotting analysis. Results A significant down-regulation of miR-199a-5p was observed in 65.2% of HCC tissues and in four of five cell lines. In contrast, DDR1 expression was significantly increased in 52.2% of HCC samples and in two of five cell lines. Increased DDR1 expression in HCC was associated with advanced tumor stage. DDR1 was shown to be a direct target of miR-199a-5p by luciferase reporter assay. Transfection of miR-199a-5p inhibited invasion of HepG2 but not SNU-182 hepatoma cells. Conclusions Decreased expression of miR-199a-5p contributes to increased cell invasion by functional deregulation of DDR1 activity in HCC. However, the effect of miR-199a-5p on DDR1 varies among individuals and hepatoma cell lines. These findings may have significant translational relevance for development of new targeted therapies as well as prognostic prediction for patients with HCC.
A safety-critical java technology compatibility kit
DEFF Research Database (Denmark)
Søndergaard, Hans; Korsholm, Stephan E.; Ravn, Anders Peter
2014-01-01
In order to claim conformance with a given Java Specification Request (JSR), a Java implementation has to pass all tests in an associated Technology Compatibility Kit (TCK). This paper presents development of test cases and tools for the draft Safety-Critical Java (SCJ) specification. In previous...... work we have shown how the Java Modeling Language (JML) is applied to specify conformance constraints for SCJ, and how JML-related tools may assist in generating and executing tests. Here we extend this work with a layout for concrete test cases including checking of results in a simplified version...
Martensitic textures: Multiscale consequences of elastic compatibility
International Nuclear Information System (INIS)
Shenoy, S.R.; Lookman, T.; Saxena, A.; Bishop, A.R.
2001-03-01
We show that a free energy entirely in the order-parameter strain variable(s), rather than the displacement field, provides a unified understanding of martensitic textures. We use compatibility equations, linking the strain tensor components in the bulk and at interfaces, that induce anisotropic order-parameter strain interactions. These two long-range bulk/interface potentials, together with local compositional fluctuations, drive the formation of global elastic textures. Relaxational simulations show the spontaneous formation (and evolution under stress/temperature quenches) of equal width parallel twins, branched twins, and tweed, including characteristic scaling of twin width with twin length. (author)
Testing quantum contextuality. The problem of compatibility
International Nuclear Information System (INIS)
Szangolies, Jochen
2015-01-01
Jochen Szangolies contributes a novel way of dealing with the problem of the experimental testability of the Kochen-Specker theorem posed by realistic, that is, noisy, measurements. Such noise spoils perfect compatibility between successive measurements, which however is a necessary requirement to test the notion of contextuality in usual approaches. To overcome this difficulty, a new, extended notion of contextuality that reduces to Kochen-Specker contextuality in the limit of perfect measurement implementations is proposed by the author, together with a scheme to test this notion experimentally. Furthermore, the behaviour of these tests under realistic noise conditions is investigated.
The DNA damage response during mitosis.
Heijink, Anne Margriet; Krajewska, Małgorzata; van Vugt, Marcel A T M
2013-10-01
Cells are equipped with a cell-intrinsic signaling network called the DNA damage response (DDR). This signaling network recognizes DNA lesions and initiates various downstream pathways to coordinate a cell cycle arrest with the repair of the damaged DNA. Alternatively, the DDR can mediate clearance of affected cells that are beyond repair through apoptosis or senescence. The DDR can be activated in response to DNA damage throughout the cell cycle, although the extent of DDR signaling is different in each cell cycle phase. Especially in response to DNA double strand breaks, only a very marginal response was observed during mitosis. Early on it was recognized that cells which are irradiated during mitosis continued division without repairing broken chromosomes. Although these initial observations indicated diminished DNA repair and lack of an acute DNA damage-induced cell cycle arrest, insight into the mechanistic re-wiring of DDR signaling during mitosis was only recently provided. Different mechanisms appear to be at play to inactivate specific signaling axes of the DDR network in mitosis. Importantly, mitotic cells not simply inactivate the entire DDR, but appear to mark their DNA damage for repair after mitotic exit. Since the treatment of cancer frequently involves agents that induce DNA damage as well as agents that block mitotic progression, it is clinically relevant to obtain a better understanding of how cancer cells deal with DNA damage during interphase versus mitosis. In this review, the molecular details concerning DDR signaling during mitosis as well as the consequences of encountering DNA damage during mitosis for cellular fate are discussed. Copyright © 2013 Elsevier B.V. All rights reserved.
The nucleosome: orchestrating DNA damage signaling and repair within chromatin.
Agarwal, Poonam; Miller, Kyle M
2016-10-01
DNA damage occurs within the chromatin environment, which ultimately participates in regulating DNA damage response (DDR) pathways and repair of the lesion. DNA damage activates a cascade of signaling events that extensively modulates chromatin structure and organization to coordinate DDR factor recruitment to the break and repair, whilst also promoting the maintenance of normal chromatin functions within the damaged region. For example, DDR pathways must avoid conflicts between other DNA-based processes that function within the context of chromatin, including transcription and replication. The molecular mechanisms governing the recognition, target specificity, and recruitment of DDR factors and enzymes to the fundamental repeating unit of chromatin, i.e., the nucleosome, are poorly understood. Here we present our current view of how chromatin recognition by DDR factors is achieved at the level of the nucleosome. Emerging evidence suggests that the nucleosome surface, including the nucleosome acidic patch, promotes the binding and activity of several DNA damage factors on chromatin. Thus, in addition to interactions with damaged DNA and histone modifications, nucleosome recognition by DDR factors plays a key role in orchestrating the requisite chromatin response to maintain both genome and epigenome integrity.
Compatibility Issues of IPSec and TCP in Wireless Networks
Institute of Scientific and Technical Information of China (English)
ZHAO Hai-yang; XIN Yang
2004-01-01
Due to the problems arising when the Transmission Control Protocol (TCP) is applied over wireless networks, many TCP performance enhancement mechanisms have been proposed. However, such mechanisms aren't compatible with IPSec protocol. The paper reviews the TCP performance enhancement mechanisms in wireless networks. Then the conflicts between them are analyzed. Several proposals for solving theconflicts are discussed, and their benefit and limitations are examined.
DNA Damage Response and Immune Defence: Links and Mechanisms
Directory of Open Access Journals (Sweden)
Björn Schumacher
2016-08-01
Full Text Available DNA damage plays a causal role in numerous human pathologies including cancer, premature aging and chronic inflammatory conditions. In response to genotoxic insults, the DNA damage response (DDR orchestrates DNA damage checkpoint activation and facilitates the removal of DNA lesions. The DDR can also arouse the immune system by for example inducing the expression of antimicrobial peptides as well as ligands for receptors found on immune cells. The activation of immune signalling is triggered by different components of the DDR including DNA damage sensors, transducer kinases, and effectors. In this review, we describe recent advances on the understanding of the role of DDR in activating immune signalling. We highlight evidence gained into (i which molecular and cellular pathways of DDR activate immune signalling, (ii how DNA damage drives chronic inflammation, and (iii how chronic inflammation causes DNA damage and pathology in humans.
Compatible biological and chemical control systems for Rhizoctonia solani in potato
Boogert, van den P.H.J.F.; Luttikholt, A.J.G.
2004-01-01
A series of chemical and biological control agents were tested for compatibility with the Rhizoctonia-specific biocontrol fungus Verticillium biguttatum aimed at designing novel control strategies for black scurf (Rhizoctonia solani) and other tuber diseases in potato. The efficacy of chemicals,
Behavior equivalence and compatibility of business process models with complex correspondences
Weidlich, M.; Dijkman, R.M.; Weske, M.H.
2012-01-01
Once multiple models of a business process are created for different purposes or to capture different variants, verification of behaviour equivalence or compatibility is needed. Equivalence verification ensures that two business process models specify the same behaviour. Since different process
DEFF Research Database (Denmark)
Gyetvai, Gabor; Sønderkær, Mads; Göbel, Ulrike
2012-01-01
of the compatible and incompatible interaction were captured by DeepSAGE analysis of 44 biological samples comprising five genotypes, differing only by the presence or absence of the R1 transgene, three infection time points and three biological replicates. 30.859 unique 21 base pair sequence tags were obtained......Late blight, caused by the oomycete Phytophthora infestans, is the most important disease of potato (Solanum tuberosum). Understanding the molecular basis of resistance and susceptibility to late blight is therefore highly relevant for developing resistant cultivars, either by marker...... interactions over the infection time course and between compatible and incompatible genotypes. Transcriptional changes were more numerous in compatible than in incompatible interactions. In contrast to incompatible interactions, transcriptional changes in the compatible interaction were observed predominantly...
Characterization of materials for waste-canister compatibility studies
International Nuclear Information System (INIS)
McCoy, H.E.; Mack, J.E.
1981-10-01
Sample materials of 7 waste forms and 15 potential canister materials were procured for compatibility tests. These materials were characterized before being placed in test, and the results are the main topic of this report. A test capsule was designed for the tests in which disks of a single waste form were contacted with duplicate samples of canister materials. The capsules are undergoing short-term tests at 800 0 C and long-term tests at 100 and 300 0 C
DIFFERENTIAL IMPACT OF HLA-A, HLA-B AND HLA-DR COMPATIBILITY ON THE RENAL ALLOGRAFT SURVIVAL
Directory of Open Access Journals (Sweden)
V. Y. Abramov
2012-01-01
Full Text Available We studied the long-term results of 532 deceased donor kidney transplantations to investigate the impact of HLA match on the survival of renal allograft. All transplants were performed in our center in 1996–2009 and moni- tored prospectively for 1–14 years. We found, the survival of 58 kidneys grafted with 0–2 mismatch for HLA- ABDR to be significantly better (Plogrank = 0,016 than the survival of the kidneys grafted with 3–6 HLA-ABDR mismatch. The full compatibility for HLA-A (n = 75 did not influence the long-term survival (Plogrank = 0,48. The absence of HLA-DR mismatch had a beneficial effect for survival of 68 kidneys (Plogrank = 0,07. Eighteen cases with the full HLA-B compatibility between graft and recipient demonstrated excellent long-term survival (Plogrank = 0,007. HLA-B compatibility influenced significantly (P = 0,042 the survival of transplanted kidney in the Cox regression model adjusted for donor and recipient age, panel-reactive antibody level, re-transplant, and immunosuppression protocol. The data obtained support the conclusion, that HLA compatibility should be one of the criteria of deceased donor kidney allocation.
Olayan, Rawan S.
2017-12-01
Computational drug repurposing aims at finding new medical uses for existing drugs. The identification of novel drug-target interactions (DTIs) can be a useful part of such a task. Computational determination of DTIs is a convenient strategy for systematic screening of a large number of drugs in the attempt to identify new DTIs at low cost and with reasonable accuracy. This necessitates development of accurate computational methods that can help focus on the follow-up experimental validation on a smaller number of highly likely targets for a drug. Although many methods have been proposed for computational DTI prediction, they suffer the high false positive prediction rate or they do not predict the effect that drugs exert on targets in DTIs. In this report, first, we present a comprehensive review of the recent progress in the field of DTI prediction from data-centric and algorithm-centric perspectives. The aim is to provide a comprehensive review of computational methods for identifying DTIs, which could help in constructing more reliable methods. Then, we present DDR, an efficient method to predict the existence of DTIs. DDR achieves significantly more accurate results compared to the other state-of-theart methods. As supported by independent evidences, we verified as correct 22 out of the top 25 DDR DTIs predictions. This validation proves the practical utility of DDR, suggesting that DDR can be used as an efficient method to identify 5 correct DTIs. Finally, we present DDR-FE method that predicts the effect types of a drug on its target. On different representative datasets, under various test setups, and using different performance measures, we show that DDR-FE achieves extremely good performance. Using blind test data, we verified as correct 2,300 out of 3,076 DTIs effects predicted by DDR-FE. This suggests that DDR-FE can be used as an efficient method to identify correct effects of a drug on its target.
Shin, Yun Kyoung; Cho, Yang Seok; Lien, Mei-Ching; Proctor, Robert W
2007-09-01
It has been argued that the psychological refractory period (PRP) effect is eliminated with two ideomotor compatible tasks when instructions stress fast and simultaneous responding. Three experiments were conducted to test this hypothesis. In all experiments, Task 1 required spatially compatible manual responses (left or right) to the direction of an arrow, and Task 2 required saying the name of the auditory letter A or B. In Experiments 1 and 3, the manual responses were keypresses made with the left and right hands, whereas in Experiment 2 they were left-right toggle-switch movements made with the dominant hand. Instructions that stressed response speed reduced reaction time and increased error rate compared to standard instructions to respond fast and accurately, but did not eliminate the PRP effect on Task 2 reaction time. These results imply that, even when response speed is emphasized, ideomotor compatible tasks do not bypass response selection.
Individual Preference Rankings Compatible with Prices, Income Distributions and Total Resources
DEFF Research Database (Denmark)
Balasko, Yves; Tvede, Mich
We consider the problem of determining the individual preference rankings that are necessarily implied by a dataset consisting of prices, income distributions and total resources. We show the equivalence between the compatibility with individual preference rankings and the existence of a solution...
Kampen, L.T. van
2000-01-01
In this study, compatibility is defined as the capability of vehicles to protect both their own occupants and occupants of opponent vehicles during crashes. Vehicles are called compatible when they offer equal amounts of protection to both their own occupants and to occupants of crash-opponent
Highly efficient and compatible shampoo for use after hair transplant.
Schweiger, Dorothea; Schoelermann, Andrea M; Filbry, Alexander; Hamann, Tina; Moser, Claudia; Rippke, Frank
2015-01-01
Sensitive or hyperreactive skin is a common condition defined by prickling, burning, pain, and pruritus. Although this skin problem was initially described on the face, the scalp is often affected. A sensitive scalp can react with irritation to harsh surfactants or other additives which are often present in shampoos. For this reason, we developed a new rinse-off hypertolerant shampoo specifically designed for the hypersensitive and problematic scalp. The shampoo formulation is based on an extremely mild surfactant system and contains bisabolol, an anti-irritant and anti-inflammatory ingredient of chamomile. The shampoo is free of additives such as perfumes, silicones, colorants, parabens, paraffins, and betaine. Since skin can remain in a hyperreactive state after wounding, the status after hair transplantation was chosen as a model system to test the shampoo. Scalp condition and compatibility of each volunteer were analyzed by a plastic surgeon directly after hair transplant and after stitch removal. The plastic surgeons also rated whether they would recommend the further use of the test shampoo. Additionally, volunteers completed a self-assessment questionnaire. Following hair transplantation, regular use of the shampoo resulted in a significant reduction in the extent of scabbing and erythema. This was confirmed by dermatological scalp examinations performed by the plastic surgeon as well as in volunteers' self-assessments. The plastic surgeon highly recommended the further use of the test shampoo after hair transplant to all study participants. Application of the test shampoo demonstrated excellent skin compatibility and product efficacy after hair transplant. The test shampoo significantly reduced the extent of scabs and erythema. Therefore, the shampoo is ideally suited for use after hair transplantation and for the treatment of sensitive scalp. The excellent skin compatibility is because of the mild surfactant system, the calming ingredient bisabolol, and
Evolved Cas9 variants with broad PAM compatibility and high DNA specificity.
Hu, Johnny H; Miller, Shannon M; Geurts, Maarten H; Tang, Weixin; Chen, Liwei; Sun, Ning; Zeina, Christina M; Gao, Xue; Rees, Holly A; Lin, Zhi; Liu, David R
2018-04-05
A key limitation of the use of the CRISPR-Cas9 system for genome editing and other applications is the requirement that a protospacer adjacent motif (PAM) be present at the target site. For the most commonly used Cas9 from Streptococcus pyogenes (SpCas9), the required PAM sequence is NGG. No natural or engineered Cas9 variants that have been shown to function efficiently in mammalian cells offer a PAM less restrictive than NGG. Here we use phage-assisted continuous evolution to evolve an expanded PAM SpCas9 variant (xCas9) that can recognize a broad range of PAM sequences including NG, GAA and GAT. The PAM compatibility of xCas9 is the broadest reported, to our knowledge, among Cas9 proteins that are active in mammalian cells, and supports applications in human cells including targeted transcriptional activation, nuclease-mediated gene disruption, and cytidine and adenine base editing. Notably, despite its broadened PAM compatibility, xCas9 has much greater DNA specificity than SpCas9, with substantially lower genome-wide off-target activity at all NGG target sites tested, as well as minimal off-target activity when targeting genomic sites with non-NGG PAMs. These findings expand the DNA targeting scope of CRISPR systems and establish that there is no necessary trade-off between Cas9 editing efficiency, PAM compatibility and DNA specificity.
Directory of Open Access Journals (Sweden)
Olga Alster
Full Text Available Nibrin plays an important role in the DNA damage response (DDR and DNA repair. DDR is a crucial signaling pathway in apoptosis and senescence. To verify whether truncated nibrin (p70, causing Nijmegen Breakage Syndrome (NBS, is involved in DDR and cell fate upon DNA damage, we used two (S4 and S3R spontaneously immortalized T cell lines from NBS patients, with the founding mutation and a control cell line (L5. S4 and S3R cells have the same level of p70 nibrin, however p70 from S4 cells was able to form more complexes with ATM and BRCA1. Doxorubicin-induced DDR followed by cell senescence could only be observed in L5 and S4 cells, but not in the S3R ones. Furthermore the S3R cells only underwent cell death, but not senescence after doxorubicin treatment. In contrary to doxorubicin treatment, cells from all three cell lines were able to activate the DDR pathway after being exposed to γ-radiation. Downregulation of nibrin in normal human vascular smooth muscle cells (VSMCs did not prevent the activation of DDR and induction of senescence. Our results indicate that a substantially reduced level of nibrin or its truncated p70 form is sufficient to induce DNA-damage dependent senescence in VSMCs and S4 cells, respectively. In doxorubicin-treated S3R cells DDR activation was severely impaired, thus preventing the induction of senescence.
IDENTIFICATION OF WIDE COMPATIBILITY VARIETIES IN SOME TROPICAL JAPONICA RICE
Directory of Open Access Journals (Sweden)
A. Hairmansis
2013-07-01
Full Text Available The F1 hybrid sterility in indica/japonica crosses is the major barrier in developing hybrid rice varieties between these two diverse germplasm. The sterility problem in japonica/indica hybrids can be overcome by using wide compatibility genes. The objective of this study was to identify wide compatibility varieties (WCVs in some tropical japonica rice. Twenty five tropical japonica varieties as male parents were crossed with indica (IR64 and japonica (Akitakomachi testers as female parents. The crosses were planted following a randomized complete block design with three replications. Varieties having average spikelet fertility of more than 70% with both the indica and japonica testers were rated as WCVs. Result from this study showed that six tropical japonica varieties were classified as WCVs, i.e., Cabacu, Grogol, Kencana Bali, Klemas, Lampung Lawer, and Napa. Hybrid sterility is caused by partial sterility of male and female gametes. The WCVs from the present study can be used in hybrid rice breeding program to solve hybrid sterility in indica/japonica hybrids.
The Compatibility between Cause and Effect According to the Theologies Suggested by Sadra and TafkῙk
Directory of Open Access Journals (Sweden)
MohammadMahdi Meshkati
2015-03-01
Full Text Available The question of why different events have occurred has always been in human being's mind and challenged his curiosity. The question word "why" is used to ask about the cause of a phenomenon,and if man was not aware of the law of causality and did not confirm that every phenomenon needed a cause, he could not imagine any questions with "why". About this law and its related subjects such as compatibility between cause and effect, many schools and theories have emerged, among which, the schools of TafkῙk(Segregation and MulāṢadrāare of special importance. The proponents of TafkῙk believe in the segregation of philosophical – theosophical instructions and religious contents. They reject many of the principles of philosophy by referring to Quran and Hadiths and conclude that philosophy is in contradiction with Quranic teachings. The school of MulāṢadrā however, has a comprehensive view and incudes as its principles all teachings gained from wisdom, texts, theosophy and reasoning. One of the controversial issues discussed by both schools is the subject of compatibility between cause and effect. It is obvious that every effect does not stem from any cause and even there is not always causal relation between concurrent and subsequent phenomena, rather the causality exists only between specific beings. In other words, there must be specialcongruencybetween cause and effect which is referred to as compatibility between cause and effect. Since cause is what brings about the existence of effect and gives it reality, then it itself should possess the existence which it gives to the effect. When one object lacks something, it cannot give it to the other. Because by giving existence to the effect, the existence of cause will not be negated, it becomes clear that cause possesses the existence in a perfect way so that the existence of effect is regarded as a beam of light radiated from cause. The scholars of the school of TafkῙkhowever, believe
Surface Modification of Biomaterials: A Quest for Blood Compatibility
de Mel, Achala; Cousins, Brian G.; Seifalian, Alexander M.
2012-01-01
Cardiovascular implants must resist thrombosis and intimal hyperplasia to maintain patency. These implants when in contact with blood face a challenge to oppose the natural coagulation process that becomes activated. Surface protein adsorption and their relevant 3D confirmation greatly determine the degree of blood compatibility. A great deal of research efforts are attributed towards realising such a surface, which comprise of a range of methods on surface modification. Surface modification ...
Stephan, Denise Nadine; Koch, Iring
2016-11-01
The present study was aimed at examining modality-specific influences in task switching. To this end, participants switched either between modality compatible tasks (auditory-vocal and visual-manual) or incompatible spatial discrimination tasks (auditory-manual and visual-vocal). In addition, auditory and visual stimuli were presented simultaneously (i.e., bimodally) in each trial, so that selective attention was required to process the task-relevant stimulus. The inclusion of bimodal stimuli enabled us to assess congruence effects as a converging measure of increased between-task interference. The tasks followed a pre-instructed sequence of double alternations (AABB), so that no explicit task cues were required. The results show that switching between two modality incompatible tasks increases both switch costs and congruence effects compared to switching between two modality compatible tasks. The finding of increased congruence effects in modality incompatible tasks supports our explanation in terms of ideomotor "backward" linkages between anticipated response effects and the stimuli that called for this response in the first place. According to this generalized ideomotor idea, the modality match between response effects and stimuli would prime selection of a response in the compatible modality. This priming would cause increased difficulties to ignore the competing stimulus and hence increases the congruence effect. Moreover, performance would be hindered when switching between modality incompatible tasks and facilitated when switching between modality compatible tasks.
Shikuma, Nicholas J; Davis, Kimberly R; Fong, Jiunn N C; Yildiz, Fitnat H
2013-05-01
Vibrio cholerae inhabits aquatic environments and colonizes the human digestive tract to cause the disease cholera. In these environments, V. cholerae copes with fluctuations in salinity and osmolarity by producing and transporting small, organic, highly soluble molecules called compatible solutes, which counteract extracellular osmotic pressure. Currently, it is unclear how V. cholerae regulates the expression of genes important for the biosynthesis or transport of compatible solutes in response to changing salinity or osmolarity conditions. Through a genome-wide transcriptional analysis of the salinity response of V. cholerae, we identified a transcriptional regulator we name CosR for compatible solute regulator. The expression of cosR is regulated by ionic strength and not osmolarity. A transcriptome analysis of a ΔcosR mutant revealed that CosR represses genes involved in ectoine biosynthesis and compatible solute transport in a salinity-dependent manner. When grown in salinities similar to estuarine environments, CosR activates biofilm formation and represses motility independently of its function as an ectoine regulator. This is the first study to characterize a compatible solute regulator in V. cholerae and couples the regulation of osmotic tolerance with biofilm formation and motility. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.
Laser welding of polymers, compatibility and mechanical properties
DEFF Research Database (Denmark)
Nielsen, Steen Erik; Strange, Marianne; Kristensen, Jens Klæstrup
2013-01-01
for research and development. This paper presents some research results related to laser welding of various polymer materials, including weld compatibility investigations related to the joining of different polymers. Theory for bonding mechanisms, strength development, mechanical properties testing and other......Laser welding of polymers is today a commonly used industrial technology. It has shown obvious advantages compared to e.g. adhesive bonding in terms of higher productivity, better quality and easiness for automation. The ongoing development of lasers tailored for polymer welding in coordination...
Steganalysis based on JPEG compatibility
Fridrich, Jessica; Goljan, Miroslav; Du, Rui
2001-11-01
In this paper, we introduce a new forensic tool that can reliably detect modifications in digital images, such as distortion due to steganography and watermarking, in images that were originally stored in the JPEG format. The JPEG compression leave unique fingerprints and serves as a fragile watermark enabling us to detect changes as small as modifying the LSB of one randomly chosen pixel. The detection of changes is based on investigating the compatibility of 8x8 blocks of pixels with JPEG compression with a given quantization matrix. The proposed steganalytic method is applicable to virtually all steganongraphic and watermarking algorithms with the exception of those that embed message bits into the quantized JPEG DCT coefficients. The method can also be used to estimate the size of the secret message and identify the pixels that carry message bits. As a consequence of our steganalysis, we strongly recommend avoiding using images that have been originally stored in the JPEG format as cover-images for spatial-domain steganography.
Electro magnetic compatibility of cabling and wiring in buildings and installations
Steenstra, H.T.
2008-01-01
The thesis deals with the behaviour, with respect to EMC (Electro Magnetic Compatibility), of cabling and wiring in buildings and installations. Measurement and calculation methods are developed and applied to cabling in a large scale installation as well as to individual cables. Besides, the
Rethinking Disarmament, Demobilization and Reintegration Programs
Directory of Open Access Journals (Sweden)
Jairo Munive
2015-10-01
Full Text Available This article introduces the special issue on DDR and ‘Armed Non-Statutory Actors’ (ANSAs which we prefer to the less precise label of Armed Non-State Actors. The understanding that disarmament, demobilization and reintegration (DDR programs are essential in helping to prevent the recurrence of war in post-conflict situations is at the heart of current peacebuilding practice and the academic literature on peacekeeping and stabilization. But the changing strategic context of DDR programs and in particular the proliferation of ANSAs presents new challenges, the responses to which have been characterized as ‘second generation’ DDR. The changing context poses new questions and forces us to rethink assumptions and templates of DDR as the concept is blurred and expanded. The question is if it makes sense to hold on to the concept or whether the assumptions associated with it will get in the way of rethinking templates for violence reduction in the future.
Tank 241-AP-103 08/1999 Compatibility Grab Samples, Analytical Results for the Final Report
International Nuclear Information System (INIS)
BELL, K.E.
1999-01-01
This document is the format IV, final report for the tank 241-AP-103 (AP-103) grab samples taken in August 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-103 samples were performed as directed in ''Compatibility Grub Sampling and Analysis Plan for Fiscal Year 1999'' (Sasaki 1999a). Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. No notification limits were exceeded
Directory of Open Access Journals (Sweden)
Xiaorong eCheng
2015-11-01
Full Text Available A recent hierarchical model of numerical processing, initiated by Fischer and Brugger (2011 and Fisher (2012, suggested that situated factors, such as different body postures and body movements, can influence the magnitude representation and bias numerical processing. Indeed, Loetscher and colleagues (2008 found that participants’ behavior in a random number generation (RNG task was biased by head rotations. More small numbers were reported after leftward than rightward head turns, i.e. a motion–numerical compatibility effect. Here, by carrying out two experiments, we explored whether similar motion–numerical compatibility effects exist for movements of other important body components, e.g. arms, and for composite body movements as well, which are basis for complex human activities in many ecologically meaningful situations. In Experiment 1, a motion-numerical compatibility effect was observed for lateral rotations of two body components, i.e., the head and arms. Relatively large numbers were reported after making rightward compared to leftward movements for both lateral head and arm turns. The motion-numerical compatibility effect was observed again in Experiment 2 when participants were asked to perform composite body movements of congruent movement directions, e.g., simultaneous head left turns and arm left turns. However, it disappeared when the movement directions were incongruent, e.g., simultaneous head left turns and arm right turns. Taken together, our results extended Loetscher et al.'s (2008 finding by demonstrating that their effect is effector-general and exists for arm movements. Moreover, our study reveals for the first time that the impact of spatial information on numerical processing induced by each of the two sensorimotor-based situated factors, e.g., a lateral head turn and a lateral arm turn, can cancel each other out.
Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Interrupted object-based updating of reach program leads to a negative compatibility effect.
Vainio, Lari
2009-07-01
The author investigated how the motor program elicited by an object's orientation is updated by object-based information while a participant reaches for the object. Participants selected the hand of response according to the thickness of the graspable object and then reached toward the location in which the object appeared. Reach initiation times decreased when the handle of the object was oriented toward the responding hand. This positive compatibility effect turned into a negative compatibility effect (NCE) during reach execution when the object was removed from the display 300 ms after object onset or replaced with a mask at movement onset. The results demonstrate that interrupted object-based updating of an ongoing reach movement triggers the NCE.
Demobilising and Disengaging Violent Extremists: Towards a New UN Framework
Directory of Open Access Journals (Sweden)
Joanne Richards
2017-10-01
Full Text Available First and second generation programmes of Disarmament, Demobilisation and Reintegration (DDR, are no longer ‘fit for purpose’ in contexts of violent extremism. Recognising this, voices from within the United Nations (UN system have recently called for the development of a practice framework combining DDR and Countering Violent Extremism (CVE. Drawing on examples from Nigeria and Somalia, this commentary outlines six issue areas where DDR and CVE overlap, and where further operational guidance is required. These issue areas are: safe passage; the handling of seized and captured weapons; risk assessment; the use of deradicalisation programmes; the reintegration of extremist offenders; and the links between DDR and rehabilitation programmes for extremist prisoners.
Directory of Open Access Journals (Sweden)
Yong Ren
2014-01-01
Full Text Available We construct a medical X-ray direct digital radiography (DDR system based on a CCD (charge-coupled devices camera. For the original images captured from X-ray exposure, computer first executes image flat-field correction and image gamma correction, and then carries out image contrast enhancement. A hybrid image contrast enhancement algorithm which is based on sharp frequency localization-contourlet transform (SFL-CT and contrast limited adaptive histogram equalization (CLAHE, is proposed and verified by the clinical DDR images. Experimental results show that, for the medical X-ray DDR images, the proposed comprehensive preprocessing algorithm can not only greatly enhance the contrast and detail information, but also improve the resolution capability of DDR system.
International Nuclear Information System (INIS)
Hassinen, Tomi; Ruotsalainen, Teemu; Laakso, Petri; Penttilä, Raimo; Sandberg, Henrik G.O.
2014-01-01
We present roll-to-roll printing compatible techniques for manufacturing organic thin film transistors using two separately processed foils that are laminated together. The introduction of heat-assisted lamination opens up possibilities for material and processing combinations. The lamination of two separately processed substrates together will allow usage of pre-patterned electrodes on both substrates and materials with non-compatible solvents. Also, the surface microstructure is formed differently when laminating dry films together compared to film formation from liquid phase. Demonstrator transistors, inverters and ring oscillators were produced using lamination techniques. Finally, a roll-to-roll compatible lamination concept is proposed where also the source and drain electrodes are patterned by laser ablation. The demonstrator transistors have shown very good lifetime in air, which is contributed partly to the good material combination and partly to the enhanced interface formation in heat-assisted lamination process. - Highlights: • A roll-to-roll compatible lamination technique for printed electronics is proposed. • Laser ablation allows highly defined metal top and bottom electrodes. • Method opens up processing possibilities for incompatible materials and solvents. • Shearing forces may enhance molecular orientation and packing. • An air stable polymer transistor is demonstrated with a lifetime of years
Integrated Data Collection Analysis (IDCA) Program - Mixing Procedures and Materials Compatibility
Energy Technology Data Exchange (ETDEWEB)
Olinger, Becky D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sandstrom, Mary M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Warner, Kirstin F. [Naval Surface Warfare Center (NSWC-IHD), Indian Head, MD (United States); Sorensen, Daniel N. [Naval Surface Warfare Center (NSWC-IHD), Indian Head, MD (United States); Remmers, Daniel L. [Naval Surface Warfare Center (NSWC-IHD), Indian Head, MD (United States); Moran, Jesse S. [Naval Surface Warfare Center (NSWC-IHD), Indian Head, MD (United States); Shelley, Timothy J. [Air Force Research Lab. (AFRL), Tyndall AFB, FL (United States); Whinnery, LeRoy L. [Sandia National Lab. (SNL-CA), Livermore, CA (United States); Hsu, Peter C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Whipple, Richard E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kashgarian, Michaele [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Reynolds, John G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2011-01-14
Three mixing procedures have been standardized for the IDCA proficiency test—solid-solid, solid-liquid, and liquid-liquid. Due to the variety of precursors used in formulating the materials for the test, these three mixing methods have been designed to address all combinations of materials. Hand mixing is recommended for quantities less than 10 grams and Jar Mill mixing is recommended for quantities over 10 grams. Consideration must also be given to the type of container used for the mixing due to the wide range of chemical reactivity of the precursors and mixtures. Eight web site sources from container and chemical manufacturers have been consulted. Compatible materials have been compiled as a resource for selecting containers made of materials stable to the mixtures. In addition, container materials used in practice by the participating laboratories are discussed. Consulting chemical compatibility tables is highly recommended for each operation by each individual engaged in testing the materials in this proficiency test.
Lukasczik, Matthias; Ahnert, Jutta; Ströbl, Veronika; Vogel, Heiner; Donath, Carolin; Enger, Ilka; Gräßel, Elmar; Heyelmann, Lena; Lux, Heidemarie; Maurer, Jochen; Özbe, Dominik; Spieckenbaum, Stefanie; Voigtländer, Elzbieta; Wildner, Manfred; Zapf, Andreas; Zellner, Angela; Hollederer, Alfons
2017-05-18
Background Healthcare professionals are confronted with specific work-related demands that influence work-family relations and might indirectly affect the quality of healthcare. This paper seeks to provide an overview of the current state of research on this topic of relevance to health services research. The overview may serve as a starting point for modifying structures in the healthcare system (especially in rural regions) with the aim of improving work-family compatibility. Methods A systematic national and international literature search was conducted in terms of a scoping review. The following criteria/contents to be covered in publications were defined: work-family compatibility; work-family interface and work-family conflict in employees working in healthcare; healthcare professions in rural areas and links with work-family issues; interventions to improve work-family compatibility. 145 publications were included in the overview. Results The available literature focuses on physicians and nursing staff while publications on other professions are largely lacking. The methodological quality of existing studies is mostly low, including a lack of meta-analyses. Several studies document dissatisfaction in physicians and nursing staff regarding reconciliation of work and family life. Only few intervention studies were found that seek to improve work-life compatibility; few of them focus on employees in healthcare. There are also deficits with respect to linking work-family issues with aspects of healthcare in rural areas. Conclusions There is a shortage of systematic national and international research regarding work-family compatibility, especially when it comes to the evaluation of interventions. The overview provides starting points for improving work-family compatibility in healthcare. © Georg Thieme Verlag KG Stuttgart · New York.
Maintenance, outages and chemistry really can be compatible
International Nuclear Information System (INIS)
Roberts, J.G.; Deaconescu, R.
2006-01-01
'Full text:' In their address to the Canadian Nuclear Society, Bruce Power's Chemistry Design staff will describe how maintenance and outages can impact negatively on chemistry control and asset protection. Considerations of material impacts and material condition have significant influences on the approach to, and control of, chemistry. This applies equally to operation as it does during unit and/or system outages. Ideas will be presented as to how to facilitate making maintenance, outages and chemistry compatible. It will be shown how the lack of such an approach can lead to disastrous results. (author)
CMOS-compatible plenoptic detector for LED lighting applications.
Neumann, Alexander; Ghasemi, Javad; Nezhadbadeh, Shima; Nie, Xiangyu; Zarkesh-Ha, Payman; Brueck, S R J
2015-09-07
LED lighting systems with large color gamuts, with multiple LEDs spanning the visible spectrum, offer the potential of increased lighting efficiency, improved human health and productivity, and visible light communications addressing the explosive growth in wireless communications. The control of this "smart lighting system" requires a silicon-integrated-circuit-compatible, visible, plenoptic (angle and wavelength) detector. A detector element, based on an offset-grating-coupled dielectric waveguide structure and a silicon photodetector, is demonstrated with an angular resolution of less than 1° and a wavelength resolution of less than 5 nm.
3D MR cisternography to identify distal dural rings. Comparison of 3D-CISS and 3D-SPACE sequences
International Nuclear Information System (INIS)
Watanabe, Yoshiyuki; Makidono, Akari; Nakamura, Miho; Saida, Yukihisa
2011-01-01
The distal dural ring (DDR) is an anatomical landmark used to distinguish intra- and extradural aneurysms. We investigated identification of the DDR using 2 three-dimensional (3D) magnetic resonance (MR) cisternography sequences-3D constructive interference in steady state (CISS) and 3D sampling perfection with application optimized contrasts using different flip angle evolutions (SPACE)-at 3.0 tesla. Ten healthy adult volunteers underwent imaging with 3D-CISS, 3D-SPACE, and time-of-flight (TOF) MR angiography (TOF-MRA) sequences at 3.0T. We analyzed DDR identification and internal carotid artery (ICA) signal intensity and classified the shape of the carotid cave. We identified the DDR using both 3D-SPACE and 3D-CISS, with no significant difference between the sequences. Visualization of the outline of the ICA in the cavernous sinus (CS) was significantly clearer with 3D-SPACE than 3D-CISS. In the CS and petrous portions, signal intensity was lower with 3D-SPACE, and the flow void was poor with 3D-CISS in some subjects. We identified the DDR with both 3D-SPACE and 3D-CISS, but the superior contrast of the ICA in the CS using 3D-SPACE suggests the superiority of this sequence for evaluating the DDR. (author)
Compatibility of sodium with ceramic oxides employed in nuclear reactors
International Nuclear Information System (INIS)
Acena, V.
1981-01-01
A review of experiments carried out up to the present time on the corrosion and compatibility of ceramic oxides with liquid sodium at temperatures corresponding to those in fast breeder reactors, is presented. The results of a thermo-dynamic/liquid sodium reactions are included. The exercise has been conducted with a view to effecting experimental studies in the future. (author) [es
Compatibility of sodium with ceramic oxides employed in nuclear reactors
International Nuclear Information System (INIS)
Acena Moreno, V.
1981-01-01
This work is a review of experiments carried out up to the present time on the corrosion and compatibility of ceramic oxides with liquid sodium at temperatures corresponding to those in fast breeder reactors. The review also includes the results of a thermo-dynamic/liquid sodium reactions. The exercise has been conducted with a view to effecting experimental studies in the future. (Author)
Overview on the standardization in the field of electromagnetic compatibility
Goldberg, Georges
1989-04-01
Standardization in the domain of electromagnetic compatibility (EMC) is discussed, with specific reference to the standards of the International Electrotechnical Commission, the Comite International Special des Perturbations Radioelectriques, and the Comite Europeen de Normalisation Electrotechnique. EMC fields considered include radiocommunications, telecommunications, biological effects, and data transmission. Standards are presented for such electromagnetic disturbances as low-frequency, high-frequency, conduction, and radiation phenomena.
Design and calibration of a vacuum compatible scanning tunneling microscope
Abel, Phillip B.
1990-01-01
A vacuum compatible scanning tunneling microscope was designed and built, capable of imaging solid surfaces with atomic resolution. The single piezoelectric tube design is compact, and makes use of sample mounting stubs standard to a commercially available surface analysis system. Image collection and display is computer controlled, allowing storage of images for further analysis. Calibration results from atomic scale images are presented.
The compatibility of the concept of friendship to the role of an ...
African Journals Online (AJOL)
The compatibility of the concept of friendship to the role of an educator in the Classroom. ... Friendship bridges the distance between educator and learner and brings the educator into the world of the learner, ... AJOL African Journals Online.
Qi, Dong; Cheng, Yongzhi; Wang, Xian; Wang, Fang; Li, Bowen; Gong, Rongzhou
2017-12-01
In this paper, a polytetrafluoroethylene (PTFE) top-covered multi-layer composite structure PTFE/H s/(Ge/ZnS)3 (H s represents the surface layer ZnS with various thicknesses) for spectral compatibility is proposed and investigated theoretically and experimentally. A substantial decline of glossiness from over 200 Gs to 74.2 Gs could be realized, due to high roughness and interface reflection of the 800 nm PTFE protection layer. In addition, similar to the structure of H s/(Ge/ZnS)3, the designed structure with a certain color exhibits ultra-low emissivity of average 0.196 at 8-14 µm and highly transparent performance of 96.45% in the radar frequency range of 2-18 GHz. Our design will provide an important reference for the practical applications of the spectral compatible multilayer films.
Study on blood compatibility of the radiation sterilized disposable burette transfusion apparatus
International Nuclear Information System (INIS)
Chen Guochong; Liu Wen; Liu Qingfang
2011-01-01
The blood compatibility of the radiation sterilized disposable burette transfusion apparatus was investigated to provide evidence for the safety of radiation sterilized medical devices. The initial bacteria burden of the disposable burette transfusion apparatus was examined according to the ISO11737 standard, and the whole blood clotting time, prothrombin time, partial thromboplastin time and hemolysis rate of the samples were determined. There was no significant difference between the radiation sterilized samples and negative controls on WBCT, PT and PTT (p>0.05). Haemolysis test showed that the haemolysis rate of the sample sterilized by irradiation was 1.38%, which was coincidence with the criteria of the medical devices. After sterilization by irradiation, disposable burette transfusion apparatus show good blood compatibility, which could be considered that radiation sterilization is a biologically safe method for the medical apparatus. (authors)
Directory of Open Access Journals (Sweden)
María J. León
2018-02-01
Full Text Available Members of the genus Spiribacter are found worldwide and are abundant in ecosystems possessing intermediate salinities between seawater and saturated salt concentrations. Spiribacter salinus M19-40 is the type species of this genus and its first cultivated representative. In the habitats of S. salinus M19-40, high salinity is a key determinant for growth and we therefore focused on the cellular adjustment strategy to this persistent environmental challenge. We coupled these experimental studies to the in silico mining of the genome sequence of this moderate halophile with respect to systems allowing this bacterium to control its potassium and sodium pools, and its ability to import and synthesize compatible solutes. S. salinus M19-40 produces enhanced levels of the compatible solute ectoine, both under optimal and growth-challenging salt concentrations, but the genes encoding the corresponding biosynthetic enzymes are not organized in a canonical ectABC operon. Instead, they are scrambled (ectAC; ectB and are physically separated from each other on the S. salinus M19-40 genome. Genomes of many phylogenetically related bacteria also exhibit a non-canonical organization of the ect genes. S. salinus M19-40 also synthesizes trehalose, but this compatible solute seems to make only a minor contribution to the cytoplasmic solute pool under osmotic stress conditions. However, its cellular levels increase substantially in stationary phase cells grown under optimal salt concentrations. In silico genome mining revealed that S. salinus M19-40 possesses different types of uptake systems for compatible solutes. Among the set of compatible solutes tested in an osmostress protection growth assay, glycine betaine and arsenobetaine were the most effective. Transport studies with radiolabeled glycine betaine showed that S. salinus M19-40 increases the pool size of this osmolyte in a fashion that is sensitively tied to the prevalent salinity of the growth medium
[Compatibility of Work and Family Life: Survey of Physicians in the Munich Metropolitan Area].
Lauchart, Meike; Ascher, Philipp; Kesel, Karin; Weber, Sabine; Grabein, Beatrice; Schneeweiss, Bertram; Fischer-Truestedt, Cordula; Schoenberg, Michael; Rogler, Gudrun; Borelli, Claudia
2017-05-15
Aim Investigation of the compatibility of work and family life for physicians in the Munich metropolitan area. Methods Survey of a representative sample of 1,800 physicians using a questionnaire. Results Men were less satisfied (7% very satisfied vs. 21%) with compatibility between work and family life than women. The group least satisfied overall was hospital-based physicians (p=0.000, chi-square=122.75). Women rather than men cut back their career due to children, perceived their professional advancement as impaired, desisted from establishing private practice or quit hospital employment altogether. Respondents strove for flexible childcare and makeshift solution if the established service failed. Most did not have that at their disposal. Hospital-based physicians wished for predictable working hours, and would like to have a say in the structure of their schedule. For the majority this was not the case. While for 80% it would be important to participate in the definition of their working hours, this was only possible in 17%. 86% found the opportunity to work part-time important, but many doctors (more than 30%) did not have that option. The biggest help for office-based physicians would be an expedited procedure by the Bavarian Association of Statutory Health Insurance Physicians (KVB) when applying for a proxy. The second most important would be the ability to hand over on-call duties. 36% of respondents felt that compatibility of work and family life was best achieved outside of patient care, during residency 42% believed this to be the case. Only 6% of physicians felt the best compatibility to be achieved in a hospital. Among the physician owners of practices, 34% considered their model to be the best way to reconcile both aspects of life. Conclusion More flexible options for childcare and more influence on the definition of working hours are necessary in order to better reconcile work and family life. For office-based physicians it must be made easier to
Heo, Youn-Jung; Jung, Yen-Sook; Hwang, Kyeongil; Kim, Jueng-Eun; Yeo, Jun-Seok; Lee, Sehyun; Jeon, Ye-Jin; Lee, Donmin; Kim, Dong-Yu
2017-11-15
For the first time, the photovoltaic modules composed of small molecule were successfully fabricated by using roll-to-roll compatible printing techniques. In this study, blend films of small molecules, BTR and PC 71 BM were slot-die coated using a halogen-free solvent system. As a result, high efficiencies of 7.46% and 6.56% were achieved from time-consuming solvent vapor annealing (SVA) treatment and roll-to-roll compatible solvent additive approaches, respectively. After successful verification of our roll-to-roll compatible method on small-area devices, we further fabricated large-area photovoltaic modules with a total active area of 10 cm 2 , achieving a power conversion efficiency (PCE) of 4.83%. This demonstration of large-area photovoltaic modules through roll-to-roll compatible printing methods, even based on a halogen-free solvent, suggests the great potential for the industrial-scale production of organic solar cells (OSCs).
Thermodynamics of non-bridging oxigen in silica bio-compatible glass-ceramics
Czech Academy of Sciences Publication Activity Database
Koga, N.; Strnad, Z.; Šesták, Jaroslav; Strnad, J.
2003-01-01
Roč. 71, - (2003), s. 927-937 ISSN 1418-2874 R&D Projects: GA AV ČR IAA4010101 Institutional research plan: CEZ:AV0Z1010914 Keywords : bio-compatible * bone-like apatite * glass-ceramics * mimetic material * thermodynamics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.598, year: 2002
Is Christian Religious Conservatism Compatible with the Liberal Social Welfare State?
Belcher, John R.; Fandetti, Donald; Cole, Danny
2004-01-01
This article examines the rise of Christian religious conservatism and explores whether the theological views of the conservative Christian movement are compatible with the liberal social welfare state. The authors conclude that the driving force behind social change should remain with the state, even though faith-based initiatives can provide…
Why a Gunk World is Compatible with Nihilism about Objects
Directory of Open Access Journals (Sweden)
Baptiste Le Bihan
2015-07-01
Full Text Available Ted Sider argues that nihilism about objects is incompatible with the metaphysical possibility of gunk and takes this point to show that nihilism is flawed. I shall describe one kind of nihilism able to answer this objection. I believe that most of the things we usually encounter do not exist. That is, I take talk of macroscopic objects and macroscopic properties to refer to sets of fundamental properties, which are invoked as a matter of linguistic convention. This view is a kind of nihilism: it rules out the existence of objects; that is, from an ontological point of view, there are no objects. But unlike the moderate nihilism of Mark Heller, Peter van Inwagen and Trenton Merricks that claims that most objects do not exist, I endorse a radical nihilism according to which there are no objects in the world, but only properties instantiated in spacetime. As I will show, radical nihilism is perfectly compatible with the metaphysical possibility of gunk. It is also compatible with the epistemic possibility that we actually live in a gunk world. The objection raised by Ted Sider only applies to moderate nihilism that admits some objects in its ontology.
Fabrication of CMOS-compatible nanopillars for smart bio-mimetic CMOS image sensors
Saffih, Faycal; Elshurafa, Amro M.; Mohammad, Mohammad Ali; Nelson-Fitzpatrick, Nathan E.; Evoy, S.
2012-01-01
. The fabrication of the nanopillars was carried out keeping the CMOS process in mind to ultimately obtain a CMOS-compatible process. This work serves as an initial step in the ultimate objective of integrating photo-sensors based on these nanopillars seamlessly
The role of compatibility in the diffusion of technologies through social networks
N.S. Immorlica (Nicole Simone); J. Kleinberg; M. Mahdian (Mohammad); T. Wexler; J.K. MacKie-Mason; P. Resnick
2007-01-01
textabstractIn many settings, competing technologies -- for example, operating systems, instant messenger systems, or document formats -- can be seen adopting a limited amount of compatibility with one another; in other words, the difficulty in using multiple technologies is balanced somewhere
[Compatibility of different quality control systems].
Invernizzi, Enrico
2002-01-01
Management of the good laboratory practice (GLP) quality system presupposes its linking to a basic recognized and approved quality system, from which it can draw on management procedures common to all quality systems, such as the ISO 9000 set of norms. A quality system organized in this way can also be integrated with other dedicated quality systems, or parts of them, to obtain principles or management procedures for specific topics. The aim of this organization is to set up a reliable, recognized quality system compatible with the principles of GLP and other quality management systems, which provides users with a simplified set of easily accessible management tools and answers. The organization of this quality system is set out in the quality assurance programme, which is actually the document in which the test facility incorporates the GLP principles into its own quality organization.
fMRI-Compatible Electromagnetic Haptic Interface.
Riener, R; Villgrattner, T; Kleiser, R; Nef, T; Kollias, S
2005-01-01
A new haptic interface device is suggested, which can be used for functional magnetic resonance imaging (fMRI) studies. The basic component of this 1 DOF haptic device are two coils that produce a Lorentz force induced by the large static magnetic field of the MR scanner. A MR-compatible optical angular encoder and a optical force sensor enable the implementation of different control architectures for haptic interactions. The challenge was to provide a large torque, and not to affect image quality by the currents applied in the device. The haptic device was tested in a 3T MR scanner. With a current of up to 1A and a distance of 1m to the focal point of the MR-scanner it was possible to generate torques of up to 4 Nm. Within these boundaries image quality was not affected.
CAMAC-compatible differential pulse discriminator-counter
International Nuclear Information System (INIS)
Tselikov, I.V.
1988-01-01
A differential pulse discriminator-counter for a Moessbauer spectrometer is described. Input pulses are collected according to the following algorithm; a pulse is admitted into the channel depending on whether or not the preceding pulse fell into the discrimination window. The circuit does not contain delay lines to allow for the delay lines to allow for the delay of the signal from the upper-level discriminator with respect to the signal from the lower-level discriminator due to the finite rise time of the input pulses, which makes it possible to reduce the dead time of the discriminator to the actuation time of the threshold circuits. The pulse count rate is 150 MHz, the input amplitude is +/-3 V, the dead time is 6 nsec, and the delay from input to output is 14 nsec. The unit is CAMAC-compatible
An overview of electromagnetic compatibility (EMC)
International Nuclear Information System (INIS)
Raffi, M.; Qadeer, S.; Anwar, M.
1998-01-01
The world is becoming increasingly dependent upon the use of electrical and electronic equipment. In the recent years, introduction of semiconductor based devices, microprocessor and micro computer have brought about a technological revolution that has had far reaching effects in the home, in industry, in commerce and in defense. Electromagnetic Compatibility (EMC) is the discipline which attempts to over come or, at least, minimize the effects of mismatch between equipment and the operating environment in accordance with agreed specifications, standards and regulations. Increased electromagnetic pollution in the environment has caused tremendous concern in the electronic industry and among users. Designers of the electronic products and systems want to be sure that their products do not emit excessive, unintentional radiation to interfere with the operation of the other systems, nor should these products be susceptible to electromagnetic interference which may degrade their performance. (author)
International Nuclear Information System (INIS)
Pineda, A.A.; Dharkar, D.D.; Wahner, H.W.
1984-01-01
Modified red blood cell survival studies with use of 51Cr were performed in three groups of subjects. Group 1 consisted of normal subjects who were given labeled autologous blood, group 2 were subjects in need of blood transfusions and given labeled ABO and Rh crossmatch-compatible blood, and group 3 were patients in need of blood transfusion but in whom problems arose in finding compatible blood. The results of the studies suggest that for patients with blood compatibility problems, normal red blood cell survival values at 1 hour do not exclude the possibility of severe hemolysis 24 hours later. Thus, if a 1-hour test result is normal, the procedure should be extended routinely to 24 hours. Moreover, the test can be used to evaluate the clinical importance of antibodies. We showed that anti-Yka and anti-Lan were clinically significant, but high-titer, low-avidity antibodies, anti-Kna, anti-I, and anti-HI were clinically insignificant in the cases studied. This finding emphasizes the importance of an in vivo test for the final compatibility evaluation in complicated blood replacement problems
Chen, Xiaowen; Shekiro, Joseph; Pschorn, Thomas; Sabourin, Marc; Tucker, Melvin P; Tao, Ling
2015-01-01
A novel, highly efficient deacetylation and disk refining (DDR) process to liberate fermentable sugars from biomass was recently developed at the National Renewable Energy Laboratory (NREL). The DDR process consists of a mild, dilute alkaline deacetylation step followed by low-energy-consumption disk refining. The DDR corn stover substrates achieved high process sugar conversion yields, at low to modest enzyme loadings, and also produced high sugar concentration syrups at high initial insoluble solid loadings. The sugar syrups derived from corn stover are highly fermentable due to low concentrations of fermentation inhibitors. The objective of this work is to evaluate the economic feasibility of the DDR process through a techno-economic analysis (TEA). A large array of experiments designed using a response surface methodology was carried out to investigate the two major cost-driven operational parameters of the novel DDR process: refining energy and enzyme loadings. The boundary conditions for refining energy (128-468 kWh/ODMT), cellulase (Novozyme's CTec3) loading (11.6-28.4 mg total protein/g of cellulose), and hemicellulase (Novozyme's HTec3) loading (0-5 mg total protein/g of cellulose) were chosen to cover the most commercially practical operating conditions. The sugar and ethanol yields were modeled with good adequacy, showing a positive linear correlation between those yields and refining energy and enzyme loadings. The ethanol yields ranged from 77 to 89 gallons/ODMT of corn stover. The minimum sugar selling price (MSSP) ranged from $0.191 to $0.212 per lb of 50 % concentrated monomeric sugars, while the minimum ethanol selling price (MESP) ranged from $2.24 to $2.54 per gallon of ethanol. The DDR process concept is evaluated for economic feasibility through TEA. The MSSP and MESP of the DDR process falls within a range similar to that found with the deacetylation/dilute acid pretreatment process modeled in NREL's 2011 design report. The DDR process is
International Nuclear Information System (INIS)
Inamura, T.; Kim, H.Y.; Hosoda, H.; Miyazaki, S.
2013-01-01
Highlights: ► Kinematic compatibility (KC) among martensite variants in Ti-Nb-Al is evaluated. ► Rotation Q is necessary to keep KC at any junction plane (JP). ► The rotation Q is equivalent to the rotation to form the exact twin-relationship. ► The JP preferentially observed in experiment is the JP with the smaller Q. ► We propose two preferential JPs with {1 1 1} type I and 〈2 1 1〉 type II twin in Ti-Nb-Al. -- Abstract: The invariant plane (IP) condition at a habit plane (HP) and the kinematic compatibility (KC) condition at a junction plane (JP) are quantitatively evaluated by the geometrically nonlinear theory of martensite and the origin of the twin orientation relationship (OR) at a JP is revealed in a β titanium shape memory alloy. Exact twin OR at a JP is impossible among the habit plane variants (HPVs). A nonzero rotation is necessary to maintain the compatibility at a JP between the HPVs. The fully compatible HPV cluster in which IP at a HP and KC at a JP are maintained simultaneously is impossible in this alloy. However, it was found that twin OR and KC can be maintained simultaneously. The preferentially observed HPV clusters in transmission electron microscopy are the clusters with a smaller rotation to maintain KC at a JP
Novel silicone compatible cross-linkers for controlled functionalization of PDMS networks
DEFF Research Database (Denmark)
Madsen, Frederikke Bahrt; Daugaard, Anders Egede; Hvilsted, Søren
2013-01-01
. In order to improve the dielectric properties of PDMS a novel system is developed where push-pull dipoles are grafted to a new silicone compatible cross-linker. The grafted cross-linkers are prepared by reaction of two different push-pull dipole alkynes as well as a fluorescent alkyne with the new azide...
Action compatibility in spatial knowledge developed through virtual navigation.
Wang, Qi; Taylor, Holly A; Brunyé, Tad T
2018-01-09
Action-compatibility effects (ACEs) arise due to incongruity between perceptuo-motor traces stored in memory and the perceptuo-motor demands of a retrieval task. Recent research has suggested that ACEs arising during spatial memory retrieval are additionally modulated by individual differences in how experienced participants are with a college campus environment. However, the extent and nature of experience with a real-world environment is difficult to assess and control, and characteristics of the retrieval task itself might modulate ACEs during spatial memory retrieval. The present study provides a more controlled and in-depth examination of how individual differences and task-based factors interact to shape ACEs when participants retrieve spatial memories. In two experiments, participants with varied video game experience learned a virtual environment and then used the computer mouse to verify spatial relationships from different perspectives. Mouse trajectories demonstrated ACEs, differing by retrieval perspective and video game experience. Videogame experts demonstrated the ACE based on learned spatial relationships during egocentric retrieval only, whereas videogame novices showed the ACE based on semantic processing of directional terms only. Specifically, gaming experts invoke perspective-specific perceptuo-motor associations to retrieve spatial knowledge, whereas non-experts are influenced by semantically based associations specific to the retrieval task. Results are discussed in the context of action-compatibility effects, the intentional weighting hypothesis, and the flexible encoding and retrieval of spatial information.
CPU and GPU (Cuda Template Matching Comparison
Directory of Open Access Journals (Sweden)
Evaldas Borcovas
2014-05-01
Full Text Available Image processing, computer vision or other complicated opticalinformation processing algorithms require large resources. It isoften desired to execute algorithms in real time. It is hard tofulfill such requirements with single CPU processor. NVidiaproposed CUDA technology enables programmer to use theGPU resources in the computer. Current research was madewith Intel Pentium Dual-Core T4500 2.3 GHz processor with4 GB RAM DDR3 (CPU I, NVidia GeForce GT320M CUDAcompliable graphics card (GPU I and Intel Core I5-2500K3.3 GHz processor with 4 GB RAM DDR3 (CPU II, NVidiaGeForce GTX 560 CUDA compatible graphic card (GPU II.Additional libraries as OpenCV 2.1 and OpenCV 2.4.0 CUDAcompliable were used for the testing. Main test were made withstandard function MatchTemplate from the OpenCV libraries.The algorithm uses a main image and a template. An influenceof these factors was tested. Main image and template have beenresized and the algorithm computing time and performancein Gtpix/s have been measured. According to the informationobtained from the research GPU computing using the hardwarementioned earlier is till 24 times faster when it is processing abig amount of information. When the images are small the performanceof CPU and GPU are not significantly different. Thechoice of the template size makes influence on calculating withCPU. Difference in the computing time between the GPUs canbe explained by the number of cores which they have.
IVVS actuating system compatibility test to ITER gamma radiation conditions
Energy Technology Data Exchange (ETDEWEB)
Rossi, Paolo, E-mail: paolo.rossi@enea.it [Associazione EURATOM-ENEA sulla Fusione, 45 Via Enrico Fermi, 00044 Frascati, Rome (Italy); Collibus, M. Ferri de; Florean, M.; Monti, C.; Mugnaini, G.; Neri, C.; Pillon, M.; Pollastrone, F. [Associazione EURATOM-ENEA sulla Fusione, 45 Via Enrico Fermi, 00044 Frascati, Rome (Italy); Baccaro, S.; Piegari, A. [ENEA CR Casaccia, 301 Via Anguillarese, 00123 Santa Maria di Galeria, Rome (Italy); Damiani, C.; Dubus, G. [Fusion For Energy c/Josep Pla, n° 2 Torres Diagonal Litoral, 08019 Barcelona (Spain)
2013-10-15
Highlights: • ENEA developed and tested a prototype of a laser In Vessel Viewing and ranging System (IVVS) for ITER. • One piezo-motor prototype has been tested on the ENEA Calliope gamma irradiation facility to verify its compatibility to ITER gamma radiation conditions. • After a total dose of more than 4 MGy the piezo-motor maintained almost the same working parameters monitored before test without any evident and significant degradation of functionality. • After the full gamma irradiation test, the same piezo-motor assembly will be tested with 14 MeV neutrons irradiation using ENEA FNG facility. -- Abstract: The In Vessel Viewing System (IVVS) is a fundamental remote handling equipment, which will be used to make a survey of the status of the blanket first wall and divertor plasma facing components. A design and testing activity is ongoing, in the framework of a Fusion for Energy (F4E) grant agreement, to make the IVVS probe design compatible with ITER operating conditions and in particular, but not only, with attention to neutrons and gammas fluxes and both space constraints and interfaces. The paper describes the testing activity performed on the customized piezoelectric motors and the main components of the actuating system of the IVVS probe with reference to ITER gamma radiation conditions. In particular the test is performed on the piezoelectric motor, optical encoder and small scale optical samples .The test is carried out on the ENEA Calliope gamma irradiation facility at ITER relevant gamma fields at rate of about 2.5 kGy/h and doses of 4 MGy. The paper reports in detail the setup arrangement of the test campaign in order to verify significant working capability of the IVVS actuating components and the results are shown in terms of functional performances and parameters. The overall test campaign on IVVS actuating system will be completed on other ENEA testing facilities in order to verify compatibility to Magnetic field, neutrons and thermal
IVVS actuating system compatibility test to ITER gamma radiation conditions
International Nuclear Information System (INIS)
Rossi, Paolo; Collibus, M. Ferri de; Florean, M.; Monti, C.; Mugnaini, G.; Neri, C.; Pillon, M.; Pollastrone, F.; Baccaro, S.; Piegari, A.; Damiani, C.; Dubus, G.
2013-01-01
Highlights: • ENEA developed and tested a prototype of a laser In Vessel Viewing and ranging System (IVVS) for ITER. • One piezo-motor prototype has been tested on the ENEA Calliope gamma irradiation facility to verify its compatibility to ITER gamma radiation conditions. • After a total dose of more than 4 MGy the piezo-motor maintained almost the same working parameters monitored before test without any evident and significant degradation of functionality. • After the full gamma irradiation test, the same piezo-motor assembly will be tested with 14 MeV neutrons irradiation using ENEA FNG facility. -- Abstract: The In Vessel Viewing System (IVVS) is a fundamental remote handling equipment, which will be used to make a survey of the status of the blanket first wall and divertor plasma facing components. A design and testing activity is ongoing, in the framework of a Fusion for Energy (F4E) grant agreement, to make the IVVS probe design compatible with ITER operating conditions and in particular, but not only, with attention to neutrons and gammas fluxes and both space constraints and interfaces. The paper describes the testing activity performed on the customized piezoelectric motors and the main components of the actuating system of the IVVS probe with reference to ITER gamma radiation conditions. In particular the test is performed on the piezoelectric motor, optical encoder and small scale optical samples .The test is carried out on the ENEA Calliope gamma irradiation facility at ITER relevant gamma fields at rate of about 2.5 kGy/h and doses of 4 MGy. The paper reports in detail the setup arrangement of the test campaign in order to verify significant working capability of the IVVS actuating components and the results are shown in terms of functional performances and parameters. The overall test campaign on IVVS actuating system will be completed on other ENEA testing facilities in order to verify compatibility to Magnetic field, neutrons and thermal
Cesare, Anthony J
2014-11-01
Double strand break (DSB) repair is suppressed during mitosis because RNF8 and downstream DNA damage response (DDR) factors, including 53BP1, do not localize to mitotic chromatin. Discovery of the mitotic kinase-dependent mechanism that inhibits DSB repair during cell division was recently reported. It was shown that restoring mitotic DSB repair was detrimental, resulting in repair dependent genome instability and covalent telomere fusions. The telomere DDR that occurs naturally during cellular aging and in cancer is known to be refractory to G2/M checkpoint activation. Such DDR-positive telomeres, and those that occur as part of the telomere-dependent prolonged mitotic arrest checkpoint, normally pass through mitosis without covalent ligation, but result in cell growth arrest in G1 phase. The discovery that suppressing DSB repair during mitosis may function primarily to protect DDR-positive telomeres from fusing during cell division reinforces the unique cooperation between telomeres and the DDR to mediate tumor suppression. © 2014 The Author. Bioessays published by WILEY Periodicals, Inc.
Maintenance, outages and chemistry really can be compatible
Energy Technology Data Exchange (ETDEWEB)
Roberts, J.G.; Deaconescu, R. [Bruce Power, Tiverton, Ontario (Canada)
2006-07-01
'Full text:' In their address to the Canadian Nuclear Society, Bruce Power's Chemistry Design staff will describe how maintenance and outages can impact negatively on chemistry control and asset protection. Considerations of material impacts and material condition have significant influences on the approach to, and control of, chemistry. This applies equally to operation as it does during unit and/or system outages. Ideas will be presented as to how to facilitate making maintenance, outages and chemistry compatible. It will be shown how the lack of such an approach can lead to disastrous results. (author)
Methane emissions and climate compatibility of fossil fuels
International Nuclear Information System (INIS)
Meier, B.
1992-01-01
Methane contributes directly and indirectly to the additional greenhouse effect caused by human activities. The vast majority of the anthropogenic methane release occurs worldwide in non-fossil sources such as rice cultivation, livestock operations, sanitary landfills and combustion of bio-mass. Methane emissions also occur during production, distribution and utilisation of fossil fuels. Also when considering the methane release and CO 2 -emissions of processes upstream of combustion, the ranking of environmental compatibility of natural gas, fuel oil and cool remains unchanged. Of all fossil fuels, natural gas contributes the least to the greenhouse effect. (orig.) [de
Radiation damage studies of detector-compatible Si JFETs
International Nuclear Information System (INIS)
Dalla Betta, Gian-Franco; Boscardin, Maurizio; Candelori, Andrea; Pancheri, Lucio; Piemonte, Claudio; Ratti, Lodovico; Zorzi, Nicola
2007-01-01
We have largely improved the performance of our detector-compatible Si JFETs by optimizing the fabrication technology. New devices feature thermal noise values close to the theoretical ones, and remarkably low 1/f noise figures. In view of adopting these JFETs for X-ray imaging and HEP applications, bulk and surface radiation damage tests have been carried out by irradiating single transistors and test structures with neutrons and X-rays. Selected results from static and noise characterization of irradiated devices are discussed in this paper, and the impact of radiation effects on the performance of JFET-based circuits is addressed
Interfacial Compatibility in Microelectronics Moving Away from the Trial and Error Approach
Laurila, Tomi; Paulasto-Kröckel, Mervi; Turunen, Markus; Mattila, Toni T; Kivilahti, Jorma
2012-01-01
Interfaces between dissimilar materials are met everywhere in microelectronics and microsystems. In order to ensure faultless operation of these highly sophisticated structures, it is mandatory to have fundamental understanding of materials and their interactions in the system. In this difficult task, the “traditional” method of trial and error is not feasible anymore; it takes too much time and repeated efforts. In Interfacial Compatibility in Microelectronics, an alternative approach is introduced. In this revised method four fundamental disciplines are combined: i) thermodynamics of materials ii) reaction kinetics iii) theory of microstructures and iv) stress and strain analysis. The advantages of the method are illustrated in Interfacial Compatibility in Microelectronics which includes: •solutions to several common reliability issues in microsystem technology, •methods to understand and predict failure mechanisms at interfaces between dissimilar materials and •an approach to DFR based on deep un...
Jing, Chan Jer; Seman, Idris Abu; Zakaria, Latiffah
2015-12-01
Mating compatibility and restriction analyses of Internal Transcribed Spacer (ITS) regions were performed to determine the relations between Ganoderma boninense, the most common species associated with basal stem rot in oil palm and Ganoderma isolates from infected oil palm, two ornamental palms, sealing wax palm (Cyrtostachys renda) and MacArthur palm (Ptychosperma macarthurii), an isolate from coconut stump (Cocos nucifera), Ganoderma miniatocinctum, Ganoderma zonatum and Ganoderma tornatum. The results showed that G. boninense was compatible with Ganoderma isolates from oil palm, G. miniatocinctum and G. zonatum, Ganoderma isolates from sealing wax palm, MacArthur palm and coconut stump. G. boninense was not compatible with G. tornatum. Therefore, the results suggested that the G. boninense, G. miniatocinctum, G. zonatum, and Ganoderma isolates from oil palm, ornamental palms and coconut stump could represent the same biological species. In performing a restriction analysis of the ITS regions, variations were observed in which five haplotypes were generated from the restriction patterns. An unweighted pair-group method with arithmetic averages (UPGMA) cluster analysis showed that all the Ganoderma isolates were grouped into five primary groups, and the similarity values of the isolates ranged from 97% to 100%. Thus, a restriction analysis of the ITS regions showed that G. boninense and the Ganoderma isolates from other palm hosts were closely related. On the basis of the mating compatibility test and the restriction analysis of the ITS regions performed in this study, a diverse group of Ganoderma species from oil palm and other palm hosts are closely related, except for G. tornatum and Ganoderma isolates from tea and rubber.
Physical properties and compatibility with dental stones of current alginate impression materials.
Murata, H; Kawamura, M; Hamada, T; Chimori, H; Nikawa, H
2004-11-01
This study examined physical properties and compatibility with dental stones of two types of alginate impression materials. Five powder-type alginate impression materials (Alginoplast EM, Aroma Fine, Algiace Z, Coe Alginate, Jeltrate Plus) and a paste-type alginate impression material (Tokuso AP-1) were used. The dynamic viscosity immediately after mixing was measured by means of a controlled-stress rheometer. The gelation times were determined according to Japanese Industrial Standards (JIS) T6505, and recovery from deformation, strain in compression and compressive strength were determined according to the International Organization for Standardization (ISO) specification 1563. Detail reproduction and surface roughness of type III dental stones (New Plastone, New Sunstone) and a type IV dental stone (Die Stone) were evaluated using a ruled test block as specified in the ISO specification 1563 and a profilometer, respectively. The alginate impression materials evaluated in this study were all in compliance with the ISO specification 1563 and JIS T6505. The alginate impression materials had similar mechanical properties after gelation, whilst a wide range of dynamic viscosity immediately after being mixed, gelation times and compatibility with dental stones were found among the materials. The paste-type material had a higher dynamic viscosity and a shorter gelation time than the powder-type materials. The best surface quality was obtained with the paste-type material/type III dental stone cast combinations. The materials should be selected in consideration of initial flow, setting characteristics and compatibility with dental stones. The results suggested that a paste-type material would better meet the requirements of an alginate impression material.
Compatibility of Anti-Wear Additives with Non-Ferrous Engine Bearing Alloys
Energy Technology Data Exchange (ETDEWEB)
Qu, Jun [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Zhou, Yan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-01-01
Investigate the compatibility of engine lubricant antiwear (AW) additives, specifically conventional zinc dialkyldithiophosphate (ZDDP) and newly developed ionic liquids (ILs), with selected non-ferrous engine bearing alloys, specifically aluminum and bronze alloys that are commonly used in connecting rod end journal bearings and bushings, to gain fundamental understanding to guide future development of engine lubricants
Dhawde, Rutuja; Macaden, Ragini; Saranath, Dhananjaya; Nilgiriwala, Kayzad; Ghadge, Appasaheb; Birdi, Tannaz
2018-06-12
In the current study, ceftazidime- and ciprofloxacin-resistant—or dual drug-resistant (DDR)— E. coli were isolated from river Mula-Mutha, which flows through rural Pune district and Pune city. The DDR E. coli were further examined for antibiotic resistance to six additional antibiotics. The study also included detection of genes responsible for ceftazidime and ciprofloxacin resistance and vectors for horizontal gene transfer. Twenty-eight percent of the identified DDR E. coli were resistant to more than six antibiotics, with 12% being resistant to all eight antibiotics tested. Quinolone resistance was determined through the detection of qnrA , qnrB , qnrS and oqxA genes, whereas cephalosporin resistance was confirmed through detection of TEM, CTX-M-15, CTX-M-27 and SHV genes. Out of 219 DDR E. coli , 8.2% were qnrS positive and 0.4% were qnrB positive. Percentage of isolates positive for the TEM, CTX-M-15 and CTX-M-27 genes were 32%, 46% and 0.9%, respectively. None of the DDR E. coli tested carried the qnrA , SHV and oqxA genes. Percentage of DDR E. coli carrying Class 1 and 2 integrons (mobile genetic elements) were 47% and 8%, respectively. The results showed that antibiotic resistance genes (ARGs) and integrons were present in the E. coli isolated from the river at points adjoining and downstream of Pune city.
Tank 241-SY-102, January 2000 Compatibility Grab Samples Analytical Results for the Final Report
International Nuclear Information System (INIS)
BELL, K.E.
2000-01-01
This document is the format IV, final report for the tank 241-SY-102 (SY-102) grab samples taken in January 2000 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank SY-102 samples were performed as directed in Comparability Grab Sampling and Analysis Plan for Fiscal Year 2000 (Sasaki 1999). No notification limits were exceeded. Preliminary data on samples 2SY-99-5, -6, and -7 were reported in ''Format II Report on Tank 241-SY-102 Waste Compatibility Grab Samples Taken in January 2000'' (Lockrem 2000). The data presented here represent the final results
Gender Compatibility, Math-Gender Stereotypes, and Self-Concepts in Math and Physics
Koul, Ravinder; Lerdpornkulrat, Thanita; Poondej, Chanut
2016-01-01
Positive self-assessment of ability in the quantitative domains is considered critical for student participation in science, technology, engineering, and mathematics field studies. The present study investigated associations of gender compatibility (gender typicality and contentedness) and math-gender stereotypes with self-concepts in math and…
DNA damage response and DNA repair – dog as a model?
International Nuclear Information System (INIS)
Grosse, Nicole; Loon, Barbara van; Rohrer Bley, Carla
2014-01-01
Companion animals like dogs frequently develop tumors with age and similarly to human malignancies, display interpatient tumoral heterogeneity. Tumors are frequently characterized with regard to their mutation spectra, changes in gene expression or protein levels. Among others, these changes affect proteins involved in the DNA damage response (DDR), which served as a basis for the development of numerous clinically relevant cancer therapies. Even though the effects of different DNA damaging agents, as well as DDR kinetics, have been well characterized in mammalian cells in vitro, very little is so far known about the kinetics of DDR in tumor and normal tissues in vivo. Due to (i) the similarities between human and canine genomes, (ii) the course of spontaneous tumor development, as well as (iii) common exposure to environmental agents, canine tumors are potentially an excellent model to study DDR in vivo. This is further supported by the fact that dogs show approximately the same rate of tumor development with age as humans. Though similarities between human and dog osteosarcoma, as well as mammary tumors have been well established, only few studies using canine tumor samples addressed the importance of affected DDR pathways in tumor progression, thus leaving many questions unanswered. Studies in humans showed that misregulated DDR pathways play an important role during tumor development, as well as in treatment response. Since dogs are proposed to be a good tumor model in many aspects of cancer research, we herein critically investigate the current knowledge of canine DDR and discuss (i) its future potential for studies on the in vivo level, as well as (ii) its possible translation to veterinary and human medicine
International Nuclear Information System (INIS)
Tavares, Maria I.B.; Costa, D.A.; Menezes, Sonia M.C.
1993-01-01
NMR has been frequently used for the determination of polymers compatibility. The utilization of the simple pulse technique together with the contact time variation technique has been enabling the evaluation of the compatibility of polymeric systems. This work presents the study of the behaviour of the mixture composed by nylon-6 with poly(propylene oxide) using these techniques. Results are presented
Incentive compatibility in kidney exchange problems.
Villa, Silvia; Patrone, Fioravante
2009-12-01
The problem of kidney exchanges shares common features with the classical problem of exchange of indivisible goods studied in the mechanism design literature, while presenting additional constraints on the size of feasible exchanges. The solution of a kidney exchange problem can be summarized in a mapping from the relevant underlying characteristics of the players (patients and their donors) to the set of matchings. The goal is to select only matchings maximizing a chosen welfare function. Since the final outcome heavily depends on the private information in possess of the players, a basic requirement in order to reach efficiency is the truthful revelation of this information. We show that for the kidney exchange problem, a class of (in principle) efficient mechanisms does not enjoy the incentive compatibility property and therefore is subject to possible manipulations made by the players in order to profit of the misrepresentation of their private information.
Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Is Christian Education Compatible With Science Education?
Martin, Michael
Science education and Christian education are not compatible if by Christian education one means teaching someone to be a Christian. One goal of science education is to give students factual knowledge. Even when there is no actual conflict of this knowledge with the dogmas of Christianity, there exists the potential for conflict. Another goal of science education is to teach students to have the propensity to be sensitive to evidence: to hold beliefs tentatively in light of evidence and to reject these beliefs in the light of new evidence if rejection is warranted by this evidence. This propensity conflicts with one way in which beliefs are often taught in Christian education: namely as fundamental dogmas, rather than as subject to revision in the light of the evidence.
Compatibility of elastomers in alternate jet fuels
Kalfayan, S. H.; Fedors, R. F.; Reilly, W. W.
1979-01-01
The compatibility of elastomeric compositions of known resistance to aircraft fuels was tested for potential use in Jet A type fuels obtainable from alternate sources, such as coal. Since such fuels were not available at the time, synthetic alternate fuels were prepared by adding tetralin to a petroleum based Jet A type fuel to simulate coal derived fuels which are expected to contain higher amounts of aromatic and hydroaromatic hydrocarbons. The elastomeric compounds tested were based on butadiene-acrylonitrile rubber, a castable Thiokol polysulfide rubber, and a castable fluorosilicone rubber. Batches of various cross-link densities of these rubbers were made and their chemical stress relaxation behavior in fuel, air, and nitrogen, their swelling properties, and response to mechanical testing were determined.
Ding, Yonghui; Yang, Meng; Yang, Zhilu; Luo, Rifang; Lu, Xiong; Huang, Nan; Huang, Pingbo; Leng, Yang
2015-03-01
A wide variety of environmental cues provided by the extracellular matrix, including biophysical and biochemical cues, are responsible for vascular cell behavior and function. In particular, substrate topography and surface chemistry have been shown to regulate blood and vascular compatibility individually. The combined impact of chemical and topographic cues on blood and vascular compatibility, and the interplay between these two types of cues, are subjects that are currently being explored. In the present study, a facile polydopamine-mediated approach is introduced for immobilization of heparin on topographically patterned substrates, and the combined effects of these cues on blood compatibility and re-endothelialization are systematically investigated. The results show that immobilized heparin and substrate topography cooperatively modulate anti-coagulation activity, endothelial cell (EC) attachment, proliferation, focal adhesion formation and endothelial marker expression. Meanwhile, the substrate topography is the primary determinant of cell alignment and elongation, driving in vivo-like endothelial organization. Importantly, combining immobilized heparin with substrate topography empowers substantially greater competitive ability of ECs over smooth muscle cells than each cue individually. Moreover, a model is proposed to elucidate the cooperative interplay between immobilized heparin and substrate topography in regulating cell behavior. Copyright © 2014 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Wen He
2018-02-01
Full Text Available ‘Hongmian miyou’ (Citrus grandis L. Osbeck is mutated from ‘Guanxi miyou’, with a different spongy layer coloration. Trifoliate orange (Poncirus trifoliata is widely used as rootstocks in ‘Guanxi miyou’ grafting, whereas ‘Hongmian miyou’ is incompatible with available trifoliate orange rootstocks. To explore the reasons for the etiolation of leaves of ‘Hongmian miyou’/trifoliate orange, anatomical differences among different graft unions, gene expression profiles, and auxin levels of scion were investigated in this study. A histological assay indicated that there was no significant difference in anatomical structure between the compatible and incompatible combinations. A total of 1950 significant differentially-expressed genes (DEGs were identified and analyzed. The Kyoto Encyclopedia of Genes and Genomes (KEGG pathway enrichment analysis revealed that genes involved in carbohydrate metabolism, energy metabolism, amino acid metabolism, and plant hormone signal transduction were significantly enriched. Moreover, the expression of nine genes in the auxin pathway were upregulated and three were downregulated in compatible combinations compared with those in the incompatible group. Further experiments verified that indole-3-acetic acid (IAA content increases in the compatible graft combination, which suggests that IAA might promote graft compatibility.
Directory of Open Access Journals (Sweden)
Adriana Marcela Santos
2014-07-01
Full Text Available A Colombian isolate of Spodoptera frugiperdanucleopolyhedrovirus Sf NPV003 was formulated as a powder by microencapsulating it with a methacrylic acid polymer, which increased the photostability of the virus. In order to generate recommendations for the use of this biopesticide, the objective of this study was to establish in vitro compatibility with chemicals (insecticides and fungicides and to determine the product stability during 15 months at 8 °C, 18 °C and 28 °C. The virus was compatible with eight chemicals tested, with an insecticidal activity greater than 80%. When the biopesticide was stored at 8 °C, 18 °C and 28 °C, the insecticidal activity and the content of contaminants were within acceptance limits established for each property. Results indicated that microencapsulated Sf MNPV can be stored at temperatures below 28 °C, thus ensuring product quality for at least 17 months, enough time for its distribution and use.
Drug-Drug/Drug-Excipient Compatibility Studies on Curcumin using Non-Thermal Methods
Directory of Open Access Journals (Sweden)
Moorthi Chidambaram
2014-05-01
Full Text Available Purpose: Curcumin is a hydrophobic polyphenol isolated from dried rhizome of turmeric. Clinical usefulness of curcumin in the treatment of cancer is limited due to poor aqueous solubility, hydrolytic degradation, metabolism, and poor oral bioavailability. To overcome these limitations, we proposed to fabricate curcumin-piperine, curcumin-quercetin and curcumin-silibinin loaded polymeric nanoformulation. However, unfavourable combinations of drug-drug and drug-excipient may result in interaction and rises the safety concern. Hence, the present study was aimed to assess the interaction of curcumin with excipients used in nanoformulations. Methods: Isothermal stress testing method was used to assess the compatibility of drug-drug/drug-excipient. Results: The combination of curcumin-piperine, curcumin-quercetin, curcumin-silibinin and the combination of other excipients with curcumin, piperine, quercetin and silibinin have not shown any significant physical and chemical instability. Conclusion: The study concludes that the curcumin, piperine, quercetin and silibinin is compatible with each other and with other excipients.
Compatibility and survivorship of four beneficial microorganism used in boils in agriculture
Directory of Open Access Journals (Sweden)
Villacís-Aldaz Luis
2016-05-01
Full Text Available Compatibility and survival of a mixture of beneficial microorganisms in a biol used in agriculture were evaluated in order to generate new sustainable production technologies. The study was carried out in an agro ecological farm of the Provincial Government of Tungurahua. Survival and compatibility of Trichoderma harzianum, Metarhizium anisopliae, Beauveria bassiana and Paecilomyces lilacinus in a homemade boil were evaluated. Treatments consisted in adding 0 mL (T0, 50 mL (T1, 100 mL (T2 or 150 mL (T3 of a microorganism combination in 20 L biol. At day 30, higher population of Metarrhizium, Trichoderma and Beauveria was observed in T3 (9.1x105 UPC/mL biol at pH 3.80. At day 60, higher population was verified in T2 (2,1x106 UPC/mL at pH 4.95. Genera Paecilomyces and Beauveria were not observed growing together, suggesting a possible incompatibility between them.
Compatibility of packaging components with simulant mixed waste
International Nuclear Information System (INIS)
Nigrey, P.J.; Dickens, T.G.
1996-01-01
The purpose of hazardous and radioactive materials packaging is to enable these materials to be transported without posing a threat to the health or property of the general public. To achieve this aim, regulations in the US have been written establishing general design requirements for such packagings. While no regulations have been written specifically for mixed waste packaging, regulations for the constituents of mixed wastes, i.e., hazardous and radioactive substances, have been codified by the US Department of Transportation (US DOT, 49 CFR 173) and the US Nuclear Regulatory Commission (NRC, 10 CFR 71). Based on these national requirements, a Chemical Compatibility Testing Program was developed in the Transportation Systems Department at Sandia National Laboratories (SNL). The program provides a basis to assure any regulatory body that the issue of packaging material compatibility towards hazardous and radioactive materials has been addressed. In this paper, the authors present the results of the second phase of this testing program. The first phase screened five liner materials and six seal materials towards four simulant mixed wastes. This phase involved the comprehensive testing of five candidate liner materials to an aqueous Hanford Tank simulant mixed waste. The comprehensive testing protocol involved exposing the respective materials a matrix of four gamma radiation doses (∼ 1, 3, 6, and 40 kGy), three temperatures (18, 50, and 60 C), and four exposure times (7, 14, 28, and 180 days). Following their exposure to these combinations of conditions, the materials were evaluated by measuring five material properties. These properties were specific gravity, dimensional changes, hardness, stress cracking, and mechanical properties
Herald, Stephen D.; Frisby, Paul M.; Davis, Samuel Eddie
2009-01-01
Safe and reliable seal materials for high-pressure oxygen systems sometimes appear to be extinct species when sought out by oxygen systems designers. Materials that seal well are easy to find, but these materials are typically incompatible with oxygen, especially in cryogenic liquid form. This incompatibility can result in seals that leak, or much worse, seals that easily ignite and burn during use. Materials that are compatible with oxygen are easy to find, such as the long list of compatible metals, but these metallic materials are limiting as seal materials. A material that seals well and is oxygen compatible has been the big game in the designer's safari. Scientists at the Materials Combustion Research Facility (MCRF), part of NASA/Marshall Space Flight Center (MSFC), are constantly searching for better materials and processes to improve the safety of oxygen systems. One focus of this effort is improving the characteristics of polymers used in the presence of an oxygen enriched environment. Very few systems can be built which contain no polymeric materials; therefore, materials which have good impact resistance, low heat of combustion, high auto-ignition temperature and that maintain good mechanical properties are essential. The scientists and engineers at the Materials Combustion Research Facility, in cooperation with seal suppliers, are currently testing a new formulation of polytetrafluoroethylene (PTFE) with Brass filler. This Brass-filled PTFE is showing great promise as a seal and seat material for high pressure oxygen systems. Early research has demonstrated very encouraging results, which could rank this material as one of the best fluorinated polymers ever tested. This paper will compare the data obtained for Brass-filled PTFE with other fluorinated polymers, such as TFE-Teflon (PTFE) , Kel-F 81, Viton A, Viton A-500, Fluorel , and Algoflon . A similar metal filled fluorinated polymer, Salox-M , was tested in comparison to Brass-filled PTFE to
Ethnobotanique quantitative de l'usage de Chrysophyllum albidum ...
African Journals Online (AJOL)
SARAH
30 nov. 2015 ... Objective: Chrysophyllum albidum (African star apple) is a multiple purpose tree in Benin. It is threatened ..... Indian Fern. Journal, 15, 1/2: 61-64. Dossou M.E., Houessou G.L, Lougbégnon O.T., Tenté. A.H.B. &Codjia J.T.C. (2012). Étude ethnobotanique des ressources forestières ligneuses de la forêt ...
Creatinine and cytokines plasma levels related to HLA compatibility in kidney transplant patients
Directory of Open Access Journals (Sweden)
Lorraine V. Alves
2015-10-01
Full Text Available ABSTRACTIntroduction:The success of kidney transplantation depends on prevention of organ rejection by the recipient’s immune system, which recognizes alloantigens present in transplanted tissue. Human leukocyte antigen (HLA typing is one of the tests used in pre-renal transplantation and represents one of the most important factors for a successful procedure.Objective:The present study evaluated creatinine and cytokines plasma levels in kidney transplant patients according to pre-transplant HLA typing.Methods:We assessed 40 renal transplanted patients selected in two transplant centers in Belo Horizonte (MG.Results:Patients were distributed into three groups according to HLA compatibility and, through statistical analysis, the group with more than three matches (H3 was found to have significantly lower post-transplant creatinine levels, compared to groups with three or fewer matches (H2 and H1, respectively. The median plasma levels of cytokines interleukin 6 (IL-6, tumor necrosis factor alpha (TNF-α, and interleukin 10 (IL-10 were evaluated according to the number of matches. Pro-inflammatory cytokines (IL-6 and TNF-α were significantly higher in groups with lower HLA compatibility. On the other hand, the regulatory cytokine IL-10 had significantly higher plasma levels in the group with greater compatibility between donor and recipient.Conclusion:These findings allow us to infer that pre-transplant HLA typing of donors and recipients can influence post-transplant renal graft function and may contribute to the development and choice of new treatment strategies.
Jing, Chan Jer; Seman, Idris Abu; Zakaria, Latiffah
2015-01-01
Mating compatibility and restriction analyses of Internal Transcribed Spacer (ITS) regions were performed to determine the relations between Ganoderma boninense, the most common species associated with basal stem rot in oil palm and Ganoderma isolates from infected oil palm, two ornamental palms, sealing wax palm (Cyrtostachys renda) and MacArthur palm (Ptychosperma macarthurii), an isolate from coconut stump (Cocos nucifera), Ganoderma miniatocinctum, Ganoderma zonatum and Ganoderma tornatum. The results showed that G. boninense was compatible with Ganoderma isolates from oil palm, G. miniatocinctum and G. zonatum, Ganoderma isolates from sealing wax palm, MacArthur palm and coconut stump. G. boninense was not compatible with G. tornatum. Therefore, the results suggested that the G. boninense, G. miniatocinctum, G. zonatum, and Ganoderma isolates from oil palm, ornamental palms and coconut stump could represent the same biological species. In performing a restriction analysis of the ITS regions, variations were observed in which five haplotypes were generated from the restriction patterns. An unweighted pair-group method with arithmetic averages (UPGMA) cluster analysis showed that all the Ganoderma isolates were grouped into five primary groups, and the similarity values of the isolates ranged from 97% to 100%. Thus, a restriction analysis of the ITS regions showed that G. boninense and the Ganoderma isolates from other palm hosts were closely related. On the basis of the mating compatibility test and the restriction analysis of the ITS regions performed in this study, a diverse group of Ganoderma species from oil palm and other palm hosts are closely related, except for G. tornatum and Ganoderma isolates from tea and rubber. PMID:26868709
Liao, Yuzhen; Li, Linhua; Chen, Jiang; Yang, Ping; Zhao, Ansha; Sun, Hong; Huang, Nan
2017-07-01
Surfaces with dual functions that simultaneously exhibit good anticoagulant ability and endothelial cell (EC) compatibility are desirable for blood contact materials. However, these dual functions have rarely been achieved by inorganic materials. In this study, titanium dioxide (TiO 2 ) films were treated by sulphuric acid (H 2 SO 4 ) and ultraviolet (UV) irradiation successively (TiO 2 H 2 SO 4 -UV), resulting in good anticoagulant ability and EC compatibility simultaneously. We found that UV irradiation improved the anticoagulant ability of TiO 2 films significantly while enhancing EC compatibility, though not significantly. The enhanced anticoagulant ability could be related to the oxidation of surface-adsorbed hydrocarbons and increased hydrophilicity. The H 2 SO 4 treatment improved the anticoagulant ability of TiO 2 films slightly, while UV irradiation improved the anticoagulant ability strongly. The enhanced EC compatibility could be related to the increased surface roughness and positive charges on the surface of the TiO 2 films. Furthermore, the time-dependent degradation of the enhanced EC compatibility and anticoagulant ability of TiO 2 H 2 SO 4 -UV was observed. In summary, TiO 2 H 2 SO 4 -UV expressed both excellent anticoagulant ability and good EC compatibility at the same time, which could be desirable for blood contact materials. However, the compatibility of TiO 2 H 2 SO 4 -UV with smooth muscle cells (SMCs) and macrophages was also improved. More effort is still needed to selectively improve EC compatibility on TiO 2 films for better re-endothelialization. Copyright © 2017 Elsevier B.V. All rights reserved.
Synthetic Fischer-Tropsch (FT) JP-5/JP-8 Aviation Turbine Fuel Elastomer Compatibility
National Research Council Canada - National Science Library
Muzzell, Pat; Stavinoha, Leo; Chapin, Rebecca
2005-01-01
... to seal performance may arise, possibly leading to fuel leakage. The key objective of this study was to compare and contrast the material compatibility of nitrile coupons and O-rings with selected petroleum-derived fuels, Fisher-Tropsch (FT...
2018-04-01
The goal of the U.S. Department of Transportation (DOT) Global Positioning System (GPS) Adjacent Band Compatibility Assessment is to evaluate the maximum transmitted power levels of adjacent band radiofrequency (RF) systems that can be tolerated by G...